F428648

General Info

Members Datasets Scaffolds Average Seq Length
380 202 752 312

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10002537|Ga0157371_1000253712
Length 378
Sequence LDGATDGGSFLVRFAIKNGAFVALRVGLYRLTSFLTLVIGVSLRVEYNRNIKADVPQKAALGGRGVVAMQNVGLILYPGCQVLGLSMSAIFEIANMIAKEEVYAITLLSEQGGLIQTSAGFSVSTEPFDQRMFDTLLVLGDNVIRLPSKGLVEFLQRSSPFTRRLCSICTGSAALAEAGLLDGRRATTHWAHAKDLQKDYPNIKVDEDRIFINDGPIWTAAGMSACLDLALALVENDLGSEVTRLVSKMLVVYHRRAGGQSQFSVMQELDPKSDRVQAALTFARQHLKADLSVEKLAYVVNMSPRQFSRVFHNETGKSPAKAIENLRVESARIMMETGIHSIDVIATEIGFGDRERMRRAFIRAYGQPPQVFQRANRA

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
61 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
68 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
69 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
70 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
71 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
72 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
73 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
74 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
75 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
76 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
77 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
78 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
79 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
80 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
84 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
87 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
88 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
92 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
95 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
108 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
139 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
172 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
173 2511231018 Pseudomonas sp. GM60 Isolate Nodule
174 2511231019 Pseudomonas sp. GM67 Isolate Nodule
175 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
176 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
177 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
178 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
179 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
180 2773857670 Pseudomonas sp. 478 Isolate Unclassified
181 2784132072 Pseudomonas sp. 460 Isolate Unclassified
182 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
183 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
184 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
185 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
186 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
187 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
188 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
189 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
190 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
191 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
192 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
193 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
194 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
195 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
196 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
197 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
198 2941479691
199 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
200 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
201 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
202 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.84
Metatranscriptomes 0.26
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.53
Nodule 2.63
Rhizoplane 1.84
Rhizosphere 77.63
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10002537 3300013102 Bacteria 17351
2 MRS2a_Contig_5159 2124908027 Bacteria 5101
3 rootH1_10071460 3300003323 Bacteria 5002
4 Ga0055524_1000085 3300003775 Bacteria 117478
5 Ga0055536_1010597 3300003781 Bacteria 3635
6 Ga0055530_10000421 3300003791 Bacteria 37698
7 Ga0065165_1000498 3300005262 Bacteria 60773
8 Ga0065714_10000224 3300005288 Bacteria 7203
9 Ga0065714_10076134 3300005288 Bacteria 2825
10 Ga0070709_10166486 3300005434 Bacteria 1537
11 Ga0070708_100124880 3300005445 Unclassified 2378
