F428617
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 380 | 271 | 760 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100154055|Ga0075431_1001540553 |
| Length | 217 |
| Sequence | MNRYRIAVIAGSLRKDSFNRRLGSALARLAPPDFSFQLVRIDDLPLYNQDDDARPAEAVRRLKAQIGAARGLLFITPEYNRSIPGVLKNAIDHASRPYGQSAWAGKPAGVLGVSIGAIGTAVAQQHLRAILAYLDVPTLGQPEVFLQLTDELFDATGNIGPASRPFLQGWMDRYAEWVRAHAPQAVSVGPDDDAVDLQVVHQLAQQEHRGREPRVAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 146 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 147 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 154 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 163 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 166 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 167 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 168 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 169 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 170 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 171 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 172 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 173 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 174 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 175 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 200 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 201 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 202 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 203 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 204 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 205 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 206 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 212 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 213 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 214 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 215 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 216 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 217 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 218 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 220 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 221 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 222 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 223 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 224 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 225 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 226 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 227 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 228 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 229 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 230 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 231 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 232 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 233 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 234 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 235 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 236 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 237 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 238 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 239 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 240 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 241 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 242 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 243 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 245 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 246 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 247 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 248 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 249 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 250 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 251 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 252 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 253 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 254 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 255 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 256 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 257 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 258 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 259 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 260 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 261 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 262 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 263 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 264 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 265 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 266 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 267 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 268 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 269 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 270 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 271 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.84 |
| Metatranscriptomes | 0.79 |
| Isolates | 7.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 32.11 |
| Nodule | 0.53 |
| Rhizoplane | 3.42 |
