F428649

General Info

Members Datasets Scaffolds Average Seq Length
380 212 760 155

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10758055|Ga0157371_107580552
Length 177
Sequence MAALTRLALSNFRNHADALIAPGPGFVILTGENGAGKTNILEAVSLLTPGRGLRGATLSDMARSDGPGGFAIGARLGEDVDLELGARAARACGLMILAQLNAALGSLDRVGRVVKLGAFVNSAAGFTDQPKVANGASDLMVEVFGDAGRHARSAVGVPVLPLGAAVEVDAIVALVEA

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
202 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
203 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
204 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
205 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
209 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
210 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
211 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
212 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.26
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.21
Nodule 0.26
Rhizoplane 3.95
Rhizosphere 75.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10758055 3300013102 Bacteria 729
2 JGI24738J21930_10010148 3300002075 Bacteria 2101
3 Ga0070658_10002481 3300005327 Bacteria 15415
4 Ga0070658_10002641 3300005327 Bacteria 14923
5 Ga0070658_10028651 3300005327 Bacteria 4472
6 Ga0070658_10120376 3300005327 Bacteria 2181
7 Ga0070683_100035800 3300005329 Bacteria 4538
8 Ga0070683_100155357 3300005329 Bacteria 2170
9 Ga0070683_100677911 3300005329 Bacteria 987
10 Ga0070690_100014897 3300005330 Bacteria 4624
11 Ga0070670_100016957 3300005331 Bacteria 6253
12 Ga0070670_101362734 3300005331 Bacteria 650
13 Ga0070666_10004871 3300005335 Bacteria 8205
14 Ga0070666_10361241 3300005335 Bacteria 1040
15 Ga0070680_100012761 3300005336 Bacteria 6533
16 Ga0070680_100281094 3300005336 Bacteria 1410
17 Ga0070682_101516675 3300005337 Bacteria 577
18 Ga0070660_100002885 3300005339 Bacteria 11827
19 Ga0070660_100015622 3300005339 Bacteria 5486
20 Ga0070691_10494619 3300005341 Bacteria 706
21 Ga0070661_100000507 3300005344 Bacteria 29896
22 Ga0070661_100238469 3300005344 Bacteria 1400
23 Ga0070668_100009192 3300005347 Bacteria 7328
24 Ga0070668_100045573 3300005347 Bacteria 3365
25 Ga0070669_100000266 3300005353 Bacteria 42790
26 Ga0070669_100000393 3300005353 Bacteria 33445
27 Ga0070671_100000005 3300005355 Bacteria 256547
28 Ga0070671_100003556 3300005355 Bacteria 12184
29 Ga0070659_100004145 3300005366 Bacteria 10335
30 Ga0070659_100067766 3300005366 Bacteria 2830
31 Ga0070667_100010228 3300005367 Bacteria 7751
32 Ga0070667_100010790 3300005367 Bacteria 7549
33 Ga0070713_100719703 3300005436 Bacteria 954
34 Ga0070663_100015997 3300005455 Bacteria 4858
35 Ga0070678_100234577 3300005456 Bacteria 1531
36 Ga0070662_100002012 3300005457 Bacteria 12451
37 Ga0070662_100006536 3300005457 Bacteria 7521
38 Ga0070662_100014552 3300005457 Bacteria 5260
39 Ga0070681_10014179 3300005458 Bacteria 7933
40 Ga0070685_11090112 3300005466 Bacteria 603
41 Ga0070679_100006615 3300005530 Bacteria 10802
42 Ga0070679_101383171 3300005530 Bacteria 650
43 Ga0070684_100161985 3300005535 Bacteria 2030
44 Ga0068853_100000191 3300005539 Bacteria 43207