12 Ga0070663_100004380 3300005455 Bacteria 8289
13 Ga0070706_100060374 3300005467 Bacteria 3500
14 Ga0070706_100077132 3300005467 Bacteria 3084
15 Ga0070706_100319860 3300005467 Bacteria 1447
16 Ga0070707_100040899 3300005468 Bacteria 4435
17 Ga0070707_100054440 3300005468 Bacteria 3836
18 Ga0070707_100129835 3300005468 Bacteria 2450
19 Ga0070698_100089523 3300005471 Bacteria 3061
20 Ga0070698_100139350 3300005471 Unclassified 2378
21 Ga0070699_100021232 3300005518 Bacteria 5599
22 Ga0070699_100024954 3300005518 Bacteria 5153
23 Ga0070697_100067322 3300005536 Bacteria 2929
24 Ga0070697_100143022 3300005536 Bacteria 2012
25 Ga0068851_10062448 3300005834 Bacteria 1911
26 Ga0068863_100111383 3300005841 Bacteria 2607
27 Ga0070717_10001870 3300006028 Bacteria 14720
28 Ga0070717_10170089 3300006028 Unclassified 1895
29 Ga0070716_100007766 3300006173 Bacteria 5296
30 Ga0070712_100092474 3300006175 Bacteria 2218
31 Ga0075433_10329151 3300006852 Bacteria 1351
32 Ga0075434_100317917 3300006871 Bacteria 1577
33 Ga0079104_1000073 3300006946 Bacteria 152269
34 Ga0099794_10002642 3300007265 Bacteria 6662
35 Ga0105240_10000012 3300009093 Bacteria 496639
36 Ga0105247_10233632 3300009101 Bacteria 1250
37 Ga0114129_10820922 3300009147 Bacteria 1184
38 Ga0105243_10137046 3300009148 Bacteria 2083
39 Ga0105248_10203136 3300009177 Bacteria 2233
40 Ga0105237_10000054 3300009545 Bacteria 155063
41 Ga0105249_10228039 3300009553 Bacteria 1836
42 Ga0157371_10233256 3300013102 Bacteria 1323
43 Ga0157370_10001998 3300013104 Bacteria 25057
44 Ga0157370_10005014 3300013104 Bacteria 14964
45 Ga0157370_10064494 3300013104 Bacteria 3468
46 Ga0157370_10200040 3300013104 Bacteria 1853
47 Ga0163162_10000656 3300013306 Bacteria 31990
48 Ga0163162_10015341 3300013306 Bacteria 7485
49 Ga0182008_10004936 3300014497 Bacteria 7688
50 Ga0182007_10000306 3300015262 Bacteria 31526
51 Ga0182005_1002224 3300015265 Bacteria 7129
52 Ga0182005_1004064 3300015265 Bacteria 4798
53 Ga0182005_1011095 3300015265 Bacteria 2576
54 Ga0163161_10002355 3300017792 Bacteria 13542
55 Ga0163161_10049660 3300017792 Bacteria 3033
56 Ga0209565_1006742 3300025263 Bacteria 3184
57 Ga0209675_1005399 3300025291 Bacteria 5362
58 Ga0209676_1000097 3300025292 Bacteria 237203
59 Ga0209025_1000594 3300025294 Bacteria 65297
60 Ga0209025_1004181 3300025294 Bacteria 12754
61 Ga0209758_1025360 3300025297 Bacteria 2605
62 Ga0209050_1005012 3300025298 Bacteria 8602
63 Ga0209050_1009579 3300025298 Bacteria 4931
64 Ga0209256_1000036 3300025299 Bacteria 386664
65 Ga0207696_1031148 3300025711 Bacteria 1615
66 Ga0207655_1018366 3300025728 Bacteria 3713
67 Ga0207713_1019882 3300025735 Bacteria 3271
68 Ga0207699_10145833 3300025906 Bacteria 1560
69 Ga0207695_10000097 3300025913 Bacteria 262517
70 Ga0207671_10000023 3300025914 Bacteria 274756
71 Ga0207693_10263696 3300025915 Bacteria 1350
72 Ga0207693_10399080 3300025915 Bacteria 1075
73 Ga0207663_10042205 3300025916 Bacteria 2786
74 Ga0207646_10082859 3300025922 Bacteria 2869
75 Ga0207646_10264819 3300025922 Bacteria 1553
76 Ga0207711_10108366 3300025941 Bacteria 2467
77 Ga0207711_10116697 3300025941 Bacteria 2380
78 Ga0207711_10311312 3300025941 Bacteria 1454
79 Ga0207658_10222105 3300025986 Bacteria 1590
80 Ga0207703_10307467 3300026035 Bacteria 1448
81 Ga0207678_10026524 3300026067 Bacteria 5054
82 Ga0207641_10029962 3300026088 Bacteria 4503
83 Ga0207641_10288323 3300026088 Bacteria 1547
84 Ga0307511_10056545 3300030521 Bacteria 3066
85 Ga0265760_10067161 3300031090 Bacteria 1096
86 Ga0265327_10003283 3300031251 Bacteria 15666
87 Ga0307513_10000549 3300031456 Bacteria 53746
88 Ga0307508_10007098 3300031616 Bacteria 10444
89 Ga0395900_0026088 3300037418 Bacteria 5983
90 Ga0436361_0049906 3300039447 Bacteria 14312
91 Ga0439447_000346 3300041407 Bacteria 16736
92 Ga0439447_000499 3300041407 Bacteria 14616
93 Ga0439466_0000604 3300041411 Bacteria 13476
94 Ga0439432_020317 3300042006 Bacteria 2208
95 Ga0439452_000230 3300042010 Bacteria 38856
96 Ga0450902_001483 3300042137 Bacteria 3206
97 Ga0450903_001483 3300042138 Bacteria 4370
98 Ga0450907_000058 3300042146 Bacteria 43951
99 Ga0439446_0017357 3300042156 Bacteria 2011
100 Ga0450909_004147 3300042185 Bacteria 2065
