F428617

General Info

Members Datasets Scaffolds Average Seq Length
380 271 760 184

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100154055|Ga0075431_1001540553
Length 217
Sequence MNRYRIAVIAGSLRKDSFNRRLGSALARLAPPDFSFQLVRIDDLPLYNQDDDARPAEAVRRLKAQIGAARGLLFITPEYNRSIPGVLKNAIDHASRPYGQSAWAGKPAGVLGVSIGAIGTAVAQQHLRAILAYLDVPTLGQPEVFLQLTDELFDATGNIGPASRPFLQGWMDRYAEWVRAHAPQAVSVGPDDDAVDLQVVHQLAQQEHRGREPRVAR

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
167 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
170 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
171 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
172 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
224 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
225 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
226 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
227 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
228 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
229 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
230 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
231 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
238 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
239 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
242 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
245 2511231024 Pseudomonas sp. GM84 Isolate Nodule
246 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
247 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
248 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
249 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
250 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
251 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
252 2738541277 Variovorax sp. GV051 Isolate Unclassified
253 2738543013 Variovorax sp. BT01 Isolate Unclassified
254 2738543019 Variovorax sp. GV040 Isolate Unclassified
255 2818991446 Variovorax sp. 1180 Isolate Unclassified
256 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
257 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
258 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
259 2885198086 Variovorax sp. 679 Isolate Unclassified
260 2885211737 Variovorax sp. 553 Isolate Unclassified
261 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
262 2899924645 Variovorax sp. 369 Isolate Unclassified
263 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
264 2928037797 Variovorax sp. 1126 Isolate Unclassified
265 2928044640 Variovorax sp. 1128 Isolate Unclassified
266 2928051484 Variovorax sp. 1133 Isolate Unclassified
267 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
268 2928070936 Variovorax gossypii 1167 Isolate Unclassified
269 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
270 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
271 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.84
Metatranscriptomes 0.79
Isolates 7.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.11
Nodule 0.53
Rhizoplane 3.42
Rhizosphere 55.26
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100154055 3300006847 Bacteria 2365
2 JGI24740J21852_10013476 3300001979 Bacteria 3047
3 JGI24739J22299_10119980 3300001989 Bacteria 786
4 JGI25156J39149_1019499 3300002705 Bacteria 1219
5 JGI25156J39149_1023041 3300002705 Bacteria 1046
6 JGI25152J39213_1004917 3300002773 Bacteria 4057
7 JGI25152J39213_1007207 3300002773 Bacteria 2908
8 JGI25150J39212_1002999 3300002774 Bacteria 4062
9 JGI25150J39212_1009856 3300002774 Bacteria 1801
10 JGI25159J45721_1005328 3300002987 Bacteria 4057
11 JGI25159J45721_1026736 3300002987 Bacteria 990
12 JGI25151J46595_10011538 3300003187 Bacteria 4057
13 JGI25406J46586_10000543 3300003203 Bacteria 17674
14 JGI25406J46586_10003894 3300003203 Bacteria 6978
15 JGI25153J46596_10010930 3300003215 Bacteria 4057
16 JGI25160J50197_1008030 3300003354 Bacteria 4057
17 JGI25160J50197_1012599 3300003354 Bacteria 2926
18 JGI25161J50226_1003004 3300003374 Bacteria 4057
19 Ga0006562J51391_1111446 3300003578 Bacteria 1910
20 Ga0007429J51699_1020602 3300003579 Bacteria 1326
21 Ga0055535_1000044 3300003761 Bacteria 145183
22 Ga0055535_1000330 3300003761 Bacteria 47889
23 Ga0055542_1000039 3300003762 Bacteria 215126