45 Ga0068853_100185045 3300005539 Bacteria 1890
46 Ga0068853_100259122 3300005539 Bacteria 1598
47 Ga0070686_100029070 3300005544 Bacteria 3358
48 Ga0070665_100000150 3300005548 Bacteria 127885
49 Ga0070665_101739065 3300005548 Bacteria 631
50 Ga0068855_100008151 3300005563 Bacteria 12663
51 Ga0068855_100018010 3300005563 Bacteria 8488
52 Ga0068855_100021457 3300005563 Bacteria 7745
53 Ga0068855_100082676 3300005563 Bacteria 3721
54 Ga0070664_100007691 3300005564 Bacteria 8703
55 Ga0070664_100008974 3300005564 Bacteria 8107
56 Ga0068857_100044374 3300005577 Bacteria 3943
57 Ga0068857_100062982 3300005577 Bacteria 3297
58 Ga0068857_100224031 3300005577 Bacteria 1718
59 Ga0068854_100005234 3300005578 Bacteria 8184
60 Ga0068854_100035461 3300005578 Bacteria 3491
61 Ga0068854_100113624 3300005578 Bacteria 2046
62 Ga0068854_100656912 3300005578 Bacteria 901
63 Ga0068856_100002668 3300005614 Bacteria 18296
64 Ga0068856_100310060 3300005614 Bacteria 1596
65 Ga0068852_100000122 3300005616 Bacteria 52368
66 Ga0068852_100375189 3300005616 Bacteria 1394
67 Ga0068852_100408749 3300005616 Bacteria 1337
68 Ga0068859_100177232 3300005617 Bacteria 2214
69 Ga0068864_100019038 3300005618 Bacteria 5739
70 Ga0068864_100029172 3300005618 Bacteria 4668
71 Ga0068851_10090843 3300005834 Bacteria 1607
72 Ga0068863_100004376 3300005841 Bacteria 13926
73 Ga0068858_100038346 3300005842 Bacteria 4445
74 Ga0068858_100082270 3300005842 Bacteria 2992
75 Ga0068860_100021929 3300005843 Bacteria 6180
76 Ga0068860_100025975 3300005843 Bacteria 5650
77 Ga0068860_100275089 3300005843 Bacteria 1644
78 Ga0068862_100013509 3300005844 Bacteria 6763
79 Ga0075368_10000111 3300006042 Bacteria 21282
80 Ga0075363_100043258 3300006048 Bacteria 2382
81 Ga0075364_10029010 3300006051 Bacteria 3546
82 Ga0075364_10110339 3300006051 Bacteria 1835
83 Ga0075362_10000011 3300006177 Bacteria 108953
84 Ga0075362_10003732 3300006177 Bacteria 5383
85 Ga0075367_10030503 3300006178 Bacteria 3092
86 Ga0075367_10048742 3300006178 Bacteria 2496
87 Ga0075369_10019547 3300006186 Bacteria 2766
88 Ga0075369_10022365 3300006186 Bacteria 2607
89 Ga0075366_10000295 3300006195 Bacteria 22453
90 Ga0075366_10346431 3300006195 Bacteria 911
91 Ga0075366_10477551 3300006195 Bacteria 770
92 Ga0075370_10000004 3300006353 Bacteria 121166
93 Ga0075370_10042623 3300006353 Bacteria 2564
94 Ga0075370_10071458 3300006353 Bacteria 1985
95 Ga0075370_10457675 3300006353 Bacteria 768
96 Ga0075436_100093322 3300006914 Bacteria 2092
97 Ga0097620_100177247 3300006931 Bacteria 2214
98 Ga0079104_1036604 3300006946 Bacteria 1176
99 Ga0105251_10000694 3300009011 Bacteria 31101
100 Ga0105240_10017045 3300009093 Bacteria 9809
101 Ga0105240_10604894 3300009093 Bacteria 1206
102 Ga0111539_10295976 3300009094 Bacteria 1883
103 Ga0105247_10068931 3300009101 Bacteria 2206
104 Ga0105241_10684559 3300009174 Bacteria 935
105 Ga0105248_10016340 3300009177 Bacteria 8168
106 Ga0105248_10031840 3300009177 Bacteria 5892
107 Ga0105248_10155509 3300009177 Bacteria 2580
108 Ga0105238_10020313 3300009551 Bacteria 6761
109 Ga0105246_10000896 3300011119 Bacteria 17101
110 Ga0157373_10007639 3300013100 Bacteria 8031
