F428593

General Info

Members Datasets Scaffolds Average Seq Length
380 195 380 347

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100059849|Ga0070679_1000598495
Length 339
Sequence VTEELKSHYEKPSEMYDGLRLHQNENTEGCSPRVLEALARLTREDIAFYPPYSAATDAAARYFGVAADRVALVNGLDEGIMGAAIAYLRPSSATGGVPEAVVPEPAFEIFRFDTAVAFPLEEVLAAMTPATRLVFITNPNNPTGVPVPFDVIRTIATRAPKGAIVFVDEAYAEFAGRSFIPELASFPNVVVGRTFSKAFGLAGIRIGAVIGAPDVLDPIRYVVPVYGVNIAAVAAVQAALADVDYLNDYLRQVKASKALVYAACDRLALKYWRSDANFVLIRIGDRVGEVIDGARARGVFLRNRSTEPGCEGCLRMGAGVVEHTTRGLAALEEALCAAR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
129 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.26
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10035447 3300005327 Bacteria 4019
2 Ga0070676_10003399 3300005328 Bacteria 8284
3 Ga0070690_100026561 3300005330 Bacteria 3573
4 Ga0070677_10055617 3300005333 Bacteria 1616
5 Ga0070666_10076756 3300005335 Bacteria 2280
6 Ga0068868_100037062 3300005338 Bacteria 3779
7 Ga0068868_100197166 3300005338 Bacteria 1677
8 Ga0068868_100234080 3300005338 Bacteria 1542
9 Ga0070689_100003616 3300005340 Bacteria 10308
10 Ga0070689_100270138 3300005340 Bacteria 1407
11 Ga0070691_10004501 3300005341 Bacteria 6326
12 Ga0070687_100102520 3300005343 Unclassified 1605
13 Ga0070687_100102974 3300005343 Bacteria 1602
14 Ga0070661_100029871 3300005344 Bacteria 3936
15 Ga0070669_100010795 3300005353 Bacteria 6484
16 Ga0070669_100021889 3300005353 Bacteria 4572
17 Ga0070669_100033258 3300005353 Bacteria 3728
18 Ga0070675_100000116 3300005354 Bacteria 46828
19 Ga0070675_100215022 3300005354 Unclassified 1672
20 Ga0070671_100020610 3300005355 Bacteria 5379
21 Ga0070674_100003653 3300005356 Bacteria 8667
22 Ga0070673_100010726 3300005364 Bacteria 6214
23 Ga0070667_100103537 3300005367 Bacteria 2461
24 Ga0070714_100118769 3300005435 Bacteria 2349
25 Ga0070700_100004115 3300005441 Bacteria 7577
26 Ga0070700_100009100 3300005441 Bacteria 5442
27 Ga0070694_100040793 3300005444 Bacteria 3095
28 Ga0070694_100044841 3300005444 Bacteria 2960
29 Ga0070708_100045479 3300005445 Bacteria 3867
30 Ga0070708_100309498 3300005445 Unclassified 1488
31 Ga0070678_100299242 3300005456 Bacteria 1367
32 Ga0070681_10018679 3300005458 Bacteria 6934
33 Ga0068867_100001221 3300005459 Bacteria 17681
34 Ga0068867_100027034 3300005459 Bacteria 4122
35 Ga0068867_100029048 3300005459 Bacteria 3984
36 Ga0068867_100108321 3300005459 Bacteria 2131
37 Ga0070685_10125297 3300005466 Bacteria 1600
38 Ga0070706_100447921 3300005467 Bacteria 1201
39 Ga0070706_100470168 3300005467 Bacteria 1170
40 Ga0070707_100202303 3300005468 Unclassified 1936
41 Ga0070698_100023457 3300005471 Bacteria 6450
42 Ga0070698_100036368 3300005471 Bacteria 5087
43 Ga0070698_100046872 3300005471 Bacteria 4419
44 Ga0070698_100114730 3300005471 Bacteria 2658
45 Ga0070699_100020526 3300005518 Bacteria 5700
46 Ga0070699_100131180 3300005518 Bacteria 2209
47 Ga0070699_100147438 3300005518 Bacteria 2079
48 Ga0070699_100298651 3300005518 Bacteria 1445
49 Ga0070679_100048750 3300005530 Bacteria 4219
50 Ga0070679_100059849 3300005530 Bacteria 3796
51 Ga0070679_100095270 3300005530 Bacteria 2964
52 Ga0070697_100059662 3300005536 Bacteria 3107
53 Ga0068853_100330130 3300005539 Bacteria 1415
54 Ga0070672_100022705 3300005543 Bacteria 4614
55 Ga0070686_100001728 3300005544 Bacteria 12204
56 Ga0070695_100009685 3300005545 Bacteria 5738
57 Ga0070695_100055096 3300005545 Bacteria 2562
58 Ga0070695_100078084 3300005545 Bacteria 2182
59 Ga0070696_100014970 3300005546 Bacteria 5207
60 Ga0070665_100003078 3300005548 Bacteria 17959
61 Ga0070665_100003293 3300005548 Bacteria 17316
62 Ga0070665_100022242 3300005548 Bacteria 6378
63 Ga0070665_100062216 3300005548 Bacteria 3743
64 Ga0070665_100093236 3300005548 Bacteria 3016
65 Ga0068855_100003974 3300005563 Bacteria 18058
66 Ga0070664_100234004 3300005564 Bacteria 1647
67 Ga0068854_100003422 3300005578 Bacteria 9895
68 Ga0068854_100019066 3300005578 Bacteria 4617
69 Ga0068854_100039765 3300005578 Bacteria 3315
70 Ga0070702_100000436 3300005615 Bacteria 14867
71 Ga0068859_100051448 3300005617 Unclassified 4141
72 Ga0068859_100102718 3300005617 Bacteria 2916
73 Ga0068864_100024024 3300005618 Bacteria 5124
74 Ga0068864_100046038 3300005618 Bacteria 3743
75 Ga0068864_100119749 3300005618 Bacteria 2352
76 Ga0068866_10037290 3300005718 Bacteria 2387
77 Ga0068866_10089893 3300005718 Bacteria 1670
78 Ga0068861_100000519 3300005719 Bacteria 22568
79 Ga0068861_100017344 3300005719 Bacteria 5110
80 Ga0068861_100034075 3300005719 Bacteria 3763
81 Ga0068863_100027636 3300005841 Bacteria 5413
82 Ga0068858_100003288 3300005842 Bacteria 16098
83 Ga0068858_100034564 3300005842 Bacteria 4689
84 Ga0068860_100114722 3300005843 Bacteria 2576
85 Ga0068860_100261626 3300005843 Bacteria 1686
86 Ga0068862_100024390 3300005844 Bacteria 5074
87 Ga0068862_100062993 3300005844 Bacteria 3190
88 Ga0068862_100123238 3300005844 Bacteria 2286
89 Ga0068862_100150596 3300005844 Bacteria 2070
90 Ga0081455_10028039 3300005937 Bacteria 5149
91 Ga0081539_10039875 3300005985 Bacteria 2765
92 Ga0070716_100010837 3300006173 Bacteria 4584
93 Ga0070716_100092811 3300006173 Bacteria 1831
94 Ga0097621_100003292 3300006237 Bacteria 11111
95 Ga0068871_100002048 3300006358 Bacteria 13659
96 Ga0068871_100160767 3300006358 Bacteria 1921
97 Ga0068871_100172873 3300006358 Bacteria 1853
98 Ga0075428_100225567 3300006844 Bacteria 2023
99 Ga0075428_100272047 3300006844 Bacteria 1823
100 Ga0075431_100032912 3300006847 Bacteria 5342
101 Ga0075431_100047480 3300006847 Bacteria 4427