24 Ga0055542_1025538 3300003762 Bacteria 803
25 Ga0055529_1000638 3300003763 Bacteria 25766
26 Ga0055526_1011247 3300003771 Bacteria 4057
27 Ga0055526_1017699 3300003771 Bacteria 2707
28 Ga0055526_1028107 3300003771 Bacteria 1711
29 Ga0055537_1003647 3300003773 Bacteria 4671
30 Ga0055524_1009136 3300003775 Bacteria 4057
31 Ga0055524_1014442 3300003775 Bacteria 2926
32 Ga0055536_1007617 3300003781 Bacteria 4805
33 Ga0055536_1019978 3300003781 Bacteria 2086
34 Ga0055534_1004448 3300003784 Bacteria 4057
35 Ga0055534_1007522 3300003784 Bacteria 2583
36 Ga0055528_1007818 3300003790 Bacteria 4671
37 Ga0055530_10007119 3300003791 Bacteria 4792
38 Ga0055540_1007764 3300003792 Bacteria 3984
39 Ga0055543_1004921 3300004625 Bacteria 3518
40 Ga0058860_10117914 3300004801 Bacteria 927
41 Ga0065165_1008667 3300005262 Bacteria 4709
42 Ga0070658_10108531 3300005327 Bacteria 2297
43 Ga0070676_10071280 3300005328 Bacteria 2087
44 Ga0070670_100184210 3300005331 Bacteria 1813
45 Ga0070677_10246964 3300005333 Bacteria 884
46 Ga0068869_100028858 3300005334 Bacteria 3881
47 Ga0068869_100586170 3300005334 Bacteria 940
48 Ga0070680_100139835 3300005336 Bacteria 2030
49 Ga0070660_100081807 3300005339 Bacteria 2535
50 Ga0070689_100245674 3300005340 Bacteria 1475
51 Ga0070691_10449896 3300005341 Bacteria 735
52 Ga0070661_100564444 3300005344 Bacteria 917
53 Ga0070668_100045866 3300005347 Bacteria 3354
54 Ga0070668_100076874 3300005347 Bacteria 2608
55 Ga0070668_100369603 3300005347 Bacteria 1218
56 Ga0070669_100064639 3300005353 Bacteria 2695
57 Ga0070675_100097515 3300005354 Bacteria 2472
58 Ga0070675_101524152 3300005354 Bacteria 617
59 Ga0070700_100199191 3300005441 Bacteria 1405
60 Ga0070678_100172099 3300005456 Bacteria 1765
61 Ga0070681_10004449 3300005458 Bacteria 13347
62 Ga0070681_10968674 3300005458 Bacteria 770
63 Ga0068867_100068165 3300005459 Bacteria 2655
64 Ga0070685_10058833 3300005466 Bacteria 2242
65 Ga0070706_100719997 3300005467 Bacteria 925
66 Ga0070679_100134082 3300005530 Bacteria 2457
67 Ga0068853_100051727 3300005539 Bacteria 3537
68 Ga0070672_100133152 3300005543 Bacteria 2045
69 Ga0070672_100267358 3300005543 Bacteria 1443
70 Ga0068855_100315895 3300005563 Bacteria 1728
71 Ga0068855_101056851 3300005563 Bacteria 851
72 Ga0070664_101329745 3300005564 Bacteria 679
73 Ga0068859_100143412 3300005617 Bacteria 2462
74 Ga0068859_100797837 3300005617 Bacteria 1032
75 Ga0068859_101023727 3300005617 Bacteria 907
76 Ga0068861_100001935 3300005719 Bacteria 13340
77 Ga0068861_100107241 3300005719 Bacteria 2233
78 Ga0068861_100367481 3300005719 Bacteria 1267
79 Ga0068851_10032539 3300005834 Bacteria 2595
80 Ga0068858_100024825 3300005842 Bacteria 5581
81 Ga0068858_100528827 3300005842 Bacteria 1141
82 Ga0068858_101022869 3300005842 Bacteria 810
83 Ga0081539_10000059 3300005985 Bacteria 254888
84 Ga0075368_10003562 3300006042 Bacteria 5216
85 Ga0075363_100038828 3300006048 Bacteria 2504
86 Ga0075363_100306335 3300006048 Bacteria 922
87 Ga0075364_10043012 3300006051 Bacteria 2936
88 Ga0075367_10070346 3300006178 Bacteria 2103
89 Ga0075367_10261539 3300006178 Bacteria 1086
90 Ga0075369_10022853 3300006186 Unclassified 2582
91 Ga0075366_10054380 3300006195 Bacteria 2377
92 Ga0075366_10265470 3300006195 Bacteria 1048
93 Ga0097620_100143416 3300006931 Bacteria 2462
94 Ga0097620_100797790 3300006931 Bacteria 1032
95 Ga0097620_101023948 3300006931 Bacteria 907
96 Ga0105244_10123526 3300009036 Bacteria 1252
97 Ga0105250_10013436 3300009092 Bacteria 3373
98 Ga0105240_10134415 3300009093 Bacteria 2963
99 Ga0105240_10930954 3300009093 Bacteria 933
100 Ga0111539_10034983 3300009094 Bacteria 6084
101 Ga0111539_10298202 3300009094 Bacteria 1876
102 Ga0111539_10717132 3300009094 Bacteria 1164
103 Ga0105245_10423417 3300009098 Bacteria 1335
104 Ga0105243_10100089 3300009148 Bacteria 2404
105 Ga0105242_10262915 3300009176 Bacteria 1559
106 Ga0105249_10698540 3300009553 Bacteria 1074
107 Ga0105246_10089496 3300011119 Bacteria 2215
108 Ga0157371_10533182 3300013102 Bacteria 869
109 Ga0157370_10331847 3300013104 Bacteria 1402
110 Ga0157374_10375535 3300013296 Bacteria 1415
111 Ga0157378_11911564 3300013297 Bacteria 643
112 Ga0163162_10059516 3300013306 Unclassified 3852
113 Ga0157372_10082620 3300013307 Bacteria 3637