111 Ga0157373_10019279 3300013100 Bacteria 4968
112 Ga0157371_10000938 3300013102 Bacteria 32583
113 Ga0157370_10000762 3300013104 Bacteria 40264
114 Ga0157370_10679665 3300013104 Bacteria 940
115 Ga0157369_10018279 3300013105 Bacteria 7863
116 Ga0163162_10253028 3300013306 Bacteria 1893
117 Ga0157372_10001396 3300013307 Bacteria 26027
118 Ga0157375_10063191 3300013308 Bacteria 3682
119 Ga0163163_10518378 3300014325 Bacteria 1254
120 Ga0163163_11039795 3300014325 Bacteria 882
121 Ga0157377_10164053 3300014745 Bacteria 1384
122 Ga0206356_10487225 3300020070 Bacteria 615
123 Ga0209050_1001670 3300025298 Bacteria 22344
124 Ga0207656_10341847 3300025321 Bacteria 746
125 Ga0207713_1001943 3300025735 Bacteria 15628
126 Ga0207710_10051875 3300025900 Bacteria 1843
127 Ga0207680_10067512 3300025903 Bacteria 2203
128 Ga0207647_10002569 3300025904 Bacteria 13734
129 Ga0207645_10555495 3300025907 Bacteria 779
130 Ga0207705_10000037 3300025909 Bacteria 197951
131 Ga0207705_10006653 3300025909 Bacteria 8552
132 Ga0207705_10147052 3300025909 Bacteria 1764
133 Ga0207705_10323211 3300025909 Bacteria 1186
134 Ga0207707_10013289 3300025912 Bacteria 7176
135 Ga0207695_10025876 3300025913 Bacteria 6558
136 Ga0207660_10016035 3300025917 Bacteria 4954
137 Ga0207660_10599140 3300025917 Bacteria 897
138 Ga0207657_10000227 3300025919 Bacteria 58998
139 Ga0207657_10062826 3300025919 Bacteria 3177
140 Ga0207649_10311489 3300025920 Bacteria 1154
141 Ga0207649_10795591 3300025920 Bacteria 738
142 Ga0207652_10031500 3300025921 Bacteria 4454
143 Ga0207652_11456456 3300025921 Bacteria 589
144 Ga0207681_10000062 3300025923 Bacteria 99856
145 Ga0207681_10002110 3300025923 Bacteria 12736
146 Ga0207694_10171461 3300025924 Bacteria 1757
147 Ga0207694_10824611 3300025924 Bacteria 784
148 Ga0207650_10054883 3300025925 Bacteria 2957
149 Ga0207650_10104014 3300025925 Bacteria 2190
150 Ga0207644_10000008 3300025931 Bacteria 354219
151 Ga0207644_10001703 3300025931 Bacteria 14193
152 Ga0207690_10001255 3300025932 Bacteria 16060
153 Ga0207706_10003155 3300025933 Bacteria 15829
154 Ga0207706_10014383 3300025933 Bacteria 7172
155 Ga0207709_10033820 3300025935 Bacteria 3006
156 Ga0207691_10273975 3300025940 Bacteria 1453
157 Ga0207711_10001097 3300025941 Bacteria 25808
158 Ga0207711_10318722 3300025941 Bacteria 1436
159 Ga0207711_11231133 3300025941 Bacteria 690
160 Ga0207661_10132709 3300025944 Bacteria 2135
161 Ga0207679_10002582 3300025945 Bacteria 11164
162 Ga0207679_10175041 3300025945 Bacteria 1770
163 Ga0207667_10003923 3300025949 Bacteria 18300
164 Ga0207667_10009894 3300025949 Bacteria 11185
165 Ga0207667_10015998 3300025949 Bacteria 8494
166 Ga0207667_10029281 3300025949 Bacteria 5973
167 Ga0207667_10146073 3300025949 Bacteria 2434
168 Ga0207668_10003592 3300025972 Bacteria 9113
169 Ga0207640_10012375 3300025981 Bacteria 4856
170 Ga0207640_10153397 3300025981 Bacteria 1695
171 Ga0207658_10002546 3300025986 Bacteria 13253
172 Ga0207658_10407710 3300025986 Bacteria 1196
173 Ga0207703_10087733 3300026035 Bacteria 2609
174 Ga0207639_10001018 3300026041 Bacteria 19073
175 Ga0207639_10084798 3300026041 Bacteria 2518
176 Ga0207639_10102017 3300026041 Bacteria 2321