101 Ga0439434_0001657 3300042435 Bacteria 6447
102 Ga0439460_0001297 3300042461 Bacteria 5866
103 Ga0439440_0008683 3300042993 Bacteria 2090
104 Ga0495617_001657 3300046452 Bacteria 9580
105 Ga0495617_040049 3300046452 Bacteria 1567
106 Ga0495617_066414 3300046452 Bacteria 1188
107 Ga0495627_020845 3300046453 Bacteria 2179
108 Ga0495592_0287068 3300046454 Bacteria 1074
109 Ga0495603_0002364 3300046455 Bacteria 11076
110 Ga0495603_0005483 3300046455 Bacteria 7572
111 Ga0495590_0015575 3300046457 Bacteria 2756
112 Ga0495591_000568 3300046458 Bacteria 28319
113 Ga0495591_005101 3300046458 Bacteria 6164
114 Ga0495638_0002136 3300046460 Bacteria 16599
115 Ga0495638_0003736 3300046460 Bacteria 11844
116 Ga0495638_0005498 3300046460 Bacteria 9419
117 Ga0495650_0000405 3300046471 Bacteria 71148
118 Ga0495650_0003886 3300046471 Bacteria 10568
119 Ga0495650_0008598 3300046471 Bacteria 5928
120 Ga0495650_0015667 3300046471 Bacteria 3878
121 Ga0495650_0024321 3300046471 Bacteria 2862
122 Ga0495605_0000001 3300046474 Bacteria 614538
123 Ga0495605_0000002 3300046474 Bacteria 522417
124 Ga0495605_0000596 3300046474 Bacteria 28664
125 Ga0495605_0002542 3300046474 Bacteria 11241
126 Ga0495605_0010814 3300046474 Bacteria 5097
127 Ga0495605_0017727 3300046474 Bacteria 3829
128 Ga0495605_0019142 3300046474 Unclassified 3663
129 Ga0495605_0020392 3300046474 Bacteria 3523
130 Ga0495605_0025618 3300046474 Bacteria 3072
131 Ga0495605_0030187 3300046474 Bacteria 2782
132 Ga0495584_0000140 3300046491 Bacteria 50112
133 Ga0495584_0029936 3300046491 Bacteria 2758
134 Ga0495584_0139148 3300046491 Bacteria 1232
135 Ga0495585_0004195 3300046492 Bacteria 9410
136 Ga0495585_0006562 3300046492 Bacteria 7197
137 Ga0495585_0035561 3300046492 Bacteria 2813
138 Ga0495594_0021800 3300046499 Bacteria 3421
139 Ga0495594_0049214 3300046499 Bacteria 2316
140 Ga0495607_0007373 3300046501 Bacteria 7615
141 Ga0495607_0012901 3300046501 Bacteria 5495
142 Ga0495607_0071430 3300046501 Bacteria 1935
143 Ga0495607_0075874 3300046501 Bacteria 1861
144 Ga0495583_0000012 3300046506 Bacteria 324839
145 Ga0495583_0000384 3300046506 Bacteria 68323
146 Ga0495583_0000958 3300046506 Bacteria 33509
147 Ga0495583_0003084 3300046506 Bacteria 13195
148 Ga0495606_0000502 3300046507 Bacteria 63679
149 Ga0495606_0001784 3300046507 Bacteria 27444
150 Ga0495606_0003335 3300046507 Bacteria 17138
151 Ga0495616_0004436 3300046513 Bacteria 8837
152 Ga0495616_0024999 3300046513 Bacteria 3196
153 Ga0495616_0071354 3300046513 Bacteria 1679
154 Ga0495620_0000238 3300046515 Bacteria 41133
155 Ga0495628_0256952 3300046516 Bacteria 1303
156 Ga0495630_0052143 3300046517 Bacteria 3062
157 Ga0495631_0000002 3300046518 Bacteria 178694
158 Ga0495631_0018585 3300046518 Bacteria 3270
159 Ga0495631_0026138 3300046518 Bacteria 2683
160 Ga0495631_0042980 3300046518 Bacteria 1995
161 Ga0495632_0000337 3300046519 Bacteria 44677
162 Ga0495632_0000809 3300046519 Bacteria 27722
163 Ga0495632_0005882 3300046519 Bacteria 8008
164 Ga0495632_0051789 3300046519 Bacteria 2020
165 Ga0495632_0054455 3300046519 Bacteria 1961
166 Ga0495637_0006366 3300046520 Bacteria 5934
167 Ga0495637_0009572 3300046520 Bacteria 4723
168 Ga0495637_0010919 3300046520 Bacteria 4378
169 Ga0495637_0012537 3300046520 Bacteria 4050
170 Ga0495637_0042422 3300046520 Bacteria 1946
171 Ga0495643_0004454 3300046522 Bacteria 9782
172 Ga0495643_0149563 3300046522 Bacteria 1157
173 Ga0495648_0000489 3300046524 Bacteria 42541
174 Ga0495648_0002490 3300046524 Bacteria 16910
175 Ga0495648_0028042 3300046524 Bacteria 3756
176 Ga0495648_0040461 3300046524 Bacteria 2955
177 Ga0495648_0081148 3300046524 Bacteria 1846
178 Ga0495648_0092770 3300046524 Bacteria 1685
179 Ga0495648_0164621 3300046524 Bacteria 1142
180 Ga0495666_0112332 3300046526 Bacteria 1279
181 Ga0495642_0000082 3300046528 Bacteria 55424
182 Ga0495642_0000614 3300046528 Bacteria 17935
183 Ga0495642_0008247 3300046528 Bacteria 3985
184 Ga0495654_0002809 3300046530 Bacteria 10967
185 Ga0495654_0008201 3300046530 Bacteria 5783
186 Ga0495654_0014398 3300046530 Bacteria 4208
187 Ga0495654_0035022 3300046530 Bacteria 2530
188 Ga0495654_0039244 3300046530 Bacteria 2364
189 Ga0495654_0049997 3300046530 Bacteria 2044