114 Ga0157380_10009871 3300014326 Bacteria 6854
115 Ga0157380_10348782 3300014326 Bacteria 1384
116 Ga0157380_11005254 3300014326 Bacteria 868
117 Ga0183362_10001 3300015683 Bacteria 2046624
118 Ga0163161_10088177 3300017792 Bacteria 2293
119 Ga0209436_111356 3300025208 Bacteria 1568
120 Ga0209672_106578 3300025228 Bacteria 1873
121 Ga0209258_100044 3300025242 Bacteria 376336
122 Ga0209258_100099 3300025242 Bacteria 214924
123 Ga0207425_1000799 3300025245 Bacteria 16016
124 Ga0207425_1004674 3300025245 Bacteria 4049
125 Ga0209148_1000103 3300025254 Bacteria 215356
126 Ga0209148_1005662 3300025254 Bacteria 2823
127 Ga0209759_1001086 3300025256 Bacteria 17708
128 Ga0209759_1001471 3300025256 Bacteria 13142
129 Ga0209129_1000007 3300025258 Bacteria 771325
130 Ga0209129_1001701 3300025258 Bacteria 11876
131 Ga0209565_1000199 3300025263 Bacteria 71613
132 Ga0209565_1002461 3300025263 Bacteria 6648
133 Ga0209455_1000048 3300025272 Bacteria 376260
134 Ga0209673_1000128 3300025273 Bacteria 164482
135 Ga0209673_1001078 3300025273 Bacteria 30774
136 Ga0209673_1012733 3300025273 Bacteria 3367
137 Ga0209130_1000321 3300025284 Bacteria 56239
138 Ga0209130_1001524 3300025284 Bacteria 14876
139 Ga0209675_1000114 3300025291 Bacteria 112118
140 Ga0209675_1007684 3300025291 Bacteria 4086
141 Ga0209675_1011316 3300025291 Bacteria 2968
142 Ga0209676_1000122 3300025292 Bacteria 195510
143 Ga0209676_1006366 3300025292 Bacteria 5849
144 Ga0209676_1039240 3300025292 Bacteria 1347
145 Ga0209025_1000491 3300025294 Bacteria 75913
146 Ga0209025_1008800 3300025294 Bacteria 7179
147 Ga0209025_1012900 3300025294 Bacteria 5310
148 Ga0209564_1000360 3300025295 Bacteria 84454
149 Ga0209564_1000603 3300025295 Bacteria 56168
150 Ga0209758_1000025 3300025297 Bacteria 586687
151 Ga0209758_1006146 3300025297 Bacteria 8800
152 Ga0209050_1000002 3300025298 Bacteria 1792849
153 Ga0209050_1020992 3300025298 Bacteria 2402
154 Ga0209256_1000050 3300025299 Bacteria 308622
155 Ga0209256_1000063 3300025299 Bacteria 252716
156 Ga0207426_1000001 3300025302 Bacteria 1341301
157 Ga0207426_1000028 3300025302 Bacteria 483955
158 Ga0209051_1000002 3300025303 Bacteria 1631846
159 Ga0209051_1002276 3300025303 Bacteria 14061
160 Ga0209051_1007508 3300025303 Bacteria 5949
161 Ga0209257_1000002 3300025304 Bacteria 1767052
162 Ga0209257_1001389 3300025304 Bacteria 29010
163 Ga0209257_1007025 3300025304 Bacteria 6976
164 Ga0207656_10028204 3300025321 Bacteria 2302
165 Ga0207655_1098251 3300025728 Bacteria 1014
166 Ga0207682_10025710 3300025893 Bacteria 2335
167 Ga0207688_10059028 3300025901 Bacteria 2160
168 Ga0207645_10061578 3300025907 Bacteria 2397
169 Ga0207705_10065140 3300025909 Bacteria 2634
170 Ga0207705_10116513 3300025909 Bacteria 1978
171 Ga0207705_10472579 3300025909 Bacteria 973
172 Ga0207707_10013352 3300025912 Bacteria 7159
173 Ga0207695_10092666 3300025913 Bacteria 3031
174 Ga0207660_10436540 3300025917 Bacteria 1058
175 Ga0207662_10278713 3300025918 Bacteria 1106
176 Ga0207657_10066537 3300025919 Bacteria 3067
177 Ga0207649_10496475 3300025920 Bacteria 928
178 Ga0207652_10052118 3300025921 Bacteria 3510
179 Ga0207681_10005664 3300025923 Bacteria 7668
180 Ga0207681_10272045 3300025923 Bacteria 1330
181 Ga0207650_10439850 3300025925 Bacteria 1084
182 Ga0207659_10061912 3300025926 Bacteria 2699
183 Ga0207706_10352568 3300025933 Bacteria 1279
184 Ga0207709_10112856 3300025935 Bacteria 1821
185 Ga0207691_10093863 3300025940 Bacteria 2685
186 Ga0207691_10170475 3300025940 Bacteria 1906
187 Ga0207689_10039309 3300025942 Bacteria 3917
188 Ga0207679_10672841 3300025945 Bacteria 938
189 Ga0207668_10038725 3300025972 Bacteria 3203
190 Ga0207668_10103550 3300025972 Bacteria 2120
191 Ga0207703_10039345 3300026035 Bacteria 3779
192 Ga0207703_11063093 3300026035 Bacteria 777
193 Ga0207639_10123214 3300026041 Bacteria 2133
194 Ga0207708_10644810 3300026075 Bacteria 901
195 Ga0207702_10465616 3300026078 Bacteria 1228
196 Ga0207648_10089893 3300026089 Bacteria 2683
197 Ga0207648_10479655 3300026089 Bacteria 1136
198 Ga0207675_100002774 3300026118 Bacteria 17200
199 Ga0207675_100078181 3300026118 Bacteria 3100
200 Ga0207675_100078505 3300026118 Bacteria 3093
201 Ga0207675_101326310 3300026118 Bacteria 740