177 Ga0207639_10249950 3300026041 Bacteria 1546
178 Ga0207639_10587845 3300026041 Bacteria 1025
179 Ga0207678_10055583 3300026067 Bacteria 3410
180 Ga0207702_10024465 3300026078 Bacteria 5012
181 Ga0207702_10127236 3300026078 Bacteria 2289
182 Ga0207641_10025589 3300026088 Bacteria 4866
183 Ga0207641_10135506 3300026088 Bacteria 2216
184 Ga0207676_10164122 3300026095 Bacteria 1928
185 Ga0207674_10068241 3300026116 Bacteria 3579
186 Ga0207674_10115685 3300026116 Bacteria 2653
187 Ga0207674_10171507 3300026116 Bacteria 2123
188 Ga0207683_10331923 3300026121 Bacteria 1394
189 Ga0207698_10000256 3300026142 Bacteria 32596
190 Ga0207698_10129305 3300026142 Bacteria 2155
191 Ga0207698_10205607 3300026142 Bacteria 1767
192 Ga0207698_10253863 3300026142 Bacteria 1611
193 Ga0207698_10392076 3300026142 Bacteria 1324
194 Ga0207698_11962968 3300026142 Bacteria 600
195 Ga0209813_10000138 3300027866 Bacteria 25302
196 Ga0209974_10187112 3300027876 Bacteria 760
197 Ga0268266_10000124 3300028379 Bacteria 153051
198 Ga0268266_10050873 3300028379 Bacteria 3556
199 Ga0268265_10006050 3300028380 Bacteria 8224
200 Ga0268265_10197095 3300028380 Bacteria 1744
201 Ga0268264_10023531 3300028381 Bacteria 5023
202 Ga0268264_10153050 3300028381 Bacteria 2070
203 Ga0307408_100007558 3300031548 Bacteria 7185
204 Ga0316576_10759221 3300031727 Bacteria 700
205 Ga0307405_10002149 3300031731 Bacteria 8601
206 Ga0307405_10034387 3300031731 Bacteria 3016
207 Ga0307405_10064993 3300031731 Bacteria 2321
208 Ga0307413_10088340 3300031824 Bacteria 2010
209 Ga0307413_10105104 3300031824 Bacteria 1876
210 Ga0307413_10192886 3300031824 Bacteria 1464
211 Ga0307413_10381607 3300031824 Bacteria 1098
212 Ga0307413_11498377 3300031824 Bacteria 596
213 Ga0307410_10087311 3300031852 Bacteria 2205
214 Ga0307410_10174004 3300031852 Bacteria 1625
215 Ga0307410_10193927 3300031852 Bacteria 1546
216 Ga0307410_10220911 3300031852 Bacteria 1457
217 Ga0307410_10421577 3300031852 Bacteria 1083
218 Ga0307406_10015460 3300031901 Bacteria 4417
219 Ga0307406_10120357 3300031901 Bacteria 1824
220 Ga0307406_10141163 3300031901 Bacteria 1705
221 Ga0307406_10598259 3300031901 Bacteria 909
222 Ga0307407_10035535 3300031903 Bacteria 2738
223 Ga0307407_10581337 3300031903 Bacteria 832
224 Ga0307412_10015842 3300031911 Bacteria 4477
225 Ga0307412_10038231 3300031911 Bacteria 3089
226 Ga0307412_10147888 3300031911 Bacteria 1729
227 Ga0307412_10318612 3300031911 Bacteria 1236
228 Ga0307412_11218629 3300031911 Bacteria 674
229 Ga0307409_100022719 3300031995 Bacteria 4327
230 Ga0307409_101137345 3300031995 Bacteria 803
231 Ga0307409_101532269 3300031995 Bacteria 694
232 Ga0307416_100058152 3300032002 Bacteria 3133
233 Ga0307416_100085127 3300032002 Bacteria 2689
234 Ga0307416_100178895 3300032002 Bacteria 1985
235 Ga0307416_100784702 3300032002 Bacteria 1047
236 Ga0307416_100955638 3300032002 Bacteria 959
237 Ga0307416_101570937 3300032002 Bacteria 763
238 Ga0307414_10030405 3300032004 Bacteria 3527
239 Ga0307414_10123452 3300032004 Bacteria 1995
240 Ga0307414_10250342 3300032004 Bacteria 1472
241 Ga0307414_10322997 3300032004 Bacteria 1314