190 Ga0495587_0003814 3300046536 Bacteria 9998
191 Ga0495587_0030035 3300046536 Bacteria 3297
192 Ga0495609_0000008 3300046538 Bacteria 383025
193 Ga0495609_0000043 3300046538 Bacteria 166590
194 Ga0495609_0000316 3300046538 Bacteria 43165
195 Ga0495609_0001746 3300046538 Bacteria 13981
196 Ga0495609_0003357 3300046538 Bacteria 9226
197 Ga0495597_0001812 3300046542 Bacteria 14632
198 Ga0495597_0004173 3300046542 Bacteria 8017
199 Ga0495622_0002129 3300046557 Bacteria 9649
200 Ga0495622_0003956 3300046557 Bacteria 6917
201 Ga0495622_0039369 3300046557 Bacteria 2201
202 Ga0495633_0000009 3300046558 Bacteria 293183
203 Ga0495633_0001615 3300046558 Bacteria 17035
204 Ga0495656_0004525 3300046615 Bacteria 4763
205 Ga0495656_0027305 3300046615 Bacteria 2278
206 Ga0495656_0038529 3300046615 Bacteria 1980
207 Ga0495668_0013772 3300046616 Bacteria 4758
208 Ga0495668_0023769 3300046616 Bacteria 3491
209 Ga0495668_0043534 3300046616 Bacteria 2496
210 Ga0495634_0229519 3300046642 Bacteria 1143
211 Ga0495611_0000881 3300046648 Bacteria 16332
212 Ga0495611_0001920 3300046648 Bacteria 9879
213 Ga0495611_0001963 3300046648 Bacteria 9762
214 Ga0495625_0000101 3300046660 Bacteria 139139
215 Ga0495625_0002877 3300046660 Bacteria 18012
216 Ga0495625_0003812 3300046660 Bacteria 14591
217 Ga0495625_0054522 3300046660 Bacteria 2854
218 Ga0495635_0000974 3300046663 Bacteria 18843
219 Ga0495659_0001444 3300046664 Bacteria 8058
220 Ga0495661_0000029 3300046665 Bacteria 173899
221 Ga0495661_0000683 3300046665 Bacteria 33827
222 Ga0495588_0005503 3300046674 Bacteria 5641
223 Ga0495588_0061872 3300046674 Bacteria 1939
224 Ga0495599_0010036 3300046678 Bacteria 5796
225 Ga0495623_0005517 3300046679 Bacteria 8262
226 Ga0495623_0006658 3300046679 Bacteria 7517
227 Ga0495669_0006789 3300046684 Bacteria 4789
228 Ga0495669_0021051 3300046684 Bacteria 2827
229 Ga0495613_0096296 3300046689 Bacteria 2140
230 Ga0495670_0000754 3300046691 Bacteria 15523
231 Ga0495670_0005261 3300046691 Bacteria 6368
232 Ga0495670_0015669 3300046691 Bacteria 3725
233 Ga0495670_0121336 3300046691 Bacteria 1358
234 Ga0495671_0001167 3300046692 Bacteria 18001
235 Ga0495671_0001456 3300046692 Bacteria 15898
236 Ga0495671_0006886 3300046692 Bacteria 6521
237 Ga0495671_0045519 3300046692 Bacteria 2196
238 Ga0495671_0084166 3300046692 Bacteria 1558
239 Ga0495671_0130060 3300046692 Bacteria 1227
240 Ga0495649_0000520 3300046694 Bacteria 32804
241 Ga0495589_0000562 3300046794 Bacteria 25678
242 Ga0495589_0002795 3300046794 Bacteria 9654
243 Ga0495589_0006121 3300046794 Bacteria 6356
244 Ga0495589_0006667 3300046794 Bacteria 6082
245 Ga0495660_0002662 3300046810 Bacteria 11311
246 Ga0495660_0005147 3300046810 Bacteria 7858
247 Ga0495660_0012098 3300046810 Bacteria 5005
248 Ga0495660_0025524 3300046810 Bacteria 3355
249 Ga0495660_0090455 3300046810 Bacteria 1591
250 Ga0495604_0001350 3300047317 Bacteria 20066
251 Ga0495604_0007361 3300047317 Bacteria 8720
252 Ga0495604_0050064 3300047317 Bacteria 3244
253 Ga0495636_0003234 3300047318 Bacteria 6322
254 Ga0495674_0004091 3300047319 Bacteria 14102
255 Ga0495674_0061922 3300047319 Bacteria 3259
256 Ga0495672_0006877 3300047320 Bacteria 8676
257 Ga0495672_0050685 3300047320 Bacteria 2448
258 Ga0495676_0000071 3300047321 Bacteria 76592
259 Ga0495680_0034478 3300047322 Bacteria 4086
260 Ga0495680_0131754 3300047322 Bacteria 1836
261 Ga0495683_0000037 3300047323 Bacteria 140632
262 Ga0495683_0000039 3300047323 Bacteria 137702
263 Ga0495683_0018642 3300047323 Bacteria 3585
264 Ga0495683_0020994 3300047323 Bacteria 3366
265 Ga0495683_0051006 3300047323 Bacteria 2070
266 Ga0495675_0001140 3300047444 Bacteria 16148
267 Ga0495677_0000486 3300047445 Bacteria 16837
268 Ga0495677_0002366 3300047445 Bacteria 7411
269 Ga0495679_000160 3300047446 Bacteria 61002
270 Ga0495679_000236 3300047446 Bacteria 45851
271 Ga0495679_012800 3300047446 Bacteria 3176
272 Ga0495673_0000093 3300047469 Bacteria 185841
273 Ga0495673_0000118 3300047469 Bacteria 147670
274 Ga0495673_0000319 3300047469 Bacteria 61961
275 Ga0495673_0002274 3300047469 Bacteria 13772
276 Ga0495673_0040276 3300047469 Bacteria 2112
277 Ga0495681_0000023 3300047470 Bacteria 154266
278 Ga0495681_0007115 3300047470 Bacteria 7216