202 Ga0209371_1001262 3300027312 Bacteria 17979
203 Ga0209996_1015410 3300027395 Bacteria 1043
204 Ga0209966_1017452 3300027695 Bacteria 1368
205 Ga0209813_10206415 3300027866 Bacteria 730
206 Ga0209974_10020697 3300027876 Bacteria 2180
207 Ga0268264_10375995 3300028381 Bacteria 1359
208 Ga0268264_10846281 3300028381 Bacteria 916
209 Ga0268256_1002820 3300030500 Bacteria 8394
210 Ga0265330_10136572 3300031235 Bacteria 1043
211 Ga0265327_10000008 3300031251 Bacteria 658870
212 Ga0265327_10006023 3300031251 Bacteria 9843
213 Ga0265327_10028160 3300031251 Bacteria 3218
214 Ga0265327_10048524 3300031251 Bacteria 2233
215 Ga0307513_10298981 3300031456 Bacteria 1377
216 Ga0307509_10100357 3300031507 Bacteria 2933
217 Ga0307408_100000177 3300031548 Bacteria 71449
218 Ga0307408_100158756 3300031548 Bacteria 1794
219 Ga0307405_10001913 3300031731 Bacteria 8967
220 Ga0307413_10000338 3300031824 Bacteria 14792
221 Ga0307410_10752461 3300031852 Bacteria 825
222 Ga0307406_10002828 3300031901 Bacteria 9458
223 Ga0307412_10012856 3300031911 Bacteria 4889
224 Ga0307412_10550443 3300031911 Bacteria 969
225 Ga0307409_100009856 3300031995 Bacteria 5896
226 Ga0307409_100324671 3300031995 Bacteria 1442
227 Ga0307409_101226735 3300031995 Bacteria 774
228 Ga0307414_10078765 3300032004 Bacteria 2403
229 Ga0307414_10643352 3300032004 Bacteria 955
230 Ga0307411_10106277 3300032005 Bacteria 1997
231 Ga0307411_10269741 3300032005 Bacteria 1349
232 Ga0307415_100011448 3300032126 Bacteria 5078
233 Ga0307415_101148234 3300032126 Bacteria 729
234 Ga0373931_0006259 3300035691 Bacteria 5552
235 Ga0373927_0002681 3300035695 Bacteria 12977
236 Ga0373937_0140533 3300036401 Bacteria 2259
237 Ga0373937_1048452 3300036401 Bacteria 764
238 Ga0373925_0781219 3300037068 Bacteria 787
239 Ga0395899_0013350 3300037312 Bacteria 6282
240 Ga0395899_0072948 3300037312 Bacteria 2511
241 Ga0395899_0601229 3300037312 Bacteria 700
242 Ga0395900_0083563 3300037418 Bacteria 3280
243 Ga0395900_0127388 3300037418 Bacteria 2610
244 Ga0395900_0723596 3300037418 Bacteria 927
245 Ga0395898_0007949 3300037466 Bacteria 11250
246 Ga0395898_0009334 3300037466 Bacteria 10309
247 Ga0395905_0000597 3300037471 Bacteria 48243
248 Ga0395905_0422908 3300037471 Bacteria 1228
249 Ga0395901_0068022 3300038443 Bacteria 3710
250 Ga0395901_0173159 3300038443 Bacteria 2264
251 Ga0451789_0394941 3300041443 Bacteria 1526
252 Ga0451793_0421842 3300041452 Bacteria 1111
253 Ga0451798_0559650 3300041458 Bacteria 3187
254 Ga0451807_0896412 3300041486 Bacteria 3216
255 Ga0451849_0346875 3300041505 Bacteria 795
256 Ga0451849_1023129 3300041505 Bacteria 1522
257 Ga0451851_0498234 3300041507 Bacteria 785
258 Ga0439448_0241951 3300042005 Bacteria 636
259 Ga0439455_0009486 3300042012 Bacteria 2114
260 Ga0450898_024525 3300042134 Bacteria 1078
261 Ga0450910_007340 3300042147 Bacteria 1536
262 Ga0450918_018668 3300042531 Bacteria 1210
263 Ga0451577_0034620 3300042876 Bacteria 4551
264 Ga0451577_0434675 3300042876 Bacteria 1192
265 Ga0453684_0000457 3300044712 Bacteria 163653
266 Ga0453684_0008562 3300044712 Bacteria 18255
267 Ga0453684_0079900 3300044712 Bacteria 4086
268 Ga0453684_0139112 3300044712 Bacteria 2902
269 Ga0453684_0142700 3300044712 Bacteria 2857
270 Ga0466960_0233079 3300044901 Bacteria 1017
271 Ga0451576_0001528 3300045051 Bacteria 38953
272 Ga0495638_0006304 3300046460 Bacteria 8647
273 Ga0495638_0029313 3300046460 Bacteria 3549
274 Ga0495641_0079107 3300046461 Bacteria 1473
275 Ga0495641_0096161 3300046461 Bacteria 1322
276 Ga0495607_0017616 3300046501 Bacteria 4579
277 Ga0495616_0005680 3300046513 Bacteria 7641
278 Ga0495620_0049339 3300046515 Bacteria 1802
279 Ga0495630_0265367 3300046517 Bacteria 1312
280 Ga0495631_0002176 3300046518 Bacteria 11313
281 Ga0495642_0029291 3300046528 Bacteria 2197
282 Ga0495654_0240493 3300046530 Bacteria 758
283 Ga0495621_0015454 3300046539 Bacteria 2435
284 Ga0495633_0062548 3300046558 Bacteria 1743
285 Ga0495656_0094442 3300046615 Bacteria 1373
286 Ga0495625_0033017 3300046660 Bacteria 3831
287 Ga0495625_0036876 3300046660 Bacteria 3589
288 Ga0495625_0041522 3300046660 Bacteria 3348
289 Ga0495635_0698736 3300046663 Bacteria 658
290 Ga0495588_0033417 3300046674 Bacteria 2597