242 Ga0307414_10354553 3300032004 Bacteria 1260
243 Ga0307414_10591287 3300032004 Bacteria 994
244 Ga0307411_10108583 3300032005 Bacteria 1980
245 Ga0307411_10121896 3300032005 Bacteria 1888
246 Ga0307411_10181842 3300032005 Bacteria 1597
247 Ga0307411_10347821 3300032005 Bacteria 1207
248 Ga0307411_10871807 3300032005 Bacteria 798
249 Ga0307415_100045881 3300032126 Bacteria 2933
250 Ga0307415_100048837 3300032126 Bacteria 2857
251 Ga0307415_100606962 3300032126 Bacteria 975
252 Ga0307415_100751480 3300032126 Bacteria 885
253 Ga0373948_0009357 3300034817 Bacteria 1688
254 Ga0373932_0022153 3300035112 Bacteria 1685
255 Ga0395900_0001302 3300037418 Bacteria 30375
256 Ga0395900_0055234 3300037418 Bacteria 4089
257 Ga0395905_0040414 3300037471 Bacteria 4375
258 Ga0395901_0000131 3300038443 Bacteria 96504
259 Ga0395901_0087152 3300038443 Bacteria 3264
260 Ga0451843_0204349 3300041509 Bacteria 2496
261 Ga0451853_1296698 3300041512 Bacteria 903
262 Ga0451853_1869091 3300041512 Bacteria 685
263 Ga0451853_3454958 3300041512 Bacteria 618
264 Ga0439448_0379228 3300042005 Bacteria 505
265 Ga0466972_0324747 3300044658 Bacteria 719
266 Ga0466963_0011625 3300044694 Bacteria 5360
267 Ga0466957_0277288 3300044842 Bacteria 1121
268 Ga0466967_0017556 3300045976 Bacteria 5687
269 Ga0466967_0385204 3300045976 Bacteria 1362
270 Ga0466967_0610713 3300045976 Bacteria 1077
271 Ga0495638_0028154 3300046460 Bacteria 3631
272 Ga0495638_0097715 3300046460 Bacteria 1760
273 Ga0495638_0112986 3300046460 Bacteria 1612
274 Ga0495596_0000226 3300046500 Bacteria 38225
275 Ga0495596_0003844 3300046500 Bacteria 7462
276 Ga0495610_0001472 3300046512 Bacteria 20775
277 Ga0495620_0178790 3300046515 Bacteria 821
278 Ga0495631_0256651 3300046518 Bacteria 745
279 Ga0495643_0026283 3300046522 Bacteria 3286
280 Ga0495643_0094254 3300046522 Bacteria 1541
281 Ga0495609_0017095 3300046538 Bacteria 3372
282 Ga0495621_0020526 3300046539 Bacteria 2169
283 Ga0495668_0051731 3300046616 Bacteria 2274
284 Ga0495668_0184342 3300046616 Bacteria 1143
285 Ga0495625_0010394 3300046660 Bacteria 7707
286 Ga0495625_0318407 3300046660 Bacteria 991
287 Ga0495670_0049104 3300046691 Bacteria 2111
288 Ga0495671_0016625 3300046692 Bacteria 3926
289 Ga0495686_0523149 3300047472 Bacteria 622
290 Ga0495615_0011944 3300048090 Bacteria 1779
291 Ga0495626_0000346 3300048091 Bacteria 48769
292 Ga0496100_0224231 3300048903 Bacteria 1380
293 Ga0496100_1478584 3300048903 Bacteria 536
294 Ga0496101_0032170 3300048904 Bacteria 3690
295 Ga0496102_0656719 3300048905 Bacteria 972
296 Ga0496103_0030838 3300048906 Bacteria 3264
297 Ga0496103_0085040 3300048906 Bacteria 1993
298 Ga0496104_0216369 3300048907 Bacteria 1827
299 Ga0496105_0040419 3300048908 Bacteria 3845
300 Ga0496106_0025330 3300048909 Bacteria 4414
301 Ga0496107_0000222 3300048910 Bacteria 30025
302 Ga0496108_0668022 3300048911 Bacteria 902
303 Ga0496109_0139276 3300048912 Bacteria 2268
304 Ga0496110_0042442 3300048913 Bacteria 3969
305 Ga0496113_0068029 3300048916 Bacteria 2702
306 Ga0496114_0088885 3300048917 Bacteria 2621
307 Ga0496116_0000045 3300048919 Bacteria 324307
308 Ga0496116_0105157 3300048919 Bacteria 1675