102 Ga0075433_10025117 3300006852 Bacteria 5036
103 Ga0075433_10040585 3300006852 Bacteria 4029
104 Ga0075433_10041260 3300006852 Bacteria 3997
105 Ga0075434_100000264 3300006871 Bacteria 37263
106 Ga0075434_100002266 3300006871 Bacteria 16832
107 Ga0075434_100002447 3300006871 Bacteria 16345
108 Ga0075434_100084568 3300006871 Bacteria 3171
109 Ga0075434_100258509 3300006871 Bacteria 1760
110 Ga0075434_100268332 3300006871 Bacteria 1726
111 Ga0075434_100293805 3300006871 Bacteria 1645
112 Ga0075429_100069834 3300006880 Bacteria 3058
113 Ga0068865_100131793 3300006881 Bacteria 1874
114 Ga0068865_100147112 3300006881 Bacteria 1783
115 Ga0075436_100000694 3300006914 Bacteria 22204
116 Ga0075436_100025705 3300006914 Archaea 4052
117 Ga0075436_100126827 3300006914 Unclassified 1788
118 Ga0075436_100139501 3300006914 Bacteria 1703
119 Ga0097620_100051445 3300006931 Unclassified 4141
120 Ga0097620_100102720 3300006931 Bacteria 2916
121 Ga0075435_100000163 3300007076 Bacteria 38632
122 Ga0075435_100003822 3300007076 Bacteria 10277
123 Ga0075435_100004567 3300007076 Bacteria 9526
124 Ga0075435_100031814 3300007076 Bacteria 4161
125 Ga0075435_100057482 3300007076 Bacteria 3147
126 Ga0075435_100086041 3300007076 Bacteria 2588
127 Ga0075435_100096673 3300007076 Bacteria 2443
128 Ga0075435_100118324 3300007076 Bacteria 2208
129 Ga0105240_10027396 3300009093 Bacteria 7459
130 Ga0105240_10068056 3300009093 Bacteria 4412
131 Ga0105240_10225388 3300009093 Bacteria 2181
132 Ga0105240_10295845 3300009093 Bacteria 1854
133 Ga0105240_10317592 3300009093 Bacteria 1776
134 Ga0111539_10011384 3300009094 Bacteria 11168
135 Ga0111539_10022857 3300009094 Bacteria 7679
136 Ga0105245_10060671 3300009098 Bacteria 3406
137 Ga0105245_10398984 3300009098 Bacteria 1374
138 Ga0105247_10035422 3300009101 Bacteria 3042
139 Ga0114129_10002855 3300009147 Bacteria 24166
140 Ga0114129_10003232 3300009147 Bacteria 22871
141 Ga0114129_10005775 3300009147 Bacteria 17527
142 Ga0114129_10015399 3300009147 Bacteria 10881
143 Ga0114129_10052156 3300009147 Bacteria 5741
144 Ga0114129_10175658 3300009147 Bacteria 2917
145 Ga0114129_10178848 3300009147 Bacteria 2888
146 Ga0114129_10322110 3300009147 Bacteria 2055
147 Ga0105243_10004718 3300009148 Bacteria 10732
148 Ga0105243_10186119 3300009148 Bacteria 1810
149 Ga0105241_10028556 3300009174 Bacteria 4158
150 Ga0105242_10020241 3300009176 Bacteria 5217
151 Ga0105242_10340937 3300009176 Bacteria 1381
152 Ga0105248_10038706 3300009177 Bacteria 5338
153 Ga0105248_10044083 3300009177 Bacteria 5002
154 Ga0105248_10076842 3300009177 Bacteria 3753
155 Ga0105248_10193812 3300009177 Bacteria 2289
156 Ga0105248_10379288 3300009177 Bacteria 1592
157 Ga0105249_10027405 3300009553 Bacteria 5140
158 Ga0105249_10447343 3300009553 Bacteria 1330
159 Ga0105246_10150172 3300011119 Bacteria 1763
160 Ga0157369_10094426 3300013105 Bacteria 3193
161 Ga0157374_10015726 3300013296 Bacteria 6644
162 Ga0157378_10072346 3300013297 Bacteria 3098
163 Ga0163162_10240479 3300013306 Bacteria 1941
164 Ga0157375_10102918 3300013308 Bacteria 2942
165 Ga0157375_10228546 3300013308 Bacteria 2019
166 Ga0163163_10081161 3300014325 Bacteria 3244
167 Ga0157380_10021339 3300014326 Bacteria 4856
168 Ga0157380_10243584 3300014326 Bacteria 1623
169 Ga0157380_10416209 3300014326 Bacteria 1280
170 Ga0157377_10203158 3300014745 Bacteria 1259
171 Ga0157379_10010798 3300014968 Bacteria 7961
172 Ga0157379_10026054 3300014968 Bacteria 5202
173 Ga0157379_10131913 3300014968 Bacteria 2249
174 Ga0157376_10088018 3300014969 Bacteria 2681
175 Ga0207680_10041682 3300025903 Bacteria 2681
176 Ga0207680_10044931 3300025903 Bacteria 2601
177 Ga0207645_10010064 3300025907 Bacteria 6511
178 Ga0207643_10054655 3300025908 Bacteria 2270
179 Ga0207705_10020745 3300025909 Bacteria 4690
180 Ga0207695_10053939 3300025913 Bacteria 4201
181 Ga0207695_10193271 3300025913 Bacteria 1952
182 Ga0207695_10246823 3300025913 Bacteria 1685
183 Ga0207662_10020080 3300025918 Bacteria 3810
184 Ga0207657_10004533 3300025919 Bacteria 14676
185 Ga0207649_10007249 3300025920 Bacteria 6026
186 Ga0207652_10037506 3300025921 Bacteria 4103
187 Ga0207652_10128376 3300025921 Bacteria 2260
188 Ga0207646_10030753 3300025922 Bacteria 4865
189 Ga0207646_10240193 3300025922 Bacteria 1637
190 Ga0207681_10016450 3300025923 Bacteria 4628
191 Ga0207681_10067536 3300025923 Bacteria 2479
192 Ga0207694_10031624 3300025924 Bacteria 4045
193 Ga0207694_10062421 3300025924 Bacteria 2901
194 Ga0207659_10000064 3300025926 Bacteria 67058
195 Ga0207659_10079607 3300025926 Bacteria 2418
196 Ga0207659_10163076 3300025926 Bacteria 1752
197 Ga0207687_10009331 3300025927 Bacteria 6417
198 Ga0207700_10023052 3300025928 Bacteria 4284
199 Ga0207644_10034322 3300025931 Bacteria 3549
200 Ga0207644_10128951 3300025931 Bacteria 1934
201 Ga0207706_10104457 3300025933 Bacteria 2493
202 Ga0207686_10010294 3300025934 Bacteria 5089
203 Ga0207709_10122611 3300025935 Bacteria 1758
204 Ga0207670_10082760 3300025936 Bacteria 2250
205 Ga0207704_10132482 3300025938 Bacteria 1729
206 Ga0207665_10026731 3300025939 Bacteria 3811
207 Ga0207665_10048061 3300025939 Bacteria 2862
208 Ga0207691_10010360 3300025940 Bacteria 8942
209 Ga0207711_10023512 3300025941 Bacteria 5158
210 Ga0207711_10038401 3300025941 Bacteria 4072
211 Ga0207711_10321044 3300025941 Bacteria 1431
212 Ga0207689_10048993 3300025942 Bacteria 3485
213 Ga0207689_10055233 3300025942 Bacteria 3269
214 Ga0207689_10062697 3300025942 Bacteria 3057
215 Ga0207679_10127564 3300025945 Bacteria 2036