| Rhizosphere | 55.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075431_100154055 | 3300006847 | Bacteria | 2365 |
| 2 | JGI24740J21852_10013476 | 3300001979 | Bacteria | 3047 |
| 3 | JGI24739J22299_10119980 | 3300001989 | Bacteria | 786 |
| 4 | JGI25156J39149_1019499 | 3300002705 | Bacteria | 1219 |
| 5 | JGI25156J39149_1023041 | 3300002705 | Bacteria | 1046 |
| 6 | JGI25152J39213_1004917 | 3300002773 | Bacteria | 4057 |
| 7 | JGI25152J39213_1007207 | 3300002773 | Bacteria | 2908 |
| 8 | JGI25150J39212_1002999 | 3300002774 | Bacteria | 4062 |
| 9 | JGI25150J39212_1009856 | 3300002774 | Bacteria | 1801 |
| 10 | JGI25159J45721_1005328 | 3300002987 | Bacteria | 4057 |
| 11 | JGI25159J45721_1026736 | 3300002987 | Bacteria | 990 |
| 12 | JGI25151J46595_10011538 | 3300003187 | Bacteria | 4057 |
| 13 | JGI25406J46586_10000543 | 3300003203 | Bacteria | 17674 |
| 14 | JGI25406J46586_10003894 | 3300003203 | Bacteria | 6978 |
| 15 | JGI25153J46596_10010930 | 3300003215 | Bacteria | 4057 |
| 16 | JGI25160J50197_1008030 | 3300003354 | Bacteria | 4057 |
| 17 | JGI25160J50197_1012599 | 3300003354 | Bacteria | 2926 |
| 18 | JGI25161J50226_1003004 | 3300003374 | Bacteria | 4057 |
| 19 | Ga0006562J51391_1111446 | 3300003578 | Bacteria | 1910 |
| 20 | Ga0007429J51699_1020602 | 3300003579 | Bacteria | 1326 |
| 21 | Ga0055535_1000044 | 3300003761 | Bacteria | 145183 |
| 22 | Ga0055535_1000330 | 3300003761 | Bacteria | 47889 |
| 23 | Ga0055542_1000039 | 3300003762 | Bacteria | 215126 |
| 24 | Ga0055542_1025538 | 3300003762 | Bacteria | 803 |
| 25 | Ga0055529_1000638 | 3300003763 | Bacteria | 25766 |
| 26 | Ga0055526_1011247 | 3300003771 | Bacteria | 4057 |
| 27 | Ga0055526_1017699 | 3300003771 | Bacteria | 2707 |
| 28 | Ga0055526_1028107 | 3300003771 | Bacteria | 1711 |
| 29 | Ga0055537_1003647 | 3300003773 | Bacteria | 4671 |
| 30 | Ga0055524_1009136 | 3300003775 | Bacteria | 4057 |
| 31 | Ga0055524_1014442 | 3300003775 | Bacteria | 2926 |
| 32 | Ga0055536_1007617 | 3300003781 | Bacteria | 4805 |
| 33 | Ga0055536_1019978 | 3300003781 | Bacteria | 2086 |
| 34 | Ga0055534_1004448 | 3300003784 | Bacteria | 4057 |
| 35 | Ga0055534_1007522 | 3300003784 | Bacteria | 2583 |
| 36 | Ga0055528_1007818 | 3300003790 | Bacteria | 4671 |
| 37 | Ga0055530_10007119 | 3300003791 | Bacteria | 4792 |
| 38 | Ga0055540_1007764 | 3300003792 | Bacteria | 3984 |
| 39 | Ga0055543_1004921 | 3300004625 | Bacteria | 3518 |
| 40 | Ga0058860_10117914 | 3300004801 | Bacteria | 927 |
| 41 | Ga0065165_1008667 | 3300005262 | Bacteria | 4709 |
| 42 | Ga0070658_10108531 | 3300005327 | Bacteria | 2297 |
| 43 | Ga0070676_10071280 | 3300005328 | Bacteria | 2087 |
| 44 | Ga0070670_100184210 | 3300005331 | Bacteria | 1813 |
| 45 | Ga0070677_10246964 | 3300005333 | Bacteria | 884 |
| 46 | Ga0068869_100028858 | 3300005334 | Bacteria | 3881 |
| 47 | Ga0068869_100586170 | 3300005334 | Bacteria | 940 |
| 48 | Ga0070680_100139835 | 3300005336 | Bacteria | 2030 |
| 49 | Ga0070660_100081807 | 3300005339 | Bacteria | 2535 |
| 50 | Ga0070689_100245674 | 3300005340 | Bacteria | 1475 |
| 51 | Ga0070691_10449896 | 3300005341 | Bacteria | 735 |
| 52 | Ga0070661_100564444 | 3300005344 | Bacteria | 917 |
| 53 | Ga0070668_100045866 | 3300005347 | Bacteria | 3354 |
| 54 | Ga0070668_100076874 | 3300005347 | Bacteria | 2608 |
| 55 | Ga0070668_100369603 | 3300005347 | Bacteria | 1218 |
| 56 | Ga0070669_100064639 | 3300005353 | Bacteria | 2695 |
| 57 | Ga0070675_100097515 | 3300005354 | Bacteria | 2472 |
| 58 | Ga0070675_101524152 | 3300005354 | Bacteria | 617 |
| 59 | Ga0070700_100199191 | 3300005441 | Bacteria | 1405 |
| 60 | Ga0070678_100172099 | 3300005456 | Bacteria | 1765 |
| 61 | Ga0070681_10004449 | 3300005458 | Bacteria | 13347 |
| 62 | Ga0070681_10968674 | 3300005458 | Bacteria | 770 |
| 63 | Ga0068867_100068165 | 3300005459 | Bacteria | 2655 |
| 64 | Ga0070685_10058833 | 3300005466 | Bacteria | 2242 |
| 65 | Ga0070706_100719997 | 3300005467 | Bacteria | 925 |
| 66 | Ga0070679_100134082 | 3300005530 | Bacteria | 2457 |
| 67 | Ga0068853_100051727 | 3300005539 | Bacteria | 3537 |
| 68 | Ga0070672_100133152 | 3300005543 | Bacteria | 2045 |
| 69 | Ga0070672_100267358 | 3300005543 | Bacteria | 1443 |
| 70 | Ga0068855_100315895 | 3300005563 | Bacteria | 1728 |
| 71 | Ga0068855_101056851 | 3300005563 | Bacteria | 851 |
| 72 | Ga0070664_101329745 | 3300005564 | Bacteria | 679 |
| 73 | Ga0068859_100143412 | 3300005617 | Bacteria | 2462 |
| 74 | Ga0068859_100797837 | 3300005617 | Bacteria | 1032 |
| 75 | Ga0068859_101023727 | 3300005617 | Bacteria | 907 |
| 76 | Ga0068861_100001935 | 3300005719 | Bacteria | 13340 |
| 77 | Ga0068861_100107241 | 3300005719 | Bacteria | 2233 |
| 78 | Ga0068861_100367481 | 3300005719 | Bacteria | 1267 |
| 79 | Ga0068851_10032539 | 3300005834 | Bacteria | 2595 |
| 80 | Ga0068858_100024825 | 3300005842 | Bacteria | 5581 |
| 81 | Ga0068858_100528827 | 3300005842 | Bacteria | 1141 |
| 82 | Ga0068858_101022869 | 3300005842 | Bacteria | 810 |
| 83 | Ga0081539_10000059 | 3300005985 | Bacteria | 254888 |
| 84 | Ga0075368_10003562 | 3300006042 | Bacteria | 5216 |
| 85 | Ga0075363_100038828 | 3300006048 | Bacteria | 2504 |
| 86 | Ga0075363_100306335 | 3300006048 | Bacteria | 922 |