291 Ga0495670_0157559 3300046691 Bacteria 1192
292 Ga0495676_0026230 3300047321 Bacteria 5018
293 Ga0495677_0030768 3300047445 Bacteria 1954
294 Ga0495614_0019705 3300048089 Bacteria 2918
295 Ga0496108_0018220 3300048911 Bacteria 5749
296 Ga0496109_0331370 3300048912 Bacteria 1437
297 Ga0496110_0213656 3300048913 Bacteria 1754
298 Ga0496114_0006575 3300048917 Bacteria 9166
299 Ga0496114_0063843 3300048917 Bacteria 3083
300 Ga0496114_0398451 3300048917 Bacteria 1219
301 Ga0496116_0021136 3300048919 Bacteria 4916
302 Ga0496117_0013950 3300048920 Bacteria 6962
303 Ga0496118_0157226 3300048921 Bacteria 1412
304 Ga0496121_0014501 3300048924 Bacteria 8356
305 Ga0496123_0037969 3300048926 Bacteria 3393
306 Ga0496124_0024673 3300048927 Bacteria 5461
307 Ga0496125_0012614 3300048928 Bacteria 8371
308 Ga0501036_0260404 3300049572 Bacteria 1453
309 Ga0501047_0359780 3300049581 Bacteria 1291
310 Ga0501048_0255554 3300049582 Bacteria 1245
311 Ga0501073_0996532 3300049589 Bacteria 576
312 Ga0501279_013894 3300049775 Bacteria 1106
313 nmdc:mga03n38_14424_c1 3300050490 Bacteria 3028
314 nmdc:mga03n38_259455_c1 3300050490 Bacteria 921
315 nmdc:mga00v17_34072_c1 3300050491 Bacteria 3022
316 nmdc:mga0k408_12299_c2 3300050493 Bacteria 2591
317 nmdc:mga0k408_307645_c1 3300050493 Bacteria 946
318 nmdc:mga06z11_247064_c1 3300050494 Bacteria 1050
319 nmdc:mga06z11_590894_c1 3300050494 Bacteria 675
320 nmdc:mga06z11_76128_c1 3300050494 Bacteria 1789
321 nmdc:mga04h51_6923_c1 3300050495 Bacteria 2969
322 nmdc:mga07m45_89292_c1 3300050496 Bacteria 1765
323 nmdc:mga08y16_266092_c1 3300050511 Bacteria 1770
324 nmdc:mga08y16_33726_c1 3300050511 Bacteria 5376
325 nmdc:mga0sz30_137437_c1 3300050516 Bacteria 1078
326 nmdc:mga0sz30_201649_c1 3300050516 Unclassified 883
327 Ga0500643_013156 3300053087 Bacteria 2934
328 Ga0500651_0002648 3300053093 Bacteria 9515
329 Ga0500566_0165938 3300053094 Bacteria 1146
330 Ga0500562_002124 3300053108 Bacteria 4955
331 Ga0500571_000087 3300053110 Bacteria 29151
332 Ga0500572_053357 3300053111 Bacteria 1211
333 Ga0500594_0002456 3300053118 Bacteria 4033
334 Ga0500597_156147 3300053120 Bacteria 977
335 Ga0500607_047231 3300053121 Bacteria 2305
336 Ga0500608_253561 3300053122 Bacteria 685
337 Ga0500626_081757 3300053128 Bacteria 1427
338 Ga0500655_003141 3300053133 Bacteria 2994
339 Ga0500658_0000481 3300053134 Bacteria 17081
340 Ga0500658_0000709 3300053134 Bacteria 13770
341 Ga0500559_0004654 3300053136 Bacteria 6466
342 Ga0500559_0044118 3300053136 Bacteria 1950
343 Ga0500568_0003586 3300053139 Bacteria 8572
344 Ga0500574_092169 3300053141 Bacteria 897
345 Ga0500616_0069505 3300053153 Bacteria 1800
346 Ga0500624_049379 3300053157 Bacteria 779
347 Ga0500634_0008688 3300053161 Bacteria 5091
348 Ga0500638_043069 3300053162 Bacteria 2192
349 Ga0500636_0000056 3300053177 Bacteria 53780
350 Ga0500637_0005679 3300053178 Bacteria 6064
351 Ga0500625_028720 3300053729 Bacteria 2640
352 Ga0501084_0646498 3300054114 Bacteria 893
353 2511130802 2510917021 Bacteria 5705459
354 2511377454 2511231024 Bacteria 5835885
355 2513227126 2513020051 Bacteria 6053213
356 2599623651 2599185214 Bacteria 8209958
357 2599671730 2599185226 Bacteria 8233575
358 2599681257 2599185227 Bacteria 8246414
359 2599693340 2599185229 Bacteria 8216126
360 2644163222 2643221628 Bacteria 5745828
361 2738717721 2738541277 Bacteria 7458140
362 2739251413 2738543013 Bacteria 5618633
363 2739278407 2738543019 Bacteria 7459457
364 2819597205 2818991446 Bacteria 7757362
365 2831266330 2831265667 Bacteria 7184833
366 2838057558 2838054893 Bacteria 7451788
367 2842777956 2842775625 Bacteria 5587290
368 2885204453 2885198086 Bacteria 7212419
369 2885218106 2885211737 Bacteria 7212420
370 2895516110 2895511927 Bacteria 6802080
371 2899924709 2899924645 Bacteria 7487985
372 2904548158 2904541872 Bacteria 8915136
373 2928039164 2928037797 Bacteria 7273642
374 2928045231 2928044640 Bacteria 7271509
375 2928053036 2928051484 Bacteria 7773759
376 2928064293 2928064002 Bacteria 7419480
377 2928071730 2928070936 Bacteria 8062541
378 2928084325 2928084124 Bacteria 7159212
379 2929163087 2929160207 Bacteria 9075316
380 8054931370 8054929484 Bacteria 5599761
381 Ga0075431_100154055
382 JGI24740J21852_10013476