216 Ga0207667_10467340 3300025949 Bacteria 1281
217 Ga0207651_10540901 3300025960 Bacteria 1012
218 Ga0207712_10059399 3300025961 Bacteria 2706
219 Ga0207712_10192574 3300025961 Bacteria 1610
220 Ga0207640_10031620 3300025981 Bacteria 3273
221 Ga0207640_10033666 3300025981 Bacteria 3190
222 Ga0207658_10033948 3300025986 Bacteria 3642
223 Ga0207658_10459780 3300025986 Bacteria 1128
224 Ga0207677_10004306 3300026023 Bacteria 7623
225 Ga0207677_10096660 3300026023 Bacteria 2162
226 Ga0207703_10028142 3300026035 Bacteria 4428
227 Ga0207703_10030964 3300026035 Bacteria 4230
228 Ga0207703_10035162 3300026035 Bacteria 3981
229 Ga0207703_10306573 3300026035 Bacteria 1450
230 Ga0207703_10438557 3300026035 Bacteria 1218
231 Ga0207703_10460890 3300026035 Bacteria 1189
232 Ga0207639_10259216 3300026041 Bacteria 1520
233 Ga0207708_10003903 3300026075 Bacteria 10973
234 Ga0207708_10016651 3300026075 Bacteria 5531
235 Ga0207708_10163640 3300026075 Bacteria 1758
236 Ga0207641_10000723 3300026088 Bacteria 35443
237 Ga0207648_10004153 3300026089 Bacteria 14980
238 Ga0207648_10023751 3300026089 Bacteria 5485
239 Ga0207648_10050275 3300026089 Bacteria 3645
240 Ga0207648_10253763 3300026089 Bacteria 1568
241 Ga0207676_10029410 3300026095 Bacteria 4113
242 Ga0207676_10050364 3300026095 Bacteria 3247
243 Ga0207676_10170831 3300026095 Bacteria 1894
244 Ga0207675_100001546 3300026118 Bacteria 23054
245 Ga0207675_100010841 3300026118 Bacteria 8539
246 Ga0207675_100018097 3300026118 Bacteria 6568
247 Ga0207675_100029257 3300026118 Bacteria 5132
248 Ga0207675_100298000 3300026118 Bacteria 1570
249 Ga0207683_10018503 3300026121 Bacteria 5945
250 Ga0207683_10117113 3300026121 Bacteria 2389
251 Ga0207683_10179394 3300026121 Bacteria 1920
252 Ga0207683_10189294 3300026121 Bacteria 1868
253 Ga0207428_10006808 3300027907 Bacteria 10483
254 Ga0207428_10231067 3300027907 Bacteria 1384
255 Ga0268266_10009913 3300028379 Bacteria 8368
256 Ga0268266_10060998 3300028379 Bacteria 3252
257 Ga0268266_10066101 3300028379 Bacteria 3126
258 Ga0268266_10094414 3300028379 Bacteria 2625
259 Ga0268265_10018349 3300028380 Bacteria 4846
260 Ga0268265_10055077 3300028380 Bacteria 3020
261 Ga0268265_10106873 3300028380 Bacteria 2274
262 Ga0265332_10037411 3300031238 Bacteria 2105
263 Ga0373930_0008658 3300034816 Bacteria 1784
264 Ga0373950_0000305 3300034818 Bacteria 6188
265 Ga0373938_0000220 3300034957 Bacteria 8769
266 Ga0373949_0005049 3300035090 Bacteria 2970
267 Ga0373952_0002395 3300035092 Bacteria 3377
268 Ga0373939_0001341 3300035114 Bacteria 5963
269 Ga0373941_0000459 3300035115 Bacteria 8133
270 Ga0373941_0011372 3300035115 Bacteria 2298
271 Ga0373960_0000115 3300035121 Bacteria 12973
272 Ga0373960_0021260 3300035121 Bacteria 1724
273 Ga0373943_0008095 3300035170 Bacteria 4715
274 Ga0373942_0000216 3300035207 Bacteria 15152
275 Ga0373961_0002594 3300035241 Bacteria 4651
276 Ga0373962_0001428 3300035242 Bacteria 5637
277 Ga0373924_0020027 3300035410 Bacteria 2596
278 Ga0373931_0014367 3300035691 Bacteria 3867
279 Ga0373931_0128336 3300035691 Bacteria 1457
280 Ga0373935_0013843 3300035692 Bacteria 4870
281 Ga0373947_0005003 3300035725 Bacteria 7759
282 Ga0373937_0060901 3300036401 Bacteria 3469
283 Ga0373937_0103466 3300036401 Bacteria 2645
284 Ga0373937_0221254 3300036401 Bacteria 1782
285 Ga0373925_0016067 3300037068 Bacteria 5420
286 Ga0373925_0020175 3300037068 Bacteria 4851
287 Ga0373925_0060722 3300037068 Bacteria 2839
288 Ga0466963_0013892 3300044694 Bacteria 4958
289 Ga0466957_0139832 3300044842 Bacteria 1559
290 Ga0451576_0005342 3300045051 Bacteria 16150
291 Ga0466967_0551897 3300045976 Bacteria 1134
292 Ga0495592_0037832 3300046454 Bacteria 3631
293 Ga0495629_0139719 3300046459 Bacteria 1686
294 Ga0495653_0062124 3300046463 Bacteria 2824
295 Ga0495582_0134210 3300046473 Bacteria 1400
296 Ga0495608_0005849 3300046511 Bacteria 8756
297 Ga0495630_0027662 3300046517 Bacteria 4209
298 Ga0495640_0167505 3300046533 Archaea 1405
299 Ga0495621_0016719 3300046539 Bacteria 2360
300 Ga0495645_0001612 3300046543 Bacteria 15271
301 Ga0495645_0043909 3300046543 Bacteria 3260
302 Ga0495645_0201803 3300046543 Bacteria 1348
303 Ga0495635_0076596 3300046663 Bacteria 2292
304 Ga0495635_0091303 3300046663 Bacteria 2083
305 Ga0495647_0054602 3300046681 Bacteria 1562
306 Ga0495658_0100434 3300046683 Bacteria 1727
307 Ga0495613_0013803 3300046689 Bacteria 5992
308 Ga0495613_0081432 3300046689 Bacteria 2352
309 Ga0495600_0027231 3300046809 Bacteria 3694
310 Ga0495600_0102521 3300046809 Bacteria 1865
311 Ga0495604_0021253 3300047317 Bacteria 5181
312 Ga0495674_0032485 3300047319 Bacteria 4733
313 Ga0495674_0189252 3300047319 Bacteria 1711
314 Ga0495684_0018047 3300047471 Bacteria 5437
315 Ga0496100_0000941 3300048903 Bacteria 13917
316 Ga0496101_0001279 3300048904 Bacteria 15052
317 Ga0496101_0329352 3300048904 Bacteria 1199
318 Ga0496102_0142752 3300048905 Bacteria 2246
319 Ga0496102_0221972 3300048905 Bacteria 1782
320 Ga0496102_0318021 3300048905 Bacteria 1466
321 Ga0496103_0151870 3300048906 Bacteria 1484
322 Ga0496104_0060217 3300048907 Bacteria 3597
323 Ga0496104_0105262 3300048907 Bacteria 2704
324 Ga0496105_0254796 3300048908 Bacteria 1421
325 Ga0496108_0002181 3300048911 Bacteria 15709
326 Ga0496109_0086326 3300048912 Bacteria 2898
327 Ga0496109_0151914 3300048912 Bacteria 2168
328 Ga0496110_0024307 3300048913 Bacteria 5163
329 Ga0496112_0104043 3300048915 Bacteria 2809
330 Ga0496112_0245172 3300048915 Bacteria 1744
331 Ga0496113_0156477 3300048916 Bacteria 1800