279 Ga0495681_0007940 3300047470 Bacteria 6705
280 Ga0495681_0018538 3300047470 Bacteria 3833
281 Ga0495681_0046686 3300047470 Bacteria 2064
282 Ga0495681_0110215 3300047470 Bacteria 1193
283 Ga0495686_0000101 3300047472 Bacteria 178238
284 Ga0495686_0000326 3300047472 Bacteria 78600
285 Ga0495686_0004072 3300047472 Bacteria 12209
286 Ga0495686_0012995 3300047472 Bacteria 5800
287 Ga0495686_0035953 3300047472 Bacteria 3180
288 Ga0495593_0017638 3300047673 Bacteria 4018
289 Ga0495602_0004273 3300048088 Bacteria 14870
290 Ga0495614_0014589 3300048089 Bacteria 3436
291 Ga0495626_0000045 3300048091 Bacteria 164931
292 Ga0495626_0008878 3300048091 Bacteria 5461
293 Ga0496102_0002794 3300048905 Bacteria 14880
294 Ga0496102_0080628 3300048905 Bacteria 2998
295 Ga0496103_0002417 3300048906 Bacteria 11750
296 Ga0496111_0076087 3300048914 Bacteria 2446
297 Ga0496114_0013372 3300048917 Bacteria 6580
298 Ga0496114_0328116 3300048917 Bacteria 1353
299 Ga0496115_0002159 3300048918 Bacteria 14064
300 Ga0496116_0056833 3300048919 Bacteria 2562
301 Ga0496116_0090000 3300048919 Unclassified 1870
302 Ga0496117_0000571 3300048920 Bacteria 60417
303 Ga0496117_0006453 3300048920 Bacteria 11865
304 Ga0496117_0015523 3300048920 Bacteria 6487
305 Ga0496117_0229119 3300048920 Bacteria 1028
306 Ga0496118_0000832 3300048921 Bacteria 49071
307 Ga0496118_0016993 3300048921 Bacteria 6644
308 Ga0496118_0064123 3300048921 Bacteria 2698
309 Ga0496118_0127825 3300048921 Bacteria 1639
310 Ga0496118_0150004 3300048921 Bacteria 1461
311 Ga0496119_0033975 3300048922 Bacteria 3369
312 Ga0496119_0091410 3300048922 Bacteria 1728
313 Ga0496120_0018436 3300048923 Bacteria 4499
314 Ga0496120_0023502 3300048923 Bacteria 3859
315 Ga0496120_0083871 3300048923 Bacteria 1719
316 Ga0496121_0000249 3300048924 Bacteria 114260
317 Ga0496121_0171755 3300048924 Bacteria 1574
318 Ga0496121_0283825 3300048924 Bacteria 1131
319 Ga0496122_0015911 3300048925 Bacteria 7160
320 Ga0496123_0033851 3300048926 Bacteria 3670
321 Ga0496123_0055855 3300048926 Bacteria 2586
322 Ga0496124_0023182 3300048927 Bacteria 5672
323 Ga0496124_0067672 3300048927 Bacteria 2971
324 Ga0496125_0003865 3300048928 Bacteria 17724
325 Ga0496125_0017859 3300048928 Bacteria 6750
326 Ga0496125_0021777 3300048928 Bacteria 5964
327 Ga0496125_0078586 3300048928 Bacteria 2535
328 Ga0496126_0000138 3300048929 Bacteria 167324
329 Ga0496126_0000426 3300048929 Bacteria 84838
330 Ga0496126_0047165 3300048929 Bacteria 3945
331 Ga0496126_0360446 3300048929 Bacteria 1187
332 Ga0495678_000011 3300049459 Bacteria 335512
333 Ga0495678_029257 3300049459 Bacteria 2315
334 Ga0495682_0006897 3300049460 Bacteria 4563
335 Ga0495682_0018761 3300049460 Bacteria 2604
336 Ga0495682_0029078 3300049460 Bacteria 2046
337 nmdc:mga0n895_226577_c1 3300050512 Bacteria 1897
338 nmdc:mga0a205_270527_c1 3300050515 Bacteria 1576
339 Ga0500643_047182 3300053087 Bacteria 1242
340 Ga0500618_000669 3300053125 Bacteria 20161
341 Ga0500568_0000185 3300053139 Bacteria 54765
342 Ga0500590_024856 3300053148 Bacteria 3109
343 Ga0500622_0005636 3300053156 Bacteria 7459
344 Ga0500622_0017340 3300053156 Bacteria 3831
345 Ga0500633_0069105 3300053160 Bacteria 1258
346 Ga0500645_032678 3300053730 Bacteria 1559
347 2511335805 2511231018 Bacteria 6436256
348 2511347100 2511231019 Bacteria 6520662
349 2514043359 2513237165 Bacteria 6771773
350 2585221146 2582581298 Bacteria 7315509
351 2585332709 2582581316 Bacteria 7774528
352 2585549348 2585427529 Bacteria 7395659
353 2644186693 2643221633 Bacteria 6733554
354 2774123600 2773857670 Bacteria 6407454
355 2784317233 2784132072 Bacteria 6596533
356 2808958249 2808606382 Bacteria 6841132
357 2821450000 2821443989 Bacteria 7658172
358 2840766097 2840764183 Bacteria 6358399
359 2842326997 2842324504 Bacteria 9364110
360 2842350602 2842348783 Bacteria 9002918
361 2842456657 2842454564 Bacteria 8730687
362 2842874336 2842871566 Bacteria 4827117
363 2860342203 2860339153 Bacteria 6846989
364 2874173025 2874168670 Bacteria 8062617
365 2902409319 2902405164 Bacteria 6784948
366 2904543800 2904541872 Bacteria 8915136
367 2904580299 2904578770 Bacteria 5302906
368 2919120025 2919119836 Bacteria 5208557
369 2919456345 2919456309 Bacteria 6586567