309 Ga0496117_0015740 3300048920 Bacteria 6423
310 Ga0496117_0066447 3300048920 Bacteria 2446
311 Ga0496118_0027493 3300048921 Bacteria 4813
312 Ga0496119_0030505 3300048922 Bacteria 3633
313 Ga0496120_0134271 3300048923 Bacteria 1264
314 Ga0496121_0007888 3300048924 Bacteria 12739
315 Ga0496121_0044956 3300048924 Bacteria 3801
316 Ga0496121_0088816 3300048924 Bacteria 2422
317 Ga0496122_0006623 3300048925 Bacteria 13212
318 Ga0496123_0006282 3300048926 Bacteria 11563
319 Ga0496124_0064546 3300048927 Bacteria 3055
320 Ga0496124_0066544 3300048927 Bacteria 3000
321 Ga0496124_0120767 3300048927 Bacteria 2094
322 Ga0496124_0343690 3300048927 Bacteria 1058
323 Ga0496125_0011111 3300048928 Bacteria 9031
324 Ga0496125_0026441 3300048928 Bacteria 5288
325 Ga0496126_0000568 3300048929 Bacteria 70707
326 Ga0496126_0727325 3300048929 Bacteria 769
327 Ga0495682_0208903 3300049460 Bacteria 692
328 Ga0501031_0919128 3300049568 Bacteria 560
329 Ga0501032_0323046 3300049569 Bacteria 996
330 Ga0501033_0208943 3300049570 Bacteria 1392
331 Ga0501034_0182575 3300049571 Bacteria 2063
332 Ga0501034_0758761 3300049571 Bacteria 865
333 Ga0501036_0961952 3300049572 Bacteria 700
334 Ga0501037_0712920 3300049573 Bacteria 667
335 Ga0501039_0222770 3300049575 Bacteria 1483
336 Ga0501042_0116023 3300049578 Bacteria 1928
337 Ga0501043_0267522 3300049579 Bacteria 1313
338 Ga0501047_0682530 3300049581 Bacteria 845
339 Ga0501070_0736303 3300049586 Bacteria 778
340 Ga0501035_0275868 3300049822 Bacteria 1422
341 Ga0501044_0016615 3300049823 Bacteria 7900
342 Ga0501044_0355335 3300049823 Bacteria 1384
343 nmdc:mga03683_193_c1 3300050489 Bacteria 20052
344 nmdc:mga03683_31940_c1 3300050489 Bacteria 2115
345 nmdc:mga03683_37_c1 3300050489 Bacteria 63604
346 nmdc:mga03n38_194_c1 3300050490 Bacteria 13831
347 nmdc:mga03n38_2320_c1 3300050490 Bacteria 5841
348 nmdc:mga00v17_210007_c1 3300050491 Bacteria 1260
349 nmdc:mga00v17_24287_c1 3300050491 Bacteria 3514
350 nmdc:mga00v17_3287_c1 3300050491 Bacteria 1915
351 nmdc:mga00v17_63149_c1 3300050491 Bacteria 2280
352 nmdc:mga00v17_853116_c1 3300050491 Bacteria 578
353 nmdc:mga0yw44_121926_c1 3300050492 Bacteria 1680
354 nmdc:mga0k408_140671_c1 3300050493 Bacteria 1436
355 nmdc:mga0k408_18_c1 3300050493 Bacteria 112318
356 nmdc:mga06z11_4461_c1 3300050494 Bacteria 5508
357 nmdc:mga06z11_8840_c1 3300050494 Bacteria 4219
358 nmdc:mga04h51_320_c1 3300050495 Bacteria 12120
359 nmdc:mga07m45_169635_c1 3300050496 Bacteria 1268
360 nmdc:mga07m45_19_c1 3300050496 Bacteria 133476
361 nmdc:mga07m45_449_c1 3300050496 Bacteria 17223
362 nmdc:mga07m45_64_c1 3300050496 Bacteria 41841
363 nmdc:mga0sz30_157153_c1 3300050516 Bacteria 1007
364 nmdc:mga0sz30_508_c1 3300050516 Bacteria 14498
365 nmdc:mga0sz30_60916_c1 3300050516 Bacteria 1238
366 Ga0500643_000039 3300053087 Bacteria 169629
367 Ga0500643_023678 3300053087 Bacteria 1959
368 Ga0500562_076088 3300053108 Bacteria 907
369 Ga0500592_011312 3300053116 Bacteria 1426
370 Ga0500594_0011659 3300053118 Bacteria 2055
371 Ga0500607_000152 3300053121 Bacteria 59345
372 Ga0500559_0000524 3300053136 Bacteria 26811
373 Ga0500616_0001209 3300053153 Bacteria 26110