383 JGI24739J22299_10119980
384 JGI25156J39149_1019499
385 JGI25156J39149_1023041
386 JGI25152J39213_1004917
387 JGI25152J39213_1007207
388 JGI25150J39212_1002999
389 JGI25150J39212_1009856
390 JGI25159J45721_1005328
391 JGI25159J45721_1026736
392 JGI25151J46595_10011538
393 JGI25406J46586_10000543
394 JGI25406J46586_10003894
395 JGI25153J46596_10010930
396 JGI25160J50197_1008030
397 JGI25160J50197_1012599
398 JGI25161J50226_1003004
399 Ga0006562J51391_1111446
400 Ga0007429J51699_1020602
401 Ga0055535_1000044
402 Ga0055535_1000330
403 Ga0055542_1000039
404 Ga0055542_1025538
405 Ga0055529_1000638
406 Ga0055526_1011247
407 Ga0055526_1017699
408 Ga0055526_1028107
409 Ga0055537_1003647
410 Ga0055524_1009136
411 Ga0055524_1014442
412 Ga0055536_1007617
413 Ga0055536_1019978
414 Ga0055534_1004448
415 Ga0055534_1007522
416 Ga0055528_1007818
417 Ga0055530_10007119
418 Ga0055540_1007764
419 Ga0055543_1004921
420 Ga0058860_10117914
421 Ga0065165_1008667
422 Ga0070658_10108531
423 Ga0070676_10071280
424 Ga0070670_100184210
425 Ga0070677_10246964
426 Ga0068869_100028858
427 Ga0068869_100586170
428 Ga0070680_100139835
429 Ga0070660_100081807
430 Ga0070689_100245674
431 Ga0070691_10449896
432 Ga0070661_100564444
433 Ga0070668_100045866
434 Ga0070668_100076874
435 Ga0070668_100369603
436 Ga0070669_100064639
437 Ga0070675_100097515
438 Ga0070675_101524152
439 Ga0070700_100199191
440 Ga0070678_100172099
441 Ga0070681_10004449
442 Ga0070681_10968674
443 Ga0068867_100068165
444 Ga0070685_10058833
445 Ga0070706_100719997
446 Ga0070679_100134082
447 Ga0068853_100051727
448 Ga0070672_100133152
449 Ga0070672_100267358
450 Ga0068855_100315895
451 Ga0068855_101056851
452 Ga0070664_101329745
453 Ga0068859_100143412
454 Ga0068859_100797837
455 Ga0068859_101023727
456 Ga0068861_100001935
457 Ga0068861_100107241
458 Ga0068861_100367481
459 Ga0068851_10032539
460 Ga0068858_100024825
461 Ga0068858_100528827
462 Ga0068858_101022869
463 Ga0081539_10000059
464 Ga0075368_10003562
465 Ga0075363_100038828
466 Ga0075363_100306335
467 Ga0075364_10043012
468 Ga0075367_10070346
469 Ga0075367_10261539
470 Ga0075369_10022853
471 Ga0075366_10054380
472 Ga0075366_10265470
473 Ga0097620_100143416
474 Ga0097620_100797790
475 Ga0097620_101023948
476 Ga0105244_10123526
477 Ga0105250_10013436
478 Ga0105240_10134415
479 Ga0105240_10930954
480 Ga0111539_10034983
481 Ga0111539_10298202
482 Ga0111539_10717132
483 Ga0105245_10423417
484 Ga0105243_10100089
485 Ga0105242_10262915
486 Ga0105249_10698540
487 Ga0105246_10089496
488 Ga0157371_10533182
489 Ga0157370_10331847
490 Ga0157374_10375535
491 Ga0157378_11911564
492 Ga0163162_10059516
493 Ga0157372_10082620
494 Ga0157380_10009871
495 Ga0157380_10348782
496 Ga0157380_11005254
497 Ga0183362_10001
498 Ga0163161_10088177
499 Ga0209436_111356
500 Ga0209672_106578
501 Ga0209258_100044
502 Ga0209258_100099
503 Ga0207425_1000799
504 Ga0207425_1004674
505 Ga0209148_1000103
506 Ga0209148_1005662
507 Ga0209759_1001086
508 Ga0209759_1001471
509 Ga0209129_1000007
510 Ga0209129_1001701
511 Ga0209565_1000199
512 Ga0209565_1002461
513 Ga0209455_1000048
514 Ga0209673_1000128
515 Ga0209673_1001078
516 Ga0209673_1012733
517 Ga0209130_1000321
518 Ga0209130_1001524
519 Ga0209675_1000114
520 Ga0209675_1007684
521 Ga0209675_1011316
522 Ga0209676_1000122
523 Ga0209676_1006366
524 Ga0209676_1039240
525 Ga0209025_1000491
526 Ga0209025_1008800
527 Ga0209025_1012900
528 Ga0209564_1000360
529 Ga0209564_1000603
530 Ga0209758_1000025
531 Ga0209758_1006146
532 Ga0209050_1000002
533 Ga0209050_1020992
534 Ga0209256_1000050
535 Ga0209256_1000063
536 Ga0207426_1000001
537 Ga0207426_1000028
538 Ga0209051_1000002
539 Ga0209051_1002276
540 Ga0209051_1007508
541 Ga0209257_1000002
542 Ga0209257_1001389
543 Ga0209257_1007025
544 Ga0207656_10028204
545 Ga0207655_1098251
546 Ga0207682_10025710
547 Ga0207688_10059028
548 Ga0207645_10061578
549 Ga0207705_10065140
550 Ga0207705_10116513
551 Ga0207705_10472579
552 Ga0207707_10013352
553 Ga0207695_10092666
554 Ga0207660_10436540
555 Ga0207662_10278713
556 Ga0207657_10066537
557 Ga0207649_10496475
558 Ga0207652_10052118
559 Ga0207681_10005664
560 Ga0207681_10272045
561 Ga0207650_10439850
562 Ga0207659_10061912
563 Ga0207706_10352568
564 Ga0207709_10112856