370 2929162642 2929160207 Bacteria 9075316
371 2931401137 2931396565 Bacteria 7251677
372 2941481311
373 3007514687 3007511990 Bacteria 6481491
374 3007621891 3007619802 Bacteria 6411688
375 643598783 643348564 Bacteria 8839022
376 644747722 644736347 Bacteria 6476522
377 Ga0157371_10002537
378 MRS2a_Contig_5159
379 rootH1_10071460
380 Ga0055524_1000085
381 Ga0055536_1010597
382 Ga0055530_10000421
383 Ga0065165_1000498
384 Ga0065714_10000224
385 Ga0065714_10076134
386 Ga0070709_10166486
387 Ga0070708_100124880
388 Ga0070663_100004380
389 Ga0070706_100060374
390 Ga0070706_100077132
391 Ga0070706_100319860
392 Ga0070707_100040899
393 Ga0070707_100054440
394 Ga0070707_100129835
395 Ga0070698_100089523
396 Ga0070698_100139350
397 Ga0070699_100021232
398 Ga0070699_100024954
399 Ga0070697_100067322
400 Ga0070697_100143022
401 Ga0068851_10062448
402 Ga0068863_100111383
403 Ga0070717_10001870
404 Ga0070717_10170089
405 Ga0070716_100007766
406 Ga0070712_100092474
407 Ga0075433_10329151
408 Ga0075434_100317917
409 Ga0079104_1000073
410 Ga0099794_10002642
411 Ga0105240_10000012
412 Ga0105247_10233632
413 Ga0114129_10820922
414 Ga0105243_10137046
415 Ga0105248_10203136
416 Ga0105237_10000054
417 Ga0105249_10228039
418 Ga0157371_10233256
419 Ga0157370_10001998
420 Ga0157370_10005014
421 Ga0157370_10064494
422 Ga0157370_10200040
423 Ga0163162_10000656
424 Ga0163162_10015341
425 Ga0182008_10004936
426 Ga0182007_10000306
427 Ga0182005_1002224
428 Ga0182005_1004064
429 Ga0182005_1011095
430 Ga0163161_10002355
431 Ga0163161_10049660
432 Ga0209565_1006742
433 Ga0209675_1005399
434 Ga0209676_1000097
435 Ga0209025_1000594
436 Ga0209025_1004181
437 Ga0209758_1025360
438 Ga0209050_1005012
439 Ga0209050_1009579
440 Ga0209256_1000036
441 Ga0207696_1031148
442 Ga0207655_1018366
443 Ga0207713_1019882
444 Ga0207699_10145833
445 Ga0207695_10000097
446 Ga0207671_10000023
447 Ga0207693_10263696
448 Ga0207693_10399080
449 Ga0207663_10042205
450 Ga0207646_10082859
451 Ga0207646_10264819
452 Ga0207711_10108366
453 Ga0207711_10116697
454 Ga0207711_10311312
455 Ga0207658_10222105
456 Ga0207703_10307467
457 Ga0207678_10026524
458 Ga0207641_10029962
459 Ga0207641_10288323
460 Ga0307511_10056545
461 Ga0265760_10067161
462 Ga0265327_10003283
463 Ga0307513_10000549
464 Ga0307508_10007098
465 Ga0395900_0026088
466 Ga0436361_0049906
467 Ga0439447_000346
468 Ga0439447_000499
469 Ga0439466_0000604
470 Ga0439432_020317
471 Ga0439452_000230
472 Ga0450902_001483
473 Ga0450903_001483
474 Ga0450907_000058
475 Ga0439446_0017357
476 Ga0450909_004147
477 Ga0439434_0001657
478 Ga0439460_0001297
479 Ga0439440_0008683
480 Ga0495617_001657
481 Ga0495617_040049
482 Ga0495617_066414
483 Ga0495627_020845
484 Ga0495592_0287068
485 Ga0495603_0002364
486 Ga0495603_0005483
487 Ga0495590_0015575
488 Ga0495591_000568
489 Ga0495591_005101
490 Ga0495638_0002136
491 Ga0495638_0003736
492 Ga0495638_0005498
493 Ga0495650_0000405
494 Ga0495650_0003886
495 Ga0495650_0008598
496 Ga0495650_0015667
497 Ga0495650_0024321
498 Ga0495605_0000001
499 Ga0495605_0000002
500 Ga0495605_0000596
501 Ga0495605_0002542
502 Ga0495605_0010814
503 Ga0495605_0017727
504 Ga0495605_0019142
505 Ga0495605_0020392
506 Ga0495605_0025618
507 Ga0495605_0030187
508 Ga0495584_0000140
509 Ga0495584_0029936
510 Ga0495584_0139148
511 Ga0495585_0004195
512 Ga0495585_0006562
513 Ga0495585_0035561
514 Ga0495594_0021800
515 Ga0495594_0049214
516 Ga0495607_0007373
517 Ga0495607_0012901
518 Ga0495607_0071430
519 Ga0495607_0075874
520 Ga0495583_0000012
521 Ga0495583_0000384
522 Ga0495583_0000958
523 Ga0495583_0003084
524 Ga0495606_0000502
525 Ga0495606_0001784
526 Ga0495606_0003335
527 Ga0495616_0004436
528 Ga0495616_0024999
529 Ga0495616_0071354
530 Ga0495620_0000238
531 Ga0495628_0256952
532 Ga0495630_0052143
533 Ga0495631_0000002
534 Ga0495631_0018585
535 Ga0495631_0026138
536 Ga0495631_0042980
537 Ga0495632_0000337
538 Ga0495632_0000809
539 Ga0495632_0005882
540 Ga0495632_0051789
541 Ga0495632_0054455
542 Ga0495637_0006366
543 Ga0495637_0009572
544 Ga0495637_0010919
545 Ga0495637_0012537
546 Ga0495637_0042422
547 Ga0495643_0004454
548 Ga0495643_0149563
549 Ga0495648_0000489
550 Ga0495648_0002490
551 Ga0495648_0028042
552 Ga0495648_0040461
553 Ga0495648_0081148