| 87 | Ga0075364_10043012 | 3300006051 | Bacteria | 2936 |
| 88 | Ga0075367_10070346 | 3300006178 | Bacteria | 2103 |
| 89 | Ga0075367_10261539 | 3300006178 | Bacteria | 1086 |
| 90 | Ga0075369_10022853 | 3300006186 | Unclassified | 2582 |
| 91 | Ga0075366_10054380 | 3300006195 | Bacteria | 2377 |
| 92 | Ga0075366_10265470 | 3300006195 | Bacteria | 1048 |
| 93 | Ga0097620_100143416 | 3300006931 | Bacteria | 2462 |
| 94 | Ga0097620_100797790 | 3300006931 | Bacteria | 1032 |
| 95 | Ga0097620_101023948 | 3300006931 | Bacteria | 907 |
| 96 | Ga0105244_10123526 | 3300009036 | Bacteria | 1252 |
| 97 | Ga0105250_10013436 | 3300009092 | Bacteria | 3373 |
| 98 | Ga0105240_10134415 | 3300009093 | Bacteria | 2963 |
| 99 | Ga0105240_10930954 | 3300009093 | Bacteria | 933 |
| 100 | Ga0111539_10034983 | 3300009094 | Bacteria | 6084 |
| 101 | Ga0111539_10298202 | 3300009094 | Bacteria | 1876 |
| 102 | Ga0111539_10717132 | 3300009094 | Bacteria | 1164 |
| 103 | Ga0105245_10423417 | 3300009098 | Bacteria | 1335 |
| 104 | Ga0105243_10100089 | 3300009148 | Bacteria | 2404 |
| 105 | Ga0105242_10262915 | 3300009176 | Bacteria | 1559 |
| 106 | Ga0105249_10698540 | 3300009553 | Bacteria | 1074 |
| 107 | Ga0105246_10089496 | 3300011119 | Bacteria | 2215 |
| 108 | Ga0157371_10533182 | 3300013102 | Bacteria | 869 |
| 109 | Ga0157370_10331847 | 3300013104 | Bacteria | 1402 |
| 110 | Ga0157374_10375535 | 3300013296 | Bacteria | 1415 |
| 111 | Ga0157378_11911564 | 3300013297 | Bacteria | 643 |
| 112 | Ga0163162_10059516 | 3300013306 | Unclassified | 3852 |
| 113 | Ga0157372_10082620 | 3300013307 | Bacteria | 3637 |
| 114 | Ga0157380_10009871 | 3300014326 | Bacteria | 6854 |
| 115 | Ga0157380_10348782 | 3300014326 | Bacteria | 1384 |
| 116 | Ga0157380_11005254 | 3300014326 | Bacteria | 868 |
| 117 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 118 | Ga0163161_10088177 | 3300017792 | Bacteria | 2293 |
| 119 | Ga0209436_111356 | 3300025208 | Bacteria | 1568 |
| 120 | Ga0209672_106578 | 3300025228 | Bacteria | 1873 |
| 121 | Ga0209258_100044 | 3300025242 | Bacteria | 376336 |
| 122 | Ga0209258_100099 | 3300025242 | Bacteria | 214924 |
| 123 | Ga0207425_1000799 | 3300025245 | Bacteria | 16016 |
| 124 | Ga0207425_1004674 | 3300025245 | Bacteria | 4049 |
| 125 | Ga0209148_1000103 | 3300025254 | Bacteria | 215356 |
| 126 | Ga0209148_1005662 | 3300025254 | Bacteria | 2823 |
| 127 | Ga0209759_1001086 | 3300025256 | Bacteria | 17708 |
| 128 | Ga0209759_1001471 | 3300025256 | Bacteria | 13142 |
| 129 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 130 | Ga0209129_1001701 | 3300025258 | Bacteria | 11876 |
| 131 | Ga0209565_1000199 | 3300025263 | Bacteria | 71613 |
| 132 | Ga0209565_1002461 | 3300025263 | Bacteria | 6648 |
| 133 | Ga0209455_1000048 | 3300025272 | Bacteria | 376260 |
| 134 | Ga0209673_1000128 | 3300025273 | Bacteria | 164482 |
| 135 | Ga0209673_1001078 | 3300025273 | Bacteria | 30774 |
| 136 | Ga0209673_1012733 | 3300025273 | Bacteria | 3367 |
| 137 | Ga0209130_1000321 | 3300025284 | Bacteria | 56239 |
| 138 | Ga0209130_1001524 | 3300025284 | Bacteria | 14876 |
| 139 | Ga0209675_1000114 | 3300025291 | Bacteria | 112118 |
| 140 | Ga0209675_1007684 | 3300025291 | Bacteria | 4086 |
| 141 | Ga0209675_1011316 | 3300025291 | Bacteria | 2968 |
| 142 | Ga0209676_1000122 | 3300025292 | Bacteria | 195510 |
| 143 | Ga0209676_1006366 | 3300025292 | Bacteria | 5849 |
| 144 | Ga0209676_1039240 | 3300025292 | Bacteria | 1347 |
| 145 | Ga0209025_1000491 | 3300025294 | Bacteria | 75913 |
| 146 | Ga0209025_1008800 | 3300025294 | Bacteria | 7179 |
| 147 | Ga0209025_1012900 | 3300025294 | Bacteria | 5310 |
| 148 | Ga0209564_1000360 | 3300025295 | Bacteria | 84454 |
| 149 | Ga0209564_1000603 | 3300025295 | Bacteria | 56168 |
| 150 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 151 | Ga0209758_1006146 | 3300025297 | Bacteria | 8800 |
| 152 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 153 | Ga0209050_1020992 | 3300025298 | Bacteria | 2402 |
| 154 | Ga0209256_1000050 | 3300025299 | Bacteria | 308622 |
| 155 | Ga0209256_1000063 | 3300025299 | Bacteria | 252716 |
| 156 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 157 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 158 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 159 | Ga0209051_1002276 | 3300025303 | Bacteria | 14061 |
| 160 | Ga0209051_1007508 | 3300025303 | Bacteria | 5949 |
| 161 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 162 | Ga0209257_1001389 | 3300025304 | Bacteria | 29010 |
| 163 | Ga0209257_1007025 | 3300025304 | Bacteria | 6976 |
| 164 | Ga0207656_10028204 | 3300025321 | Bacteria | 2302 |
| 165 | Ga0207655_1098251 | 3300025728 | Bacteria | 1014 |
| 166 | Ga0207682_10025710 | 3300025893 | Bacteria | 2335 |
| 167 | Ga0207688_10059028 | 3300025901 | Bacteria | 2160 |
| 168 | Ga0207645_10061578 | 3300025907 | Bacteria | 2397 |
| 169 | Ga0207705_10065140 | 3300025909 | Bacteria | 2634 |
| 170 | Ga0207705_10116513 | 3300025909 | Bacteria | 1978 |
| 171 | Ga0207705_10472579 | 3300025909 | Bacteria | 973 |
| 172 | Ga0207707_10013352 | 3300025912 | Bacteria | 7159 |
| 173 | Ga0207695_10092666 | 3300025913 | Bacteria | 3031 |
| 174 | Ga0207660_10436540 | 3300025917 | Bacteria | 1058 |