374 Ga0500622_0001350 3300053156 Bacteria 19863
375 Ga0500637_0188159 3300053178 Bacteria 1180
376 Ga0500645_002769 3300053730 Bacteria 7579
377 Ga0500645_002911 3300053730 Bacteria 7297
378 2511130808 2510917021 Bacteria 5705459
379 2882809504 2882806704 Bacteria 3007728
380 2896185983 2896184354 Bacteria 3258548
381 Ga0157371_10758055
382 JGI24738J21930_10010148
383 Ga0070658_10002481
384 Ga0070658_10002641
385 Ga0070658_10028651
386 Ga0070658_10120376
387 Ga0070683_100035800
388 Ga0070683_100155357
389 Ga0070683_100677911
390 Ga0070690_100014897
391 Ga0070670_100016957
392 Ga0070670_101362734
393 Ga0070666_10004871
394 Ga0070666_10361241
395 Ga0070680_100012761
396 Ga0070680_100281094
397 Ga0070682_101516675
398 Ga0070660_100002885
399 Ga0070660_100015622
400 Ga0070691_10494619
401 Ga0070661_100000507
402 Ga0070661_100238469
403 Ga0070668_100009192
404 Ga0070668_100045573
405 Ga0070669_100000266
406 Ga0070669_100000393
407 Ga0070671_100000005
408 Ga0070671_100003556
409 Ga0070659_100004145
410 Ga0070659_100067766
411 Ga0070667_100010228
412 Ga0070667_100010790
413 Ga0070713_100719703
414 Ga0070663_100015997
415 Ga0070678_100234577
416 Ga0070662_100002012
417 Ga0070662_100006536
418 Ga0070662_100014552
419 Ga0070681_10014179
420 Ga0070685_11090112
421 Ga0070679_100006615
422 Ga0070679_101383171
423 Ga0070684_100161985
424 Ga0068853_100000191
425 Ga0068853_100185045
426 Ga0068853_100259122
427 Ga0070686_100029070
428 Ga0070665_100000150
429 Ga0070665_101739065
430 Ga0068855_100008151
431 Ga0068855_100018010
432 Ga0068855_100021457
433 Ga0068855_100082676
434 Ga0070664_100007691
435 Ga0070664_100008974
436 Ga0068857_100044374
437 Ga0068857_100062982
438 Ga0068857_100224031
439 Ga0068854_100005234
440 Ga0068854_100035461
441 Ga0068854_100113624
442 Ga0068854_100656912
443 Ga0068856_100002668
444 Ga0068856_100310060
445 Ga0068852_100000122
446 Ga0068852_100375189
447 Ga0068852_100408749
448 Ga0068859_100177232
449 Ga0068864_100019038
450 Ga0068864_100029172
451 Ga0068851_10090843
452 Ga0068863_100004376
453 Ga0068858_100038346
454 Ga0068858_100082270
455 Ga0068860_100021929
456 Ga0068860_100025975
457 Ga0068860_100275089
458 Ga0068862_100013509
459 Ga0075368_10000111
460 Ga0075363_100043258
461 Ga0075364_10029010
462 Ga0075364_10110339
463 Ga0075362_10000011
464 Ga0075362_10003732
465 Ga0075367_10030503
466 Ga0075367_10048742
467 Ga0075369_10019547
468 Ga0075369_10022365
469 Ga0075366_10000295
470 Ga0075366_10346431
471 Ga0075366_10477551
472 Ga0075370_10000004
473 Ga0075370_10042623
474 Ga0075370_10071458
475 Ga0075370_10457675
476 Ga0075436_100093322
477 Ga0097620_100177247
478 Ga0079104_1036604
479 Ga0105251_10000694
480 Ga0105240_10017045
481 Ga0105240_10604894
482 Ga0111539_10295976
483 Ga0105247_10068931
484 Ga0105241_10684559
485 Ga0105248_10016340
486 Ga0105248_10031840
487 Ga0105248_10155509
488 Ga0105238_10020313
489 Ga0105246_10000896
490 Ga0157373_10007639
491 Ga0157373_10019279
492 Ga0157371_10000938
493 Ga0157370_10000762
494 Ga0157370_10679665
495 Ga0157369_10018279
496 Ga0163162_10253028
497 Ga0157372_10001396
498 Ga0157375_10063191
499 Ga0163163_10518378
500 Ga0163163_11039795
501 Ga0157377_10164053