554 Ga0495648_0092770
555 Ga0495648_0164621
556 Ga0495666_0112332
557 Ga0495642_0000082
558 Ga0495642_0000614
559 Ga0495642_0008247
560 Ga0495654_0002809
561 Ga0495654_0008201
562 Ga0495654_0014398
563 Ga0495654_0035022
564 Ga0495654_0039244
565 Ga0495654_0049997
566 Ga0495587_0003814
567 Ga0495587_0030035
568 Ga0495609_0000008
569 Ga0495609_0000043
570 Ga0495609_0000316
571 Ga0495609_0001746
572 Ga0495609_0003357
573 Ga0495597_0001812
574 Ga0495597_0004173
575 Ga0495622_0002129
576 Ga0495622_0003956
577 Ga0495622_0039369
578 Ga0495633_0000009
579 Ga0495633_0001615
580 Ga0495656_0004525
581 Ga0495656_0027305
582 Ga0495656_0038529
583 Ga0495668_0013772
584 Ga0495668_0023769
585 Ga0495668_0043534
586 Ga0495634_0229519
587 Ga0495611_0000881
588 Ga0495611_0001920
589 Ga0495611_0001963
590 Ga0495625_0000101
591 Ga0495625_0002877
592 Ga0495625_0003812
593 Ga0495625_0054522
594 Ga0495635_0000974
595 Ga0495659_0001444
596 Ga0495661_0000029
597 Ga0495661_0000683
598 Ga0495588_0005503
599 Ga0495588_0061872
600 Ga0495599_0010036
601 Ga0495623_0005517
602 Ga0495623_0006658
603 Ga0495669_0006789
604 Ga0495669_0021051
605 Ga0495613_0096296
606 Ga0495670_0000754
607 Ga0495670_0005261
608 Ga0495670_0015669
609 Ga0495670_0121336
610 Ga0495671_0001167
611 Ga0495671_0001456
612 Ga0495671_0006886
613 Ga0495671_0045519
614 Ga0495671_0084166
615 Ga0495671_0130060
616 Ga0495649_0000520
617 Ga0495589_0000562
618 Ga0495589_0002795
619 Ga0495589_0006121
620 Ga0495589_0006667
621 Ga0495660_0002662
622 Ga0495660_0005147
623 Ga0495660_0012098
624 Ga0495660_0025524
625 Ga0495660_0090455
626 Ga0495604_0001350
627 Ga0495604_0007361
628 Ga0495604_0050064
629 Ga0495636_0003234
630 Ga0495674_0004091
631 Ga0495674_0061922
632 Ga0495672_0006877
633 Ga0495672_0050685
634 Ga0495676_0000071
635 Ga0495680_0034478
636 Ga0495680_0131754
637 Ga0495683_0000037
638 Ga0495683_0000039
639 Ga0495683_0018642
640 Ga0495683_0020994
641 Ga0495683_0051006
642 Ga0495675_0001140
643 Ga0495677_0000486
644 Ga0495677_0002366
645 Ga0495679_000160
646 Ga0495679_000236
647 Ga0495679_012800
648 Ga0495673_0000093
649 Ga0495673_0000118
650 Ga0495673_0000319
651 Ga0495673_0002274
652 Ga0495673_0040276
653 Ga0495681_0000023
654 Ga0495681_0007115
655 Ga0495681_0007940
656 Ga0495681_0018538
657 Ga0495681_0046686
658 Ga0495681_0110215
659 Ga0495686_0000101
660 Ga0495686_0000326
661 Ga0495686_0004072
662 Ga0495686_0012995
663 Ga0495686_0035953
664 Ga0495593_0017638
665 Ga0495602_0004273
666 Ga0495614_0014589
667 Ga0495626_0000045
668 Ga0495626_0008878
669 Ga0496102_0002794
670 Ga0496102_0080628
671 Ga0496103_0002417
672 Ga0496111_0076087
673 Ga0496114_0013372
674 Ga0496114_0328116
675 Ga0496115_0002159
676 Ga0496116_0056833
677 Ga0496116_0090000
678 Ga0496117_0000571
679 Ga0496117_0006453
680 Ga0496117_0015523
681 Ga0496117_0229119
682 Ga0496118_0000832
683 Ga0496118_0016993
684 Ga0496118_0064123
685 Ga0496118_0127825
686 Ga0496118_0150004
687 Ga0496119_0033975
688 Ga0496119_0091410
689 Ga0496120_0018436
690 Ga0496120_0023502
691 Ga0496120_0083871
692 Ga0496121_0000249
693 Ga0496121_0171755
694 Ga0496121_0283825
695 Ga0496122_0015911
696 Ga0496123_0033851
697 Ga0496123_0055855
698 Ga0496124_0023182
699 Ga0496124_0067672
700 Ga0496125_0003865
701 Ga0496125_0017859
702 Ga0496125_0021777
703 Ga0496125_0078586
704 Ga0496126_0000138
705 Ga0496126_0000426
706 Ga0496126_0047165
707 Ga0496126_0360446
708 Ga0495678_000011
709 Ga0495678_029257
710 Ga0495682_0006897
711 Ga0495682_0018761
712 Ga0495682_0029078
713 nmdc:mga0n895_226577_c1
714 nmdc:mga0a205_270527_c1
715 Ga0500643_047182
716 Ga0500618_000669
717 Ga0500568_0000185
718 Ga0500590_024856
719 Ga0500622_0005636
720 Ga0500622_0017340
721 Ga0500633_0069105
722 Ga0500645_032678
723 2511335805
724 2511347100
725 2514043359
726 2585221146
727 2585332709
728 2585549348
729 2644186693
730 2774123600
731 2784317233
732 2808958249
733 2821450000
734 2840766097
735 2842326997
736 2842350602
737 2842456657
738 2842874336
739 2860342203
740 2874173025
741 2902409319
742 2904543800
743 2904580299
744 2919120025
745 2919456345
746 2929162642
747 2931401137
748 2941481311
749 3007514687
750 3007621891
751 643598783
752 644747722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