332 Ga0496114_0000226 3300048917 Bacteria 40968
333 Ga0496114_0037274 3300048917 Bacteria 4021
334 Ga0496115_0054923 3300048918 Bacteria 3199
335 Ga0501034_0087747 3300049571 Bacteria 3110
336 Ga0501046_0324963 3300049580 Bacteria 1120
337 Ga0501047_0015566 3300049581 Bacteria 7247
338 Ga0501073_0111729 3300049589 Bacteria 1895
339 Ga0501083_0188607 3300049744 Bacteria 1346
340 nmdc:mga05p37_10907_c1 3300050507 Bacteria 10790
341 nmdc:mga05p37_125961_c1 3300050507 Bacteria 3146
342 nmdc:mga05p37_148931_c1 3300050507 Bacteria 2864
343 nmdc:mga05p37_15017_c1 3300050507 Bacteria 9297
344 nmdc:mga05p37_181471_c1 3300050507 Bacteria 2560
345 nmdc:mga05p37_305175_c1 3300050507 Bacteria 1889
346 nmdc:mga05p37_40665_c1 3300050507 Bacteria 5709
347 nmdc:mga09592_54422_c1 3300050508 Bacteria 3381
348 nmdc:mga06r32_70471_c1 3300050510 Bacteria 3381
349 nmdc:mga06r32_72622_c1 3300050510 Bacteria 3331
350 nmdc:mga08y16_34184_c1 3300050511 Bacteria 5340
351 nmdc:mga08y16_38877_c1 3300050511 Bacteria 4994
352 nmdc:mga0n895_12437_c1 3300050512 Bacteria 7635
353 nmdc:mga0n895_12_c1 3300050512 Bacteria 112043
354 nmdc:mga0n895_158355_c1 3300050512 Bacteria 2296
355 nmdc:mga0n895_174372_c1 3300050512 Bacteria 2181
356 nmdc:mga0n895_18663_c1 3300050512 Bacteria 6424
357 nmdc:mga0n895_288011_c1 3300050512 Bacteria 1665
358 nmdc:mga0n895_306802_c1 3300050512 Bacteria 1609
359 nmdc:mga0n895_63659_c1 3300050512 Bacteria 3647
360 nmdc:mga0rr50_191_c1 3300050513 Bacteria 33287
361 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
362 nmdc:mga0rr50_228258_c1 3300050513 Bacteria 1540
363 nmdc:mga0rr50_66018_c1 3300050513 Bacteria 2743
364 nmdc:mga0rr50_7227_c1 3300050513 Bacteria 6829
365 nmdc:mga0rr50_7461_c1 3300050513 Bacteria 6749
366 nmdc:mga08x19_22680_c1 3300050514 Bacteria 3888
367 nmdc:mga08x19_5011_c1 3300050514 Bacteria 7832
368 nmdc:mga08x19_50741_c1 3300050514 Bacteria 2663
369 nmdc:mga08x19_87_c1 3300050514 Bacteria 83168
370 nmdc:mga0a205_10463_c1 3300050515 Bacteria 8521
371 nmdc:mga0a205_119837_c1 3300050515 Bacteria 2530
372 nmdc:mga0a205_22854_c1 3300050515 Bacteria 5928
373 nmdc:mga0a205_46923_c1 3300050515 Bacteria 4167
374 nmdc:mga0a205_49577_c1 3300050515 Bacteria 4054
375 Ga0495601_0029476 3300053077 Bacteria 3404
376 Ga0495601_0151939 3300053077 Bacteria 1511
377 Ga0495601_0165943 3300053077 Bacteria 1443
378 Ga0495619_0007028 3300053085 Bacteria 7121
379 Ga0495619_0021800 3300053085 Bacteria 4093
380 Ga0501082_0080033 3300060353 Bacteria 2819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025960 Ga0207651_10540901 Ga0207651_105409011 310
2 3300005545 Ga0070695_100055096 Ga0070695_1000550963 315
3 3300006871 Ga0075434_100002447 Ga0075434_1000024475 329
4 3300006914 Ga0075436_100126827 Ga0075436_1001268272 329
5 3300007076 Ga0075435_100031814 Ga0075435_1000318144 329
6 3300050512 nmdc:mga0n895_158355_c1 nmdc:mga0n895_158355_c1_276_1319 329
7 3300050513 nmdc:mga0rr50_228258_c1 nmdc:mga0rr50_228258_c1_354_1397 329
8 3300005518 Ga0070699_100020526 Ga0070699_1000205266 331
9 3300006871 Ga0075434_100268332 Ga0075434_1002683322 331
10 3300006914 Ga0075436_100025705 Ga0075436_1000257052 331
11 3300007076 Ga0075435_100118324 Ga0075435_1001183242 331
12 3300050512 nmdc:mga0n895_288011_c1 nmdc:mga0n895_288011_c1_16_1059 331
13 3300050514 nmdc:mga08x19_22680_c1 nmdc:mga08x19_22680_c1_951_1994 331
14 3300050514 nmdc:mga08x19_50741_c1 nmdc:mga08x19_50741_c1_831_1874 331
15 3300006871 Ga0075434_100000264 Ga0075434_10000026410 332
16 3300006914 Ga0075436_100000694 Ga0075436_1000006948 332
17 3300007076 Ga0075435_100000163 Ga0075435_10000016326 332
18 3300050512 nmdc:mga0n895_12_c1 nmdc:mga0n895_12_c1_71054_72097 332
19 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_216414_217457 332
20 3300050514 nmdc:mga08x19_87_c1 nmdc:mga08x19_87_c1_23399_24442 332
21 3300005340 Ga0070689_100003616 Ga0070689_1000036163 333
22 3300005530 Ga0070679_100059849 Ga0070679_1000598495 333
23 3300005617 Ga0068859_100051448 Ga0068859_1000514482 333
24 3300006931 Ga0097620_100051445 Ga0097620_1000514452 333
25 3300025921 Ga0207652_10128376 Ga0207652_101283762 333
26 3300009093 Ga0105240_10295845 Ga0105240_102958451 335
27 3300025931 Ga0207644_10128951 Ga0207644_101289511 335
28 3300026118 Ga0207675_100010841 Ga0207675_1000108418 335
29 3300046681 Ga0495647_0054602 Ga0495647_0054602_163_1206 338
30 3300009147 Ga0114129_10015399 Ga0114129_100153995 339
31 3300050507 nmdc:mga05p37_15017_c1 nmdc:mga05p37_15017_c1_951_1994 339
32 3300050515 nmdc:mga0a205_119837_c1 nmdc:mga0a205_119837_c1_196_1239 342
33 3300026121 Ga0207683_10018503 Ga0207683_100185036 344
34 3300005468 Ga0070707_100202303 Ga0070707_1002023032 346
35 3300005471 Ga0070698_100023457 Ga0070698_1000234573 346
36 3300005985 Ga0081539_10039875 Ga0081539_100398753 346
37 3300009177 Ga0105248_10038706 Ga0105248_100387065 346
38 3300025941 Ga0207711_10023512 Ga0207711_100235124 346
39 3300045976 Ga0466967_0551897 Ga0466967_0551897_64_1107 346
40 3300005327 Ga0070658_10035447 Ga0070658_100354472 347
41 3300005328 Ga0070676_10003399 Ga0070676_100033997 347
42 3300005330 Ga0070690_100026561 Ga0070690_1000265614 347
43 3300005333 Ga0070677_10055617 Ga0070677_100556171 347
44 3300005335 Ga0070666_10076756 Ga0070666_100767562 347
45 3300005338 Ga0068868_100037062 Ga0068868_1000370624 347
46 3300005338 Ga0068868_100197166 Ga0068868_1001971662 347
47 3300005338 Ga0068868_100234080 Ga0068868_1002340802 347
48 3300005340 Ga0070689_100270138 Ga0070689_1002701382 347
49 3300005341 Ga0070691_10004501 Ga0070691_100045013 347