| 175 | Ga0207662_10278713 | 3300025918 | Bacteria | 1106 |
| 176 | Ga0207657_10066537 | 3300025919 | Bacteria | 3067 |
| 177 | Ga0207649_10496475 | 3300025920 | Bacteria | 928 |
| 178 | Ga0207652_10052118 | 3300025921 | Bacteria | 3510 |
| 179 | Ga0207681_10005664 | 3300025923 | Bacteria | 7668 |
| 180 | Ga0207681_10272045 | 3300025923 | Bacteria | 1330 |
| 181 | Ga0207650_10439850 | 3300025925 | Bacteria | 1084 |
| 182 | Ga0207659_10061912 | 3300025926 | Bacteria | 2699 |
| 183 | Ga0207706_10352568 | 3300025933 | Bacteria | 1279 |
| 184 | Ga0207709_10112856 | 3300025935 | Bacteria | 1821 |
| 185 | Ga0207691_10093863 | 3300025940 | Bacteria | 2685 |
| 186 | Ga0207691_10170475 | 3300025940 | Bacteria | 1906 |
| 187 | Ga0207689_10039309 | 3300025942 | Bacteria | 3917 |
| 188 | Ga0207679_10672841 | 3300025945 | Bacteria | 938 |
| 189 | Ga0207668_10038725 | 3300025972 | Bacteria | 3203 |
| 190 | Ga0207668_10103550 | 3300025972 | Bacteria | 2120 |
| 191 | Ga0207703_10039345 | 3300026035 | Bacteria | 3779 |
| 192 | Ga0207703_11063093 | 3300026035 | Bacteria | 777 |
| 193 | Ga0207639_10123214 | 3300026041 | Bacteria | 2133 |
| 194 | Ga0207708_10644810 | 3300026075 | Bacteria | 901 |
| 195 | Ga0207702_10465616 | 3300026078 | Bacteria | 1228 |
| 196 | Ga0207648_10089893 | 3300026089 | Bacteria | 2683 |
| 197 | Ga0207648_10479655 | 3300026089 | Bacteria | 1136 |
| 198 | Ga0207675_100002774 | 3300026118 | Bacteria | 17200 |
| 199 | Ga0207675_100078181 | 3300026118 | Bacteria | 3100 |
| 200 | Ga0207675_100078505 | 3300026118 | Bacteria | 3093 |
| 201 | Ga0207675_101326310 | 3300026118 | Bacteria | 740 |
| 202 | Ga0209371_1001262 | 3300027312 | Bacteria | 17979 |
| 203 | Ga0209996_1015410 | 3300027395 | Bacteria | 1043 |
| 204 | Ga0209966_1017452 | 3300027695 | Bacteria | 1368 |
| 205 | Ga0209813_10206415 | 3300027866 | Bacteria | 730 |
| 206 | Ga0209974_10020697 | 3300027876 | Bacteria | 2180 |
| 207 | Ga0268264_10375995 | 3300028381 | Bacteria | 1359 |
| 208 | Ga0268264_10846281 | 3300028381 | Bacteria | 916 |
| 209 | Ga0268256_1002820 | 3300030500 | Bacteria | 8394 |
| 210 | Ga0265330_10136572 | 3300031235 | Bacteria | 1043 |
| 211 | Ga0265327_10000008 | 3300031251 | Bacteria | 658870 |
| 212 | Ga0265327_10006023 | 3300031251 | Bacteria | 9843 |
| 213 | Ga0265327_10028160 | 3300031251 | Bacteria | 3218 |
| 214 | Ga0265327_10048524 | 3300031251 | Bacteria | 2233 |
| 215 | Ga0307513_10298981 | 3300031456 | Bacteria | 1377 |
| 216 | Ga0307509_10100357 | 3300031507 | Bacteria | 2933 |
| 217 | Ga0307408_100000177 | 3300031548 | Bacteria | 71449 |
| 218 | Ga0307408_100158756 | 3300031548 | Bacteria | 1794 |
| 219 | Ga0307405_10001913 | 3300031731 | Bacteria | 8967 |
| 220 | Ga0307413_10000338 | 3300031824 | Bacteria | 14792 |
| 221 | Ga0307410_10752461 | 3300031852 | Bacteria | 825 |
| 222 | Ga0307406_10002828 | 3300031901 | Bacteria | 9458 |
| 223 | Ga0307412_10012856 | 3300031911 | Bacteria | 4889 |
| 224 | Ga0307412_10550443 | 3300031911 | Bacteria | 969 |
| 225 | Ga0307409_100009856 | 3300031995 | Bacteria | 5896 |
| 226 | Ga0307409_100324671 | 3300031995 | Bacteria | 1442 |
| 227 | Ga0307409_101226735 | 3300031995 | Bacteria | 774 |
| 228 | Ga0307414_10078765 | 3300032004 | Bacteria | 2403 |
| 229 | Ga0307414_10643352 | 3300032004 | Bacteria | 955 |
| 230 | Ga0307411_10106277 | 3300032005 | Bacteria | 1997 |
| 231 | Ga0307411_10269741 | 3300032005 | Bacteria | 1349 |
| 232 | Ga0307415_100011448 | 3300032126 | Bacteria | 5078 |
| 233 | Ga0307415_101148234 | 3300032126 | Bacteria | 729 |
| 234 | Ga0373931_0006259 | 3300035691 | Bacteria | 5552 |
| 235 | Ga0373927_0002681 | 3300035695 | Bacteria | 12977 |
| 236 | Ga0373937_0140533 | 3300036401 | Bacteria | 2259 |
| 237 | Ga0373937_1048452 | 3300036401 | Bacteria | 764 |
| 238 | Ga0373925_0781219 | 3300037068 | Bacteria | 787 |
| 239 | Ga0395899_0013350 | 3300037312 | Bacteria | 6282 |
| 240 | Ga0395899_0072948 | 3300037312 | Bacteria | 2511 |
| 241 | Ga0395899_0601229 | 3300037312 | Bacteria | 700 |
| 242 | Ga0395900_0083563 | 3300037418 | Bacteria | 3280 |
| 243 | Ga0395900_0127388 | 3300037418 | Bacteria | 2610 |
| 244 | Ga0395900_0723596 | 3300037418 | Bacteria | 927 |
| 245 | Ga0395898_0007949 | 3300037466 | Bacteria | 11250 |
| 246 | Ga0395898_0009334 | 3300037466 | Bacteria | 10309 |
| 247 | Ga0395905_0000597 | 3300037471 | Bacteria | 48243 |
| 248 | Ga0395905_0422908 | 3300037471 | Bacteria | 1228 |
| 249 | Ga0395901_0068022 | 3300038443 | Bacteria | 3710 |
| 250 | Ga0395901_0173159 | 3300038443 | Bacteria | 2264 |
| 251 | Ga0451789_0394941 | 3300041443 | Bacteria | 1526 |
| 252 | Ga0451793_0421842 | 3300041452 | Bacteria | 1111 |
| 253 | Ga0451798_0559650 | 3300041458 | Bacteria | 3187 |
| 254 | Ga0451807_0896412 | 3300041486 | Bacteria | 3216 |
| 255 | Ga0451849_0346875 | 3300041505 | Bacteria | 795 |
| 256 | Ga0451849_1023129 | 3300041505 | Bacteria | 1522 |
| 257 | Ga0451851_0498234 | 3300041507 | Bacteria | 785 |
| 258 | Ga0439448_0241951 | 3300042005 | Bacteria | 636 |
| 259 | Ga0439455_0009486 | 3300042012 | Bacteria | 2114 |
| 260 | Ga0450898_024525 | 3300042134 | Bacteria | 1078 |
| 261 | Ga0450910_007340 | 3300042147 | Bacteria | 1536 |
| 262 | Ga0450918_018668 | 3300042531 | Bacteria | 1210 |