284

323

0.95

PF12833

HTH_18

Helix-turn-helix domain

296

375

0.95

PF01965

DJ-1_PfpI

DJ-1/PfpI family

88

236

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9269 207 308
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9218 205 307
3gra-assembly1.cif.gz_A crystal structure of arac family transcriptional regulator from pseudomonas putida 0.9214 1 182
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9208 205 309
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9048 205 305
ID Description Score Start End Superfamily
af_P0A9E0_176_235_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9614 205 260 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.96 208 309 1.10.10.60
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9344 207 310 1.10.10.60
3oioA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9255 207 308 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.925 208 309 1.10.10.60
ID Description Score Start End GO Terms
AF-A4X6Y1-F1-model_v4 Transcriptional regulator, AraC family 0.9743 206 306 GO:0003700
GO:0043565
AF-A0A4R5YYA1-F1-model_v4 deleted 0.9589 212 309
AF-A0A4Q1US27-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9586 207 308 GO:0003700
GO:0043565
AF-A0A0N1GD68-F1-model_v4 Transcriptional regulator, AraC family 0.9579 208 309 GO:0003700
GO:0043565
AF-A7HFP9-F1-model_v4 Helix-turn-helix-domain containing protein AraC type 0.9569 207 305 GO:0003700
GO:0043565

Map