50 3300005343 Ga0070687_100102520 Ga0070687_1001025202 347
51 3300005343 Ga0070687_100102974 Ga0070687_1001029742 347
52 3300005344 Ga0070661_100029871 Ga0070661_1000298712 347
53 3300005353 Ga0070669_100010795 Ga0070669_1000107957 347
54 3300005353 Ga0070669_100021889 Ga0070669_1000218892 347
55 3300005353 Ga0070669_100033258 Ga0070669_1000332581 347
56 3300005354 Ga0070675_100000116 Ga0070675_10000011610 347
57 3300005354 Ga0070675_100215022 Ga0070675_1002150222 347
58 3300005355 Ga0070671_100020610 Ga0070671_1000206102 347
59 3300005356 Ga0070674_100003653 Ga0070674_1000036532 347
60 3300005364 Ga0070673_100010726 Ga0070673_1000107266 347
61 3300005367 Ga0070667_100103537 Ga0070667_1001035372 347
62 3300005435 Ga0070714_100118769 Ga0070714_1001187692 347
63 3300005441 Ga0070700_100004115 Ga0070700_1000041157 347
64 3300005441 Ga0070700_100009100 Ga0070700_1000091002 347
65 3300005444 Ga0070694_100040793 Ga0070694_1000407932 347
66 3300005444 Ga0070694_100044841 Ga0070694_1000448412 347
67 3300005445 Ga0070708_100045479 Ga0070708_1000454792 347
68 3300005445 Ga0070708_100309498 Ga0070708_1003094981 347
69 3300005456 Ga0070678_100299242 Ga0070678_1002992421 347
70 3300005458 Ga0070681_10018679 Ga0070681_100186796 347
71 3300005459 Ga0068867_100001221 Ga0068867_1000012219 347
72 3300005459 Ga0068867_100027034 Ga0068867_1000270342 347
73 3300005459 Ga0068867_100029048 Ga0068867_1000290483 347
74 3300005459 Ga0068867_100108321 Ga0068867_1001083212 347
75 3300005466 Ga0070685_10125297 Ga0070685_101252972 347
76 3300005467 Ga0070706_100447921 Ga0070706_1004479211 347
77 3300005467 Ga0070706_100470168 Ga0070706_1004701681 347
78 3300005471 Ga0070698_100036368 Ga0070698_1000363685 347
79 3300005471 Ga0070698_100046872 Ga0070698_1000468724 347
80 3300005471 Ga0070698_100114730 Ga0070698_1001147302 347
81 3300005518 Ga0070699_100131180 Ga0070699_1001311801 347
82 3300005518 Ga0070699_100147438 Ga0070699_1001474382 347
83 3300005518 Ga0070699_100298651 Ga0070699_1002986512 347
84 3300005530 Ga0070679_100048750 Ga0070679_1000487503 347
85 3300005530 Ga0070679_100095270 Ga0070679_1000952704 347
86 3300005536 Ga0070697_100059662 Ga0070697_1000596622 347
87 3300005539 Ga0068853_100330130 Ga0068853_1003301302 347
88 3300005543 Ga0070672_100022705 Ga0070672_1000227052 347
89 3300005544 Ga0070686_100001728 Ga0070686_1000017284 347
90 3300005545 Ga0070695_100009685 Ga0070695_1000096854 347
91 3300005545 Ga0070695_100078084 Ga0070695_1000780842 347
92 3300005546 Ga0070696_100014970 Ga0070696_1000149706 347
93 3300005548 Ga0070665_100003078 Ga0070665_1000030787 347
94 3300005548 Ga0070665_100003293 Ga0070665_10000329311 347
95 3300005548 Ga0070665_100022242 Ga0070665_1000222423 347
96 3300005548 Ga0070665_100062216 Ga0070665_1000622162 347
97 3300005548 Ga0070665_100093236 Ga0070665_1000932364 347
98 3300005563 Ga0068855_100003974 Ga0068855_10000397410 347
99 3300005564 Ga0070664_100234004 Ga0070664_1002340042 347
100 3300005578 Ga0068854_100003422 Ga0068854_1000034226 347
101 3300005578 Ga0068854_100019066 Ga0068854_1000190662 347
102 3300005578 Ga0068854_100039765 Ga0068854_1000397652 347
103 3300005615 Ga0070702_100000436 Ga0070702_1000004363 347
104 3300005617 Ga0068859_100102718 Ga0068859_1001027183 347
105 3300005618 Ga0068864_100024024 Ga0068864_1000240243 347
106 3300005618 Ga0068864_100046038 Ga0068864_1000460383 347
107 3300005618 Ga0068864_100119749 Ga0068864_1001197493 347
108 3300005718 Ga0068866_10037290 Ga0068866_100372902 347
109 3300005718 Ga0068866_10089893 Ga0068866_100898932 347
110 3300005719 Ga0068861_100000519 Ga0068861_1000005197 347
111 3300005719 Ga0068861_100017344 Ga0068861_1000173445 347
112 3300005719 Ga0068861_100034075 Ga0068861_1000340752 347
113 3300005841 Ga0068863_100027636 Ga0068863_1000276365 347
114 3300005842 Ga0068858_100003288 Ga0068858_10000328811 347
115 3300005842 Ga0068858_100034564 Ga0068858_1000345643 347
116 3300005843 Ga0068860_100114722 Ga0068860_1001147222 347
117 3300005843 Ga0068860_100261626 Ga0068860_1002616262 347
118 3300005844 Ga0068862_100024390 Ga0068862_1000243904 347
119 3300005844 Ga0068862_100062993 Ga0068862_1000629932 347
120 3300005844 Ga0068862_100123238 Ga0068862_1001232382 347
121 3300005844 Ga0068862_100150596 Ga0068862_1001505962 347
122 3300005937 Ga0081455_10028039 Ga0081455_100280394 347
123 3300006173 Ga0070716_100010837 Ga0070716_1000108373 347
124 3300006173 Ga0070716_100092811 Ga0070716_1000928112 347
125 3300006237 Ga0097621_100003292 Ga0097621_1000032928 347
126 3300006358 Ga0068871_100002048 Ga0068871_1000020485 347
127 3300006358 Ga0068871_100160767 Ga0068871_1001607673 347
128 3300006358 Ga0068871_100172873 Ga0068871_1001728732 347
129 3300006844 Ga0075428_100225567 Ga0075428_1002255672 347
130 3300006844 Ga0075428_100272047 Ga0075428_1002720472 347
131 3300006847 Ga0075431_100032912 Ga0075431_1000329127 347
132 3300006847 Ga0075431_100047480 Ga0075431_1000474804 347
133 3300006852 Ga0075433_10025117 Ga0075433_100251172 347
134 3300006852 Ga0075433_10040585 Ga0075433_100405852 347
135 3300006852 Ga0075433_10041260 Ga0075433_100412602 347
136 3300006871 Ga0075434_100002266 Ga0075434_1000022667 347
137 3300006871 Ga0075434_100084568 Ga0075434_1000845684 347
138 3300006871 Ga0075434_100258509 Ga0075434_1002585092 347
139 3300006871 Ga0075434_100293805 Ga0075434_1002938052 347
140 3300006880 Ga0075429_100069834 Ga0075429_1000698342 347
141 3300006881 Ga0068865_100131793 Ga0068865_1001317932 347
142 3300006881 Ga0068865_100147112 Ga0068865_1001471122 347