| 263 | Ga0451577_0034620 | 3300042876 | Bacteria | 4551 |
| 264 | Ga0451577_0434675 | 3300042876 | Bacteria | 1192 |
| 265 | Ga0453684_0000457 | 3300044712 | Bacteria | 163653 |
| 266 | Ga0453684_0008562 | 3300044712 | Bacteria | 18255 |
| 267 | Ga0453684_0079900 | 3300044712 | Bacteria | 4086 |
| 268 | Ga0453684_0139112 | 3300044712 | Bacteria | 2902 |
| 269 | Ga0453684_0142700 | 3300044712 | Bacteria | 2857 |
| 270 | Ga0466960_0233079 | 3300044901 | Bacteria | 1017 |
| 271 | Ga0451576_0001528 | 3300045051 | Bacteria | 38953 |
| 272 | Ga0495638_0006304 | 3300046460 | Bacteria | 8647 |
| 273 | Ga0495638_0029313 | 3300046460 | Bacteria | 3549 |
| 274 | Ga0495641_0079107 | 3300046461 | Bacteria | 1473 |
| 275 | Ga0495641_0096161 | 3300046461 | Bacteria | 1322 |
| 276 | Ga0495607_0017616 | 3300046501 | Bacteria | 4579 |
| 277 | Ga0495616_0005680 | 3300046513 | Bacteria | 7641 |
| 278 | Ga0495620_0049339 | 3300046515 | Bacteria | 1802 |
| 279 | Ga0495630_0265367 | 3300046517 | Bacteria | 1312 |
| 280 | Ga0495631_0002176 | 3300046518 | Bacteria | 11313 |
| 281 | Ga0495642_0029291 | 3300046528 | Bacteria | 2197 |
| 282 | Ga0495654_0240493 | 3300046530 | Bacteria | 758 |
| 283 | Ga0495621_0015454 | 3300046539 | Bacteria | 2435 |
| 284 | Ga0495633_0062548 | 3300046558 | Bacteria | 1743 |
| 285 | Ga0495656_0094442 | 3300046615 | Bacteria | 1373 |
| 286 | Ga0495625_0033017 | 3300046660 | Bacteria | 3831 |
| 287 | Ga0495625_0036876 | 3300046660 | Bacteria | 3589 |
| 288 | Ga0495625_0041522 | 3300046660 | Bacteria | 3348 |
| 289 | Ga0495635_0698736 | 3300046663 | Bacteria | 658 |
| 290 | Ga0495588_0033417 | 3300046674 | Bacteria | 2597 |
| 291 | Ga0495670_0157559 | 3300046691 | Bacteria | 1192 |
| 292 | Ga0495676_0026230 | 3300047321 | Bacteria | 5018 |
| 293 | Ga0495677_0030768 | 3300047445 | Bacteria | 1954 |
| 294 | Ga0495614_0019705 | 3300048089 | Bacteria | 2918 |
| 295 | Ga0496108_0018220 | 3300048911 | Bacteria | 5749 |
| 296 | Ga0496109_0331370 | 3300048912 | Bacteria | 1437 |
| 297 | Ga0496110_0213656 | 3300048913 | Bacteria | 1754 |
| 298 | Ga0496114_0006575 | 3300048917 | Bacteria | 9166 |
| 299 | Ga0496114_0063843 | 3300048917 | Bacteria | 3083 |
| 300 | Ga0496114_0398451 | 3300048917 | Bacteria | 1219 |
| 301 | Ga0496116_0021136 | 3300048919 | Bacteria | 4916 |
| 302 | Ga0496117_0013950 | 3300048920 | Bacteria | 6962 |
| 303 | Ga0496118_0157226 | 3300048921 | Bacteria | 1412 |
| 304 | Ga0496121_0014501 | 3300048924 | Bacteria | 8356 |
| 305 | Ga0496123_0037969 | 3300048926 | Bacteria | 3393 |
| 306 | Ga0496124_0024673 | 3300048927 | Bacteria | 5461 |
| 307 | Ga0496125_0012614 | 3300048928 | Bacteria | 8371 |
| 308 | Ga0501036_0260404 | 3300049572 | Bacteria | 1453 |
| 309 | Ga0501047_0359780 | 3300049581 | Bacteria | 1291 |
| 310 | Ga0501048_0255554 | 3300049582 | Bacteria | 1245 |
| 311 | Ga0501073_0996532 | 3300049589 | Bacteria | 576 |
| 312 | Ga0501279_013894 | 3300049775 | Bacteria | 1106 |
| 313 | nmdc:mga03n38_14424_c1 | 3300050490 | Bacteria | 3028 |
| 314 | nmdc:mga03n38_259455_c1 | 3300050490 | Bacteria | 921 |
| 315 | nmdc:mga00v17_34072_c1 | 3300050491 | Bacteria | 3022 |
| 316 | nmdc:mga0k408_12299_c2 | 3300050493 | Bacteria | 2591 |
| 317 | nmdc:mga0k408_307645_c1 | 3300050493 | Bacteria | 946 |
| 318 | nmdc:mga06z11_247064_c1 | 3300050494 | Bacteria | 1050 |
| 319 | nmdc:mga06z11_590894_c1 | 3300050494 | Bacteria | 675 |
| 320 | nmdc:mga06z11_76128_c1 | 3300050494 | Bacteria | 1789 |
| 321 | nmdc:mga04h51_6923_c1 | 3300050495 | Bacteria | 2969 |
| 322 | nmdc:mga07m45_89292_c1 | 3300050496 | Bacteria | 1765 |
| 323 | nmdc:mga08y16_266092_c1 | 3300050511 | Bacteria | 1770 |
| 324 | nmdc:mga08y16_33726_c1 | 3300050511 | Bacteria | 5376 |
| 325 | nmdc:mga0sz30_137437_c1 | 3300050516 | Bacteria | 1078 |
| 326 | nmdc:mga0sz30_201649_c1 | 3300050516 | Unclassified | 883 |
| 327 | Ga0500643_013156 | 3300053087 | Bacteria | 2934 |
| 328 | Ga0500651_0002648 | 3300053093 | Bacteria | 9515 |
| 329 | Ga0500566_0165938 | 3300053094 | Bacteria | 1146 |
| 330 | Ga0500562_002124 | 3300053108 | Bacteria | 4955 |
| 331 | Ga0500571_000087 | 3300053110 | Bacteria | 29151 |
| 332 | Ga0500572_053357 | 3300053111 | Bacteria | 1211 |
| 333 | Ga0500594_0002456 | 3300053118 | Bacteria | 4033 |
| 334 | Ga0500597_156147 | 3300053120 | Bacteria | 977 |
| 335 | Ga0500607_047231 | 3300053121 | Bacteria | 2305 |
| 336 | Ga0500608_253561 | 3300053122 | Bacteria | 685 |
| 337 | Ga0500626_081757 | 3300053128 | Bacteria | 1427 |
| 338 | Ga0500655_003141 | 3300053133 | Bacteria | 2994 |
| 339 | Ga0500658_0000481 | 3300053134 | Bacteria | 17081 |
| 340 | Ga0500658_0000709 | 3300053134 | Bacteria | 13770 |
| 341 | Ga0500559_0004654 | 3300053136 | Bacteria | 6466 |
| 342 | Ga0500559_0044118 | 3300053136 | Bacteria | 1950 |
| 343 | Ga0500568_0003586 | 3300053139 | Bacteria | 8572 |
| 344 | Ga0500574_092169 | 3300053141 | Bacteria | 897 |
| 345 | Ga0500616_0069505 | 3300053153 | Bacteria | 1800 |
| 346 | Ga0500624_049379 | 3300053157 | Bacteria | 779 |
| 347 | Ga0500634_0008688 | 3300053161 | Bacteria | 5091 |
| 348 | Ga0500638_043069 | 3300053162 | Bacteria | 2192 |
| 349 | Ga0500636_0000056 | 3300053177 | Bacteria | 53780 |