565 Ga0207691_10093863
566 Ga0207691_10170475
567 Ga0207689_10039309
568 Ga0207679_10672841
569 Ga0207668_10038725
570 Ga0207668_10103550
571 Ga0207703_10039345
572 Ga0207703_11063093
573 Ga0207639_10123214
574 Ga0207708_10644810
575 Ga0207702_10465616
576 Ga0207648_10089893
577 Ga0207648_10479655
578 Ga0207675_100002774
579 Ga0207675_100078181
580 Ga0207675_100078505
581 Ga0207675_101326310
582 Ga0209371_1001262
583 Ga0209996_1015410
584 Ga0209966_1017452
585 Ga0209813_10206415
586 Ga0209974_10020697
587 Ga0268264_10375995
588 Ga0268264_10846281
589 Ga0268256_1002820
590 Ga0265330_10136572
591 Ga0265327_10000008
592 Ga0265327_10006023
593 Ga0265327_10028160
594 Ga0265327_10048524
595 Ga0307513_10298981
596 Ga0307509_10100357
597 Ga0307408_100000177
598 Ga0307408_100158756
599 Ga0307405_10001913
600 Ga0307413_10000338
601 Ga0307410_10752461
602 Ga0307406_10002828
603 Ga0307412_10012856
604 Ga0307412_10550443
605 Ga0307409_100009856
606 Ga0307409_100324671
607 Ga0307409_101226735
608 Ga0307414_10078765
609 Ga0307414_10643352
610 Ga0307411_10106277
611 Ga0307411_10269741
612 Ga0307415_100011448
613 Ga0307415_101148234
614 Ga0373931_0006259
615 Ga0373927_0002681
616 Ga0373937_0140533
617 Ga0373937_1048452
618 Ga0373925_0781219
619 Ga0395899_0013350
620 Ga0395899_0072948
621 Ga0395899_0601229
622 Ga0395900_0083563
623 Ga0395900_0127388
624 Ga0395900_0723596
625 Ga0395898_0007949
626 Ga0395898_0009334
627 Ga0395905_0000597
628 Ga0395905_0422908
629 Ga0395901_0068022
630 Ga0395901_0173159
631 Ga0451789_0394941
632 Ga0451793_0421842
633 Ga0451798_0559650
634 Ga0451807_0896412
635 Ga0451849_0346875
636 Ga0451849_1023129
637 Ga0451851_0498234
638 Ga0439448_0241951
639 Ga0439455_0009486
640 Ga0450898_024525
641 Ga0450910_007340
642 Ga0450918_018668
643 Ga0451577_0034620
644 Ga0451577_0434675
645 Ga0453684_0000457
646 Ga0453684_0008562
647 Ga0453684_0079900
648 Ga0453684_0139112
649 Ga0453684_0142700
650 Ga0466960_0233079
651 Ga0451576_0001528
652 Ga0495638_0006304
653 Ga0495638_0029313
654 Ga0495641_0079107
655 Ga0495641_0096161
656 Ga0495607_0017616
657 Ga0495616_0005680
658 Ga0495620_0049339
659 Ga0495630_0265367
660 Ga0495631_0002176
661 Ga0495642_0029291
662 Ga0495654_0240493
663 Ga0495621_0015454
664 Ga0495633_0062548
665 Ga0495656_0094442
666 Ga0495625_0033017
667 Ga0495625_0036876
668 Ga0495625_0041522
669 Ga0495635_0698736
670 Ga0495588_0033417
671 Ga0495670_0157559
672 Ga0495676_0026230
673 Ga0495677_0030768
674 Ga0495614_0019705
675 Ga0496108_0018220
676 Ga0496109_0331370
677 Ga0496110_0213656
678 Ga0496114_0006575
679 Ga0496114_0063843
680 Ga0496114_0398451
681 Ga0496116_0021136
682 Ga0496117_0013950
683 Ga0496118_0157226
684 Ga0496121_0014501
685 Ga0496123_0037969
686 Ga0496124_0024673
687 Ga0496125_0012614
688 Ga0501036_0260404
689 Ga0501047_0359780
690 Ga0501048_0255554
691 Ga0501073_0996532
692 Ga0501279_013894
693 nmdc:mga03n38_14424_c1
694 nmdc:mga03n38_259455_c1
695 nmdc:mga00v17_34072_c1
696 nmdc:mga0k408_12299_c2
697 nmdc:mga0k408_307645_c1
698 nmdc:mga06z11_247064_c1
699 nmdc:mga06z11_590894_c1
700 nmdc:mga06z11_76128_c1
701 nmdc:mga04h51_6923_c1
702 nmdc:mga07m45_89292_c1
703 nmdc:mga08y16_266092_c1
704 nmdc:mga08y16_33726_c1
705 nmdc:mga0sz30_137437_c1
706 nmdc:mga0sz30_201649_c1
707 Ga0500643_013156
708 Ga0500651_0002648
709 Ga0500566_0165938
710 Ga0500562_002124
711 Ga0500571_000087
712 Ga0500572_053357
713 Ga0500594_0002456
714 Ga0500597_156147
715 Ga0500607_047231
716 Ga0500608_253561
717 Ga0500626_081757
718 Ga0500655_003141
719 Ga0500658_0000481
720 Ga0500658_0000709
721 Ga0500559_0004654
722 Ga0500559_0044118
723 Ga0500568_0003586
724 Ga0500574_092169
725 Ga0500616_0069505
726 Ga0500624_049379
727 Ga0500634_0008688
728 Ga0500638_043069
729 Ga0500636_0000056
730 Ga0500637_0005679
731 Ga0500625_028720
732 Ga0501084_0646498
733 2511130802
734 2511377454
735 2513227126
736 2599623651
737 2599671730
738 2599681257
739 2599693340
740 2644163222
741 2738717721
742 2739251413
743 2739278407
744 2819597205
745 2831266330
746 2838057558
747 2842777956
748 2885204453
749 2885218106
750 2895516110
751 2899924709
752 2904548158
753 2928039164
754 2928045231
755 2928053036
756 2928064293
757 2928071730
758 2928084325
759 2929163087
760 8054931370