143 3300006914 Ga0075436_100139501 Ga0075436_1001395012 347
144 3300006931 Ga0097620_100102720 Ga0097620_1001027203 347
145 3300007076 Ga0075435_100003822 Ga0075435_1000038227 347
146 3300007076 Ga0075435_100004567 Ga0075435_1000045678 347
147 3300007076 Ga0075435_100057482 Ga0075435_1000574822 347
148 3300007076 Ga0075435_100086041 Ga0075435_1000860412 347
149 3300007076 Ga0075435_100096673 Ga0075435_1000966732 347
150 3300009093 Ga0105240_10027396 Ga0105240_100273962 347
151 3300009093 Ga0105240_10068056 Ga0105240_100680567 347
152 3300009093 Ga0105240_10225388 Ga0105240_102253881 347
153 3300009093 Ga0105240_10317592 Ga0105240_103175922 347
154 3300009094 Ga0111539_10011384 Ga0111539_100113846 347
155 3300009094 Ga0111539_10022857 Ga0111539_100228575 347
156 3300009098 Ga0105245_10060671 Ga0105245_100606714 347
157 3300009098 Ga0105245_10398984 Ga0105245_103989842 347
158 3300009101 Ga0105247_10035422 Ga0105247_100354223 347
159 3300009147 Ga0114129_10002855 Ga0114129_100028556 347
160 3300009147 Ga0114129_10003232 Ga0114129_1000323213 347
161 3300009147 Ga0114129_10005775 Ga0114129_1000577514 347
162 3300009147 Ga0114129_10052156 Ga0114129_100521564 347
163 3300009147 Ga0114129_10175658 Ga0114129_101756582 347
164 3300009147 Ga0114129_10178848 Ga0114129_101788484 347
165 3300009147 Ga0114129_10322110 Ga0114129_103221103 347
166 3300009148 Ga0105243_10004718 Ga0105243_100047187 347
167 3300009148 Ga0105243_10186119 Ga0105243_101861192 347
168 3300009174 Ga0105241_10028556 Ga0105241_100285562 347
169 3300009176 Ga0105242_10020241 Ga0105242_100202416 347
170 3300009176 Ga0105242_10340937 Ga0105242_103409371 347
171 3300009177 Ga0105248_10044083 Ga0105248_100440833 347
172 3300009177 Ga0105248_10076842 Ga0105248_100768423 347
173 3300009177 Ga0105248_10193812 Ga0105248_101938122 347
174 3300009177 Ga0105248_10379288 Ga0105248_103792882 347
175 3300009553 Ga0105249_10027405 Ga0105249_100274052 347
176 3300009553 Ga0105249_10447343 Ga0105249_104473431 347
177 3300011119 Ga0105246_10150172 Ga0105246_101501722 347
178 3300013105 Ga0157369_10094426 Ga0157369_100944262 347
179 3300013296 Ga0157374_10015726 Ga0157374_100157267 347
180 3300013297 Ga0157378_10072346 Ga0157378_100723462 347
181 3300013306 Ga0163162_10240479 Ga0163162_102404791 347
182 3300013308 Ga0157375_10102918 Ga0157375_101029182 347
183 3300013308 Ga0157375_10228546 Ga0157375_102285463 347
184 3300014325 Ga0163163_10081161 Ga0163163_100811614 347
185 3300014326 Ga0157380_10021339 Ga0157380_100213393 347
186 3300014326 Ga0157380_10243584 Ga0157380_102435842 347
187 3300014326 Ga0157380_10416209 Ga0157380_104162092 347
188 3300014745 Ga0157377_10203158 Ga0157377_102031582 347
189 3300014968 Ga0157379_10010798 Ga0157379_100107982 347
190 3300014968 Ga0157379_10026054 Ga0157379_100260543 347
191 3300014968 Ga0157379_10131913 Ga0157379_101319132 347
192 3300014969 Ga0157376_10088018 Ga0157376_100880182 347
193 3300025903 Ga0207680_10041682 Ga0207680_100416823 347
194 3300025903 Ga0207680_10044931 Ga0207680_100449312 347
195 3300025907 Ga0207645_10010064 Ga0207645_100100644 347
196 3300025908 Ga0207643_10054655 Ga0207643_100546552 347
197 3300025909 Ga0207705_10020745 Ga0207705_100207452 347
198 3300025913 Ga0207695_10053939 Ga0207695_100539391 347
199 3300025913 Ga0207695_10193271 Ga0207695_101932712 347
200 3300025913 Ga0207695_10246823 Ga0207695_102468232 347
201 3300025918 Ga0207662_10020080 Ga0207662_100200802 347
202 3300025919 Ga0207657_10004533 Ga0207657_100045339 347
203 3300025920 Ga0207649_10007249 Ga0207649_100072496 347
204 3300025921 Ga0207652_10037506 Ga0207652_100375062 347
205 3300025922 Ga0207646_10030753 Ga0207646_100307533 347
206 3300025922 Ga0207646_10240193 Ga0207646_102401931 347
207 3300025923 Ga0207681_10016450 Ga0207681_100164502 347
208 3300025923 Ga0207681_10067536 Ga0207681_100675361 347
209 3300025924 Ga0207694_10031624 Ga0207694_100316245 347
210 3300025924 Ga0207694_10062421 Ga0207694_100624212 347
211 3300025926 Ga0207659_10000064 Ga0207659_1000006432 347
212 3300025926 Ga0207659_10079607 Ga0207659_100796072 347
213 3300025926 Ga0207659_10163076 Ga0207659_101630762 347
214 3300025927 Ga0207687_10009331 Ga0207687_100093316 347
215 3300025928 Ga0207700_10023052 Ga0207700_100230524 347
216 3300025931 Ga0207644_10034322 Ga0207644_100343222 347
217 3300025933 Ga0207706_10104457 Ga0207706_101044573 347
218 3300025934 Ga0207686_10010294 Ga0207686_100102942 347
219 3300025935 Ga0207709_10122611 Ga0207709_101226112 347
220 3300025936 Ga0207670_10082760 Ga0207670_100827601 347
221 3300025938 Ga0207704_10132482 Ga0207704_101324822 347
222 3300025939 Ga0207665_10026731 Ga0207665_100267313 347
223 3300025939 Ga0207665_10048061 Ga0207665_100480613 347
224 3300025940 Ga0207691_10010360 Ga0207691_100103605 347
225 3300025941 Ga0207711_10038401 Ga0207711_100384013 347
226 3300025941 Ga0207711_10321044 Ga0207711_103210442 347
227 3300025942 Ga0207689_10048993 Ga0207689_100489932 347
228 3300025942 Ga0207689_10055233 Ga0207689_100552332 347
229 3300025942 Ga0207689_10062697 Ga0207689_100626971 347
230 3300025945 Ga0207679_10127564 Ga0207679_101275642 347
231 3300025949 Ga0207667_10467340 Ga0207667_104673402 347
232 3300025961 Ga0207712_10059399 Ga0207712_100593993 347
233 3300025961 Ga0207712_10192574 Ga0207712_101925741 347
234 3300025981 Ga0207640_10031620 Ga0207640_100316203 347
235 3300025981 Ga0207640_10033666 Ga0207640_100336664 347
236 3300025986 Ga0207658_10033948 Ga0207658_100339481 347
237 3300025986 Ga0207658_10459780 Ga0207658_104597801 347