| 350 | Ga0500637_0005679 | 3300053178 | Bacteria | 6064 |
| 351 | Ga0500625_028720 | 3300053729 | Bacteria | 2640 |
| 352 | Ga0501084_0646498 | 3300054114 | Bacteria | 893 |
| 353 | 2511130802 | 2510917021 | Bacteria | 5705459 |
| 354 | 2511377454 | 2511231024 | Bacteria | 5835885 |
| 355 | 2513227126 | 2513020051 | Bacteria | 6053213 |
| 356 | 2599623651 | 2599185214 | Bacteria | 8209958 |
| 357 | 2599671730 | 2599185226 | Bacteria | 8233575 |
| 358 | 2599681257 | 2599185227 | Bacteria | 8246414 |
| 359 | 2599693340 | 2599185229 | Bacteria | 8216126 |
| 360 | 2644163222 | 2643221628 | Bacteria | 5745828 |
| 361 | 2738717721 | 2738541277 | Bacteria | 7458140 |
| 362 | 2739251413 | 2738543013 | Bacteria | 5618633 |
| 363 | 2739278407 | 2738543019 | Bacteria | 7459457 |
| 364 | 2819597205 | 2818991446 | Bacteria | 7757362 |
| 365 | 2831266330 | 2831265667 | Bacteria | 7184833 |
| 366 | 2838057558 | 2838054893 | Bacteria | 7451788 |
| 367 | 2842777956 | 2842775625 | Bacteria | 5587290 |
| 368 | 2885204453 | 2885198086 | Bacteria | 7212419 |
| 369 | 2885218106 | 2885211737 | Bacteria | 7212420 |
| 370 | 2895516110 | 2895511927 | Bacteria | 6802080 |
| 371 | 2899924709 | 2899924645 | Bacteria | 7487985 |
| 372 | 2904548158 | 2904541872 | Bacteria | 8915136 |
| 373 | 2928039164 | 2928037797 | Bacteria | 7273642 |
| 374 | 2928045231 | 2928044640 | Bacteria | 7271509 |
| 375 | 2928053036 | 2928051484 | Bacteria | 7773759 |
| 376 | 2928064293 | 2928064002 | Bacteria | 7419480 |
| 377 | 2928071730 | 2928070936 | Bacteria | 8062541 |
| 378 | 2928084325 | 2928084124 | Bacteria | 7159212 |
| 379 | 2929163087 | 2929160207 | Bacteria | 9075316 |
| 380 | 8054931370 | 8054929484 | Bacteria | 5599761 |
| 381 | Ga0075431_100154055 | |||
| 382 | JGI24740J21852_10013476 | |||
| 383 | JGI24739J22299_10119980 | |||
| 384 | JGI25156J39149_1019499 | |||
| 385 | JGI25156J39149_1023041 | |||
| 386 | JGI25152J39213_1004917 | |||
| 387 | JGI25152J39213_1007207 | |||
| 388 | JGI25150J39212_1002999 | |||
| 389 | JGI25150J39212_1009856 | |||
| 390 | JGI25159J45721_1005328 | |||
| 391 | JGI25159J45721_1026736 | |||
| 392 | JGI25151J46595_10011538 | |||
| 393 | JGI25406J46586_10000543 | |||
| 394 | JGI25406J46586_10003894 | |||
| 395 | JGI25153J46596_10010930 | |||
| 396 | JGI25160J50197_1008030 | |||
| 397 | JGI25160J50197_1012599 | |||
| 398 | JGI25161J50226_1003004 | |||
| 399 | Ga0006562J51391_1111446 | |||
| 400 | Ga0007429J51699_1020602 | |||
| 401 | Ga0055535_1000044 | |||
| 402 | Ga0055535_1000330 | |||
| 403 | Ga0055542_1000039 | |||
| 404 | Ga0055542_1025538 | |||
| 405 | Ga0055529_1000638 | |||
| 406 | Ga0055526_1011247 | |||
| 407 | Ga0055526_1017699 | |||
| 408 | Ga0055526_1028107 | |||
| 409 | Ga0055537_1003647 | |||
| 410 | Ga0055524_1009136 | |||
| 411 | Ga0055524_1014442 | |||
| 412 | Ga0055536_1007617 | |||
| 413 | Ga0055536_1019978 | |||
| 414 | Ga0055534_1004448 | |||
| 415 | Ga0055534_1007522 | |||
| 416 | Ga0055528_1007818 | |||
| 417 | Ga0055530_10007119 | |||
| 418 | Ga0055540_1007764 | |||
| 419 | Ga0055543_1004921 | |||
| 420 | Ga0058860_10117914 | |||
| 421 | Ga0065165_1008667 | |||
| 422 | Ga0070658_10108531 | |||
| 423 | Ga0070676_10071280 | |||
| 424 | Ga0070670_100184210 | |||
| 425 | Ga0070677_10246964 | |||
| 426 | Ga0068869_100028858 | |||
| 427 | Ga0068869_100586170 | |||
| 428 | Ga0070680_100139835 | |||
| 429 | Ga0070660_100081807 | |||
| 430 | Ga0070689_100245674 | |||
| 431 | Ga0070691_10449896 | |||
| 432 | Ga0070661_100564444 | |||
| 433 | Ga0070668_100045866 | |||
| 434 | Ga0070668_100076874 | |||
| 435 | Ga0070668_100369603 | |||
| 436 | Ga0070669_100064639 | |||
| 437 | Ga0070675_100097515 | |||
| 438 | Ga0070675_101524152 | |||
| 439 | Ga0070700_100199191 | |||
| 440 | Ga0070678_100172099 | |||
| 441 | Ga0070681_10004449 | |||
| 442 | Ga0070681_10968674 | |||
| 443 | Ga0068867_100068165 | |||
| 444 | Ga0070685_10058833 | |||
| 445 | Ga0070706_100719997 | |||
| 446 | Ga0070679_100134082 | |||
| 447 | Ga0068853_100051727 | |||
| 448 | Ga0070672_100133152 | |||
| 449 | Ga0070672_100267358 | |||
| 450 | Ga0068855_100315895 | |||
| 451 | Ga0068855_101056851 | |||
| 452 | Ga0070664_101329745 | |||
| 453 | Ga0068859_100143412 | |||
| 454 | Ga0068859_100797837 | |||
| 455 | Ga0068859_101023727 | |||
| 456 | Ga0068861_100001935 | |||
| 457 | Ga0068861_100107241 | |||
| 458 | Ga0068861_100367481 | |||
| 459 | Ga0068851_10032539 | |||
| 460 | Ga0068858_100024825 | |||
| 461 | Ga0068858_100528827 | |||
| 462 | Ga0068858_101022869 | |||
| 463 | Ga0081539_10000059 | |||
| 464 | Ga0075368_10003562 | |||
| 465 | Ga0075363_100038828 | |||
| 466 | Ga0075363_100306335 | |||
| 467 | Ga0075364_10043012 | |||
| 468 | Ga0075367_10070346 | |||
| 469 | Ga0075367_10261539 | |||
| 470 | Ga0075369_10022853 | |||
| 471 | Ga0075366_10054380 | |||
| 472 | Ga0075366_10265470 | |||
| 473 | Ga0097620_100143416 | |||
| 474 | Ga0097620_100797790 | |||
| 475 | Ga0097620_101023948 | |||
| 476 | Ga0105244_10123526 | |||
| 477 | Ga0105250_10013436 | |||
| 478 | Ga0105240_10134415 | |||
| 479 | Ga0105240_10930954 | |||
| 480 | Ga0111539_10034983 | |||
| 481 | Ga0111539_10298202 | |||
| 482 | Ga0111539_10717132 | |||
| 483 | Ga0105245_10423417 | |||
| 484 | Ga0105243_10100089 | |||