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

4

150

0.96

PF02525

Flavodoxin_2

Flavodoxin-like fold

4

140

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u7r-assembly1.cif.gz_A ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans 0.9453 4 182
3u7r-assembly1.cif.gz_A ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans 0.9254 4 182
3svl-assembly1.cif.gz_B structural basis of the improvement of chrr - a multi-purpose enzyme 0.9023 5 180
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.894 5 176
3s2y-assembly1.cif.gz_A crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii 0.8939 4 182
ID Description Score Start End Superfamily
3u7rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9385 6 182 3.40.50.360
3u7rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9131 6 182 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.894 5 176 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.886 4 179 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8798 5 176 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A1I3LNV2-F1-model_v4 Chromate reductase 0.9884 1 77 GO:0005829
GO:0010181
GO:0016491
AF-A0A257PSN8-F1-model_v4 NADPH-dependent FMN reductase 0.9778 1 116 GO:0005829
GO:0010181
GO:0016491
AF-A0A4Q3T1V4-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9775 1 119 GO:0005829
GO:0010181
GO:0016491
AF-A0A0A0EWY9-F1-model_v4 NADPH-dependent FMN reductase 0.9755 4 182 GO:0005829
GO:0010181
GO:0016491
AF-A0A1M3J7V8-F1-model_v4 deleted 0.9745 1 182

Map