238 3300026023 Ga0207677_10004306 Ga0207677_100043067 347
239 3300026023 Ga0207677_10096660 Ga0207677_100966602 347
240 3300026035 Ga0207703_10028142 Ga0207703_100281425 347
241 3300026035 Ga0207703_10030964 Ga0207703_100309643 347
242 3300026035 Ga0207703_10035162 Ga0207703_100351624 347
243 3300026035 Ga0207703_10306573 Ga0207703_103065731 347
244 3300026035 Ga0207703_10438557 Ga0207703_104385571 347
245 3300026035 Ga0207703_10460890 Ga0207703_104608901 347
246 3300026041 Ga0207639_10259216 Ga0207639_102592162 347
247 3300026075 Ga0207708_10003903 Ga0207708_100039033 347
248 3300026075 Ga0207708_10016651 Ga0207708_100166512 347
249 3300026075 Ga0207708_10163640 Ga0207708_101636402 347
250 3300026088 Ga0207641_10000723 Ga0207641_1000072328 347
251 3300026089 Ga0207648_10004153 Ga0207648_1000415312 347
252 3300026089 Ga0207648_10023751 Ga0207648_100237515 347
253 3300026089 Ga0207648_10050275 Ga0207648_100502754 347
254 3300026089 Ga0207648_10253763 Ga0207648_102537632 347
255 3300026095 Ga0207676_10029410 Ga0207676_100294104 347
256 3300026095 Ga0207676_10050364 Ga0207676_100503642 347
257 3300026095 Ga0207676_10170831 Ga0207676_101708312 347
258 3300026118 Ga0207675_100001546 Ga0207675_10000154620 347
259 3300026118 Ga0207675_100018097 Ga0207675_1000180976 347
260 3300026118 Ga0207675_100029257 Ga0207675_1000292572 347
261 3300026118 Ga0207675_100298000 Ga0207675_1002980002 347
262 3300026121 Ga0207683_10117113 Ga0207683_101171131 347
263 3300026121 Ga0207683_10179394 Ga0207683_101793942 347
264 3300026121 Ga0207683_10189294 Ga0207683_101892942 347
265 3300027907 Ga0207428_10006808 Ga0207428_100068088 347
266 3300027907 Ga0207428_10231067 Ga0207428_102310671 347
267 3300028379 Ga0268266_10009913 Ga0268266_100099135 347
268 3300028379 Ga0268266_10060998 Ga0268266_100609984 347
269 3300028379 Ga0268266_10066101 Ga0268266_100661014 347
270 3300028379 Ga0268266_10094414 Ga0268266_100944142 347
271 3300028380 Ga0268265_10018349 Ga0268265_100183494 347
272 3300028380 Ga0268265_10055077 Ga0268265_100550772 347
273 3300028380 Ga0268265_10106873 Ga0268265_101068732 347
274 3300031238 Ga0265332_10037411 Ga0265332_100374113 347
275 3300034816 Ga0373930_0008658 Ga0373930_0008658_10_1053 347
276 3300034818 Ga0373950_0000305 Ga0373950_0000305_2513_3556 347
277 3300034957 Ga0373938_0000220 Ga0373938_0000220_1468_2511 347
278 3300035090 Ga0373949_0005049 Ga0373949_0005049_1520_2563 347
279 3300035092 Ga0373952_0002395 Ga0373952_0002395_1014_2057 347
280 3300035114 Ga0373939_0001341 Ga0373939_0001341_2799_3842 347
281 3300035115 Ga0373941_0000459 Ga0373941_0000459_4544_5587 347
282 3300035115 Ga0373941_0011372 Ga0373941_0011372_1153_2196 347
283 3300035121 Ga0373960_0000115 Ga0373960_0000115_1215_2258 347
284 3300035121 Ga0373960_0021260 Ga0373960_0021260_286_1329 347
285 3300035170 Ga0373943_0008095 Ga0373943_0008095_2813_3862 347
286 3300035207 Ga0373942_0000216 Ga0373942_0000216_366_1409 347
287 3300035241 Ga0373961_0002594 Ga0373961_0002594_1780_2823 347
288 3300035242 Ga0373962_0001428 Ga0373962_0001428_1761_2804 347
289 3300035410 Ga0373924_0020027 Ga0373924_0020027_1282_2331 347
290 3300035691 Ga0373931_0014367 Ga0373931_0014367_1401_2444 347
291 3300035691 Ga0373931_0128336 Ga0373931_0128336_365_1408 347
292 3300035692 Ga0373935_0013843 Ga0373935_0013843_2359_3408 347
293 3300035725 Ga0373947_0005003 Ga0373947_0005003_2758_3807 347
294 3300036401 Ga0373937_0060901 Ga0373937_0060901_2089_3132 347
295 3300036401 Ga0373937_0103466 Ga0373937_0103466_22_1110 347
296 3300036401 Ga0373937_0221254 Ga0373937_0221254_714_1763 347
297 3300037068 Ga0373925_0016067 Ga0373925_0016067_1333_2382 347
298 3300037068 Ga0373925_0020175 Ga0373925_0020175_1463_2506 347
299 3300037068 Ga0373925_0060722 Ga0373925_0060722_747_1796 347
300 3300044694 Ga0466963_0013892 Ga0466963_0013892_1157_2224 347
301 3300044842 Ga0466957_0139832 Ga0466957_0139832_114_1160 347
302 3300045051 Ga0451576_0005342 Ga0451576_0005342_10974_12017 347
303 3300046454 Ga0495592_0037832 Ga0495592_0037832_1436_2485 347
304 3300046459 Ga0495629_0139719 Ga0495629_0139719_391_1440 347
305 3300046463 Ga0495653_0062124 Ga0495653_0062124_462_1505 347
306 3300046473 Ga0495582_0134210 Ga0495582_0134210_301_1350 347
307 3300046511 Ga0495608_0005849 Ga0495608_0005849_996_2045 347
308 3300046517 Ga0495630_0027662 Ga0495630_0027662_2142_3191 347
309 3300046533 Ga0495640_0167505 Ga0495640_0167505_101_1147 347
310 3300046539 Ga0495621_0016719 Ga0495621_0016719_306_1349 347
311 3300046543 Ga0495645_0001612 Ga0495645_0001612_1163_2206 347
312 3300046543 Ga0495645_0043909 Ga0495645_0043909_2117_3166 347
313 3300046543 Ga0495645_0201803 Ga0495645_0201803_173_1222 347
314 3300046663 Ga0495635_0076596 Ga0495635_0076596_926_1969 347
315 3300046663 Ga0495635_0091303 Ga0495635_0091303_594_1637 347
316 3300046683 Ga0495658_0100434 Ga0495658_0100434_511_1554 347
317 3300046689 Ga0495613_0013803 Ga0495613_0013803_3702_4751 347
318 3300046689 Ga0495613_0081432 Ga0495613_0081432_483_1526 347
319 3300046809 Ga0495600_0027231 Ga0495600_0027231_1552_2601 347
320 3300046809 Ga0495600_0102521 Ga0495600_0102521_522_1565 347
321 3300047317 Ga0495604_0021253 Ga0495604_0021253_2386_3435 347
322 3300047319 Ga0495674_0032485 Ga0495674_0032485_85_1134 347
323 3300047319 Ga0495674_0189252 Ga0495674_0189252_297_1340 347
324 3300047471 Ga0495684_0018047 Ga0495684_0018047_851_1900 347
325 3300048903 Ga0496100_0000941 Ga0496100_0000941_3036_4085 347
326 3300048904 Ga0496101_0001279 Ga0496101_0001279_1806_2855 347
327 3300048904 Ga0496101_0329352 Ga0496101_0329352_123_1169 347