| 485 | Ga0105242_10262915 | |||
| 486 | Ga0105249_10698540 | |||
| 487 | Ga0105246_10089496 | |||
| 488 | Ga0157371_10533182 | |||
| 489 | Ga0157370_10331847 | |||
| 490 | Ga0157374_10375535 | |||
| 491 | Ga0157378_11911564 | |||
| 492 | Ga0163162_10059516 | |||
| 493 | Ga0157372_10082620 | |||
| 494 | Ga0157380_10009871 | |||
| 495 | Ga0157380_10348782 | |||
| 496 | Ga0157380_11005254 | |||
| 497 | Ga0183362_10001 | |||
| 498 | Ga0163161_10088177 | |||
| 499 | Ga0209436_111356 | |||
| 500 | Ga0209672_106578 | |||
| 501 | Ga0209258_100044 | |||
| 502 | Ga0209258_100099 | |||
| 503 | Ga0207425_1000799 | |||
| 504 | Ga0207425_1004674 | |||
| 505 | Ga0209148_1000103 | |||
| 506 | Ga0209148_1005662 | |||
| 507 | Ga0209759_1001086 | |||
| 508 | Ga0209759_1001471 | |||
| 509 | Ga0209129_1000007 | |||
| 510 | Ga0209129_1001701 | |||
| 511 | Ga0209565_1000199 | |||
| 512 | Ga0209565_1002461 | |||
| 513 | Ga0209455_1000048 | |||
| 514 | Ga0209673_1000128 | |||
| 515 | Ga0209673_1001078 | |||
| 516 | Ga0209673_1012733 | |||
| 517 | Ga0209130_1000321 | |||
| 518 | Ga0209130_1001524 | |||
| 519 | Ga0209675_1000114 | |||
| 520 | Ga0209675_1007684 | |||
| 521 | Ga0209675_1011316 | |||
| 522 | Ga0209676_1000122 | |||
| 523 | Ga0209676_1006366 | |||
| 524 | Ga0209676_1039240 | |||
| 525 | Ga0209025_1000491 | |||
| 526 | Ga0209025_1008800 | |||
| 527 | Ga0209025_1012900 | |||
| 528 | Ga0209564_1000360 | |||
| 529 | Ga0209564_1000603 | |||
| 530 | Ga0209758_1000025 | |||
| 531 | Ga0209758_1006146 | |||
| 532 | Ga0209050_1000002 | |||
| 533 | Ga0209050_1020992 | |||
| 534 | Ga0209256_1000050 | |||
| 535 | Ga0209256_1000063 | |||
| 536 | Ga0207426_1000001 | |||
| 537 | Ga0207426_1000028 | |||
| 538 | Ga0209051_1000002 | |||
| 539 | Ga0209051_1002276 | |||
| 540 | Ga0209051_1007508 | |||
| 541 | Ga0209257_1000002 | |||
| 542 | Ga0209257_1001389 | |||
| 543 | Ga0209257_1007025 | |||
| 544 | Ga0207656_10028204 | |||
| 545 | Ga0207655_1098251 | |||
| 546 | Ga0207682_10025710 | |||
| 547 | Ga0207688_10059028 | |||
| 548 | Ga0207645_10061578 | |||
| 549 | Ga0207705_10065140 | |||
| 550 | Ga0207705_10116513 | |||
| 551 | Ga0207705_10472579 | |||
| 552 | Ga0207707_10013352 | |||
| 553 | Ga0207695_10092666 | |||
| 554 | Ga0207660_10436540 | |||
| 555 | Ga0207662_10278713 | |||
| 556 | Ga0207657_10066537 | |||
| 557 | Ga0207649_10496475 | |||
| 558 | Ga0207652_10052118 | |||
| 559 | Ga0207681_10005664 | |||
| 560 | Ga0207681_10272045 | |||
| 561 | Ga0207650_10439850 | |||
| 562 | Ga0207659_10061912 | |||
| 563 | Ga0207706_10352568 | |||
| 564 | Ga0207709_10112856 | |||
| 565 | Ga0207691_10093863 | |||
| 566 | Ga0207691_10170475 | |||
| 567 | Ga0207689_10039309 | |||
| 568 | Ga0207679_10672841 | |||
| 569 | Ga0207668_10038725 | |||
| 570 | Ga0207668_10103550 | |||
| 571 | Ga0207703_10039345 | |||
| 572 | Ga0207703_11063093 | |||
| 573 | Ga0207639_10123214 | |||
| 574 | Ga0207708_10644810 | |||
| 575 | Ga0207702_10465616 | |||
| 576 | Ga0207648_10089893 | |||
| 577 | Ga0207648_10479655 | |||
| 578 | Ga0207675_100002774 | |||
| 579 | Ga0207675_100078181 | |||
| 580 | Ga0207675_100078505 | |||
| 581 | Ga0207675_101326310 | |||
| 582 | Ga0209371_1001262 | |||
| 583 | Ga0209996_1015410 | |||
| 584 | Ga0209966_1017452 | |||
| 585 | Ga0209813_10206415 | |||
| 586 | Ga0209974_10020697 | |||
| 587 | Ga0268264_10375995 | |||
| 588 | Ga0268264_10846281 | |||
| 589 | Ga0268256_1002820 | |||
| 590 | Ga0265330_10136572 | |||
| 591 | Ga0265327_10000008 | |||
| 592 | Ga0265327_10006023 | |||
| 593 | Ga0265327_10028160 | |||
| 594 | Ga0265327_10048524 | |||
| 595 | Ga0307513_10298981 | |||
| 596 | Ga0307509_10100357 | |||
| 597 | Ga0307408_100000177 | |||
| 598 | Ga0307408_100158756 | |||
| 599 | Ga0307405_10001913 | |||
| 600 | Ga0307413_10000338 | |||
| 601 | Ga0307410_10752461 | |||
| 602 | Ga0307406_10002828 | |||
| 603 | Ga0307412_10012856 | |||
| 604 | Ga0307412_10550443 | |||
| 605 | Ga0307409_100009856 | |||
| 606 | Ga0307409_100324671 | |||
| 607 | Ga0307409_101226735 | |||
| 608 | Ga0307414_10078765 | |||
| 609 | Ga0307414_10643352 | |||
| 610 | Ga0307411_10106277 | |||
| 611 | Ga0307411_10269741 | |||
| 612 | Ga0307415_100011448 | |||
| 613 | Ga0307415_101148234 | |||
| 614 | Ga0373931_0006259 | |||
| 615 | Ga0373927_0002681 | |||
| 616 | Ga0373937_0140533 | |||
| 617 | Ga0373937_1048452 | |||
| 618 | Ga0373925_0781219 | |||
| 619 | Ga0395899_0013350 | |||
| 620 | Ga0395899_0072948 | |||
| 621 | Ga0395899_0601229 | |||
| 622 | Ga0395900_0083563 | |||
| 623 | Ga0395900_0127388 | |||
| 624 | Ga0395900_0723596 | |||
| 625 | Ga0395898_0007949 | |||
| 626 | Ga0395898_0009334 | |||
| 627 | Ga0395905_0000597 | |||
| 628 | Ga0395905_0422908 | |||
| 629 | Ga0395901_0068022 | |||
| 630 | Ga0395901_0173159 | |||
| 631 | Ga0451789_0394941 | |||
| 632 | Ga0451793_0421842 | |||
| 633 | Ga0451798_0559650 | |||
| 634 | Ga0451807_0896412 | |||
| 635 | Ga0451849_0346875 | |||
| 636 | Ga0451849_1023129 | |||
| 637 | Ga0451851_0498234 | |||
| 638 | Ga0439448_0241951 | |||
| 639 | Ga0439455_0009486 | |||
| 640 | Ga0450898_024525 | |||
| 641 | Ga0450910_007340 | |||
| 642 | Ga0450918_018668 | |||
| 643 | Ga0451577_0034620 | |||
| 644 | Ga0451577_0434675 | |||
| 645 | Ga0453684_0000457 | |||
| 646 | Ga0453684_0008562 | |||
| 647 | Ga0453684_0079900 | |||
| 648 | Ga0453684_0139112 | |||
| 649 | Ga0453684_0142700 | |||
| 650 | Ga0466960_0233079 | |||
| 651 | Ga0451576_0001528 | |||
| 652 | Ga0495638_0006304 | |||
| 653 | Ga0495638_0029313 | |||
| 654 | Ga0495641_0079107 | |||
| 655 | Ga0495641_0096161 | |||
| 656 | Ga0495607_0017616 | |||
| 657 | Ga0495616_0005680 | |||
| 658 | Ga0495620_0049339 | |||
| 659 | Ga0495630_0265367 | |||
| 660 | Ga0495631_0002176 | |||
| 661 | Ga0495642_0029291 | |||
| 662 | Ga0495654_0240493 | |||
| 663 | Ga0495621_0015454 | |||
| 664 | Ga0495633_0062548 | |||
| 665 | Ga0495656_0094442 | |||
| 666 | Ga0495625_0033017 | |||
| 667 | Ga0495625_0036876 | |||
| 668 | Ga0495625_0041522 | |||
| 669 | Ga0495635_0698736 | |||
| 670 | Ga0495588_0033417 | |||
| 671 | Ga0495670_0157559 | |||
| 672 | Ga0495676_0026230 | |||
| 673 | Ga0495677_0030768 | |||
| 674 | Ga0495614_0019705 | |||
| 675 | Ga0496108_0018220 | |||
| 676 | Ga0496109_0331370 | |||
| 677 | Ga0496110_0213656 | |||
| 678 | Ga0496114_0006575 | |||
| 679 | Ga0496114_0063843 | |||
| 680 | Ga0496114_0398451 | |||
| 681 | Ga0496116_0021136 | |||
| 682 | Ga0496117_0013950 | |||
| 683 | Ga0496118_0157226 | |||
| 684 | Ga0496121_0014501 | |||
| 685 | Ga0496123_0037969 | |||
| 686 | Ga0496124_0024673 | |||
| 687 | Ga0496125_0012614 | |||
| 688 | Ga0501036_0260404 | |||
| 689 | Ga0501047_0359780 | |||
| 690 | Ga0501048_0255554 | |||
| 691 | Ga0501073_0996532 | |||
| 692 | Ga0501279_013894 | |||
| 693 | nmdc:mga03n38_14424_c1 | |||
| 694 | nmdc:mga03n38_259455_c1 | |||
| 695 | nmdc:mga00v17_34072_c1 | |||
| 696 | nmdc:mga0k408_12299_c2 | |||
| 697 | nmdc:mga0k408_307645_c1 | |||
| 698 | nmdc:mga06z11_247064_c1 | |||
| 699 | nmdc:mga06z11_590894_c1 | |||
| 700 | nmdc:mga06z11_76128_c1 | |||
| 701 | nmdc:mga04h51_6923_c1 | |||
| 702 | nmdc:mga07m45_89292_c1 | |||
| 703 | nmdc:mga08y16_266092_c1 | |||
| 704 | nmdc:mga08y16_33726_c1 | |||
| 705 | nmdc:mga0sz30_137437_c1 | |||
| 706 | nmdc:mga0sz30_201649_c1 | |||
| 707 | Ga0500643_013156 | |||
| 708 | Ga0500651_0002648 | |||
| 709 | Ga0500566_0165938 | |||
| 710 | Ga0500562_002124 | |||
| 711 | Ga0500571_000087 | |||
| 712 | Ga0500572_053357 | |||
| 713 | Ga0500594_0002456 | |||
| 714 | Ga0500597_156147 | |||
| 715 | Ga0500607_047231 | |||
| 716 | Ga0500608_253561 | |||
| 717 | Ga0500626_081757 | |||
| 718 | Ga0500655_003141 | |||
| 719 | Ga0500658_0000481 | |||
| 720 | Ga0500658_0000709 | |||
| 721 | Ga0500559_0004654 | |||
| 722 | Ga0500559_0044118 | |||
| 723 | Ga0500568_0003586 | |||
| 724 | Ga0500574_092169 | |||
| 725 | Ga0500616_0069505 | |||
| 726 | Ga0500624_049379 | |||
| 727 | Ga0500634_0008688 | |||
| 728 | Ga0500638_043069 | |||
| 729 | Ga0500636_0000056 | |||
| 730 | Ga0500637_0005679 | |||
| 731 | Ga0500625_028720 | |||
| 732 | Ga0501084_0646498 | |||
| 733 | 2511130802 | |||
| 734 | 2511377454 | |||
| 735 | 2513227126 | |||
| 736 | 2599623651 | |||
| 737 | 2599671730 | |||
| 738 | 2599681257 | |||
| 739 | 2599693340 | |||
| 740 | 2644163222 | |||
| 741 | 2738717721 | |||
| 742 | 2739251413 | |||
| 743 | 2739278407 | |||
| 744 | 2819597205 | |||
| 745 | 2831266330 | |||
| 746 | 2838057558 | |||
| 747 | 2842777956 | |||
| 748 | 2885204453 | |||
| 749 | 2885218106 | |||
| 750 | 2895516110 | |||
| 751 | 2899924709 | |||
| 752 | 2904548158 | |||
| 753 | 2928039164 | |||
| 754 | 2928045231 | |||
| 755 | 2928053036 | |||
| 756 | 2928064293 | |||
| 757 | 2928071730 | |||
| 758 | 2928084325 | |||
| 759 | 2929163087 | |||
| 760 | 8054931370 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3u7r-assembly1.cif.gz_A | ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans | 0.9453 | 4 | 182 |
| 3u7r-assembly1.cif.gz_A | ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans | 0.9254 | 4 | 182 |
| 3svl-assembly1.cif.gz_B | structural basis of the improvement of chrr - a multi-purpose enzyme | 0.9023 | 5 | 180 |
| 1x77-assembly1.cif.gz_B | crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn | 0.894 | 5 | 176 |
| 3s2y-assembly1.cif.gz_A | crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii | 0.8939 | 4 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u7rB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9385 | 6 | 182 | 3.40.50.360 |
| 3u7rB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9131 | 6 | 182 | 3.40.50.360 |
| 1x77B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.894 | 5 | 176 | 3.40.50.360 |
| 3svlA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.886 | 4 | 179 | 3.40.50.360 |
| 1x77B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8798 | 5 | 176 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I3LNV2-F1-model_v4 | Chromate reductase | 0.9884 | 1 | 77 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A257PSN8-F1-model_v4 | NADPH-dependent FMN reductase | 0.9778 | 1 | 116 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A4Q3T1V4-F1-model_v4 | NAD(P)H-dependent oxidoreductase | 0.9775 | 1 | 119 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A0A0EWY9-F1-model_v4 | NADPH-dependent FMN reductase | 0.9755 | 4 | 182 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A1M3J7V8-F1-model_v4 | deleted | 0.9745 | 1 | 182 |
|