328 3300048905 Ga0496102_0142752 Ga0496102_0142752_1114_2157 347
329 3300048905 Ga0496102_0221972 Ga0496102_0221972_391_1434 347
330 3300048905 Ga0496102_0318021 Ga0496102_0318021_45_1088 347
331 3300048906 Ga0496103_0151870 Ga0496103_0151870_69_1112 347
332 3300048907 Ga0496104_0060217 Ga0496104_0060217_1074_2117 347
333 3300048907 Ga0496104_0105262 Ga0496104_0105262_868_1911 347
334 3300048908 Ga0496105_0254796 Ga0496105_0254796_42_1091 347
335 3300048911 Ga0496108_0002181 Ga0496108_0002181_865_1908 347
336 3300048912 Ga0496109_0086326 Ga0496109_0086326_16_1059 347
337 3300048912 Ga0496109_0151914 Ga0496109_0151914_63_1106 347
338 3300048913 Ga0496110_0024307 Ga0496110_0024307_2992_4035 347
339 3300048915 Ga0496112_0104043 Ga0496112_0104043_1613_2656 347
340 3300048915 Ga0496112_0245172 Ga0496112_0245172_482_1525 347
341 3300048916 Ga0496113_0156477 Ga0496113_0156477_315_1358 347
342 3300048917 Ga0496114_0000226 Ga0496114_0000226_39375_40424 347
343 3300048917 Ga0496114_0037274 Ga0496114_0037274_2087_3130 347
344 3300048918 Ga0496115_0054923 Ga0496115_0054923_2077_3120 347
345 3300049571 Ga0501034_0087747 Ga0501034_0087747_1767_2813 347
346 3300049580 Ga0501046_0324963 Ga0501046_0324963_29_1075 347
347 3300049581 Ga0501047_0015566 Ga0501047_0015566_55_1101 347
348 3300049589 Ga0501073_0111729 Ga0501073_0111729_510_1556 347
349 3300049744 Ga0501083_0188607 Ga0501083_0188607_270_1316 347
350 3300050507 nmdc:mga05p37_10907_c1 nmdc:mga05p37_10907_c1_566_1609 347
351 3300050507 nmdc:mga05p37_125961_c1 nmdc:mga05p37_125961_c1_575_1618 347
352 3300050507 nmdc:mga05p37_148931_c1 nmdc:mga05p37_148931_c1_1405_2448 347
353 3300050507 nmdc:mga05p37_181471_c1 nmdc:mga05p37_181471_c1_831_1874 347
354 3300050507 nmdc:mga05p37_305175_c1 nmdc:mga05p37_305175_c1_662_1708 347
355 3300050507 nmdc:mga05p37_40665_c1 nmdc:mga05p37_40665_c1_1823_2866 347
356 3300050508 nmdc:mga09592_54422_c1 nmdc:mga09592_54422_c1_2048_3097 347
357 3300050510 nmdc:mga06r32_70471_c1 nmdc:mga06r32_70471_c1_265_1314 347
358 3300050510 nmdc:mga06r32_72622_c1 nmdc:mga06r32_72622_c1_1967_3010 347
359 3300050511 nmdc:mga08y16_34184_c1 nmdc:mga08y16_34184_c1_3794_4837 347
360 3300050511 nmdc:mga08y16_38877_c1 nmdc:mga08y16_38877_c1_2097_3140 347
361 3300050512 nmdc:mga0n895_12437_c1 nmdc:mga0n895_12437_c1_841_1884 347
362 3300050512 nmdc:mga0n895_174372_c1 nmdc:mga0n895_174372_c1_427_1470 347
363 3300050512 nmdc:mga0n895_18663_c1 nmdc:mga0n895_18663_c1_1130_2173 347
364 3300050512 nmdc:mga0n895_306802_c1 nmdc:mga0n895_306802_c1_222_1265 347
365 3300050512 nmdc:mga0n895_63659_c1 nmdc:mga0n895_63659_c1_845_1888 347
366 3300050513 nmdc:mga0rr50_191_c1 nmdc:mga0rr50_191_c1_5616_6659 347
367 3300050513 nmdc:mga0rr50_66018_c1 nmdc:mga0rr50_66018_c1_615_1658 347
368 3300050513 nmdc:mga0rr50_7227_c1 nmdc:mga0rr50_7227_c1_1288_2331 347
369 3300050513 nmdc:mga0rr50_7461_c1 nmdc:mga0rr50_7461_c1_4539_5582 347
370 3300050514 nmdc:mga08x19_5011_c1 nmdc:mga08x19_5011_c1_4589_5632 347
371 3300050515 nmdc:mga0a205_10463_c1 nmdc:mga0a205_10463_c1_6255_7298 347
372 3300050515 nmdc:mga0a205_22854_c1 nmdc:mga0a205_22854_c1_893_1936 347
373 3300050515 nmdc:mga0a205_46923_c1 nmdc:mga0a205_46923_c1_2572_3615 347
374 3300050515 nmdc:mga0a205_49577_c1 nmdc:mga0a205_49577_c1_2788_3831 347
375 3300053077 Ga0495601_0029476 Ga0495601_0029476_335_1384 347
376 3300053077 Ga0495601_0151939 Ga0495601_0151939_68_1117 347
377 3300053077 Ga0495601_0165943 Ga0495601_0165943_376_1419 347
378 3300053085 Ga0495619_0007028 Ga0495619_0007028_1467_2516 347
379 3300053085 Ga0495619_0021800 Ga0495619_0021800_1684_2727 347
380 3300060353 Ga0501082_0080033 Ga0501082_0080033_405_1448 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

16

331

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bj4-assembly2.cif.gz_D crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in apo form 0.9244 12 341
3ly1-assembly1.cif.gz_B crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution 0.9158 13 341
3ffh-assembly1.cif.gz_B the crystal structure of histidinol-phosphate aminotransferase from listeria innocua clip11262. 0.9076 10 341
1uu1-assembly1.cif.gz_A complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) 0.9066 4 340
3ftb-assembly2.cif.gz_D the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum 0.9047 14 344
ID Description Score Start End Superfamily
af_I1MNX6_112_329_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9413 27 250 3.40.640.10
af_I1MNX6_112_329_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9372 27 250 3.40.640.10
1fg7A01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9273 48 248 3.40.640.10
af_P36605_51_267_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9191 47 248 3.40.640.10
3getB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9188 250 343 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A1Q7AMU6-F1-model_v4 histidinol-phosphate transaminase (EC 2.6.1.9) 0.9928 15 347 GO:0008483
GO:0009058
GO:0030170
AF-A0A1Q7AMU6-F1-model_v4 histidinol-phosphate transaminase (EC 2.6.1.9) 0.9869 15 347 GO:0008483
GO:0009058
GO:0030170
AF-A0A353WJJ3-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9759 14 339 GO:0000105
GO:0008483
GO:0030170
AF-A0A847H3D2-F1-model_v4 Histidinol-phosphate transaminase (EC 2.6.1.9) 0.9638 4 338 GO:0000105
GO:0004400
GO:0030170
AF-A0A3N5GF87-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9631 4 265 GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
93.52 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map