502 Ga0206356_10487225
503 Ga0209050_1001670
504 Ga0207656_10341847
505 Ga0207713_1001943
506 Ga0207710_10051875
507 Ga0207680_10067512
508 Ga0207647_10002569
509 Ga0207645_10555495
510 Ga0207705_10000037
511 Ga0207705_10006653
512 Ga0207705_10147052
513 Ga0207705_10323211
514 Ga0207707_10013289
515 Ga0207695_10025876
516 Ga0207660_10016035
517 Ga0207660_10599140
518 Ga0207657_10000227
519 Ga0207657_10062826
520 Ga0207649_10311489
521 Ga0207649_10795591
522 Ga0207652_10031500
523 Ga0207652_11456456
524 Ga0207681_10000062
525 Ga0207681_10002110
526 Ga0207694_10171461
527 Ga0207694_10824611
528 Ga0207650_10054883
529 Ga0207650_10104014
530 Ga0207644_10000008
531 Ga0207644_10001703
532 Ga0207690_10001255
533 Ga0207706_10003155
534 Ga0207706_10014383
535 Ga0207709_10033820
536 Ga0207691_10273975
537 Ga0207711_10001097
538 Ga0207711_10318722
539 Ga0207711_11231133
540 Ga0207661_10132709
541 Ga0207679_10002582
542 Ga0207679_10175041
543 Ga0207667_10003923
544 Ga0207667_10009894
545 Ga0207667_10015998
546 Ga0207667_10029281
547 Ga0207667_10146073
548 Ga0207668_10003592
549 Ga0207640_10012375
550 Ga0207640_10153397
551 Ga0207658_10002546
552 Ga0207658_10407710
553 Ga0207703_10087733
554 Ga0207639_10001018
555 Ga0207639_10084798
556 Ga0207639_10102017
557 Ga0207639_10249950
558 Ga0207639_10587845
559 Ga0207678_10055583
560 Ga0207702_10024465
561 Ga0207702_10127236
562 Ga0207641_10025589
563 Ga0207641_10135506
564 Ga0207676_10164122
565 Ga0207674_10068241
566 Ga0207674_10115685
567 Ga0207674_10171507
568 Ga0207683_10331923
569 Ga0207698_10000256
570 Ga0207698_10129305
571 Ga0207698_10205607
572 Ga0207698_10253863
573 Ga0207698_10392076
574 Ga0207698_11962968
575 Ga0209813_10000138
576 Ga0209974_10187112
577 Ga0268266_10000124
578 Ga0268266_10050873
579 Ga0268265_10006050
580 Ga0268265_10197095
581 Ga0268264_10023531
582 Ga0268264_10153050
583 Ga0307408_100007558
584 Ga0316576_10759221
585 Ga0307405_10002149
586 Ga0307405_10034387
587 Ga0307405_10064993
588 Ga0307413_10088340
589 Ga0307413_10105104
590 Ga0307413_10192886
591 Ga0307413_10381607
592 Ga0307413_11498377
593 Ga0307410_10087311
594 Ga0307410_10174004
595 Ga0307410_10193927
596 Ga0307410_10220911
597 Ga0307410_10421577
598 Ga0307406_10015460
599 Ga0307406_10120357
600 Ga0307406_10141163
601 Ga0307406_10598259
602 Ga0307407_10035535
603 Ga0307407_10581337
604 Ga0307412_10015842
605 Ga0307412_10038231
606 Ga0307412_10147888
607 Ga0307412_10318612
608 Ga0307412_11218629
609 Ga0307409_100022719
610 Ga0307409_101137345
611 Ga0307409_101532269
612 Ga0307416_100058152
613 Ga0307416_100085127
614 Ga0307416_100178895
615 Ga0307416_100784702
616 Ga0307416_100955638
617 Ga0307416_101570937
618 Ga0307414_10030405
619 Ga0307414_10123452
620 Ga0307414_10250342
621 Ga0307414_10322997
622 Ga0307414_10354553
623 Ga0307414_10591287
624 Ga0307411_10108583
625 Ga0307411_10121896
626 Ga0307411_10181842
627 Ga0307411_10347821
628 Ga0307411_10871807
629 Ga0307415_100045881
630 Ga0307415_100048837
631 Ga0307415_100606962
632 Ga0307415_100751480
633 Ga0373948_0009357
634 Ga0373932_0022153
635 Ga0395900_0001302
636 Ga0395900_0055234
637 Ga0395905_0040414
638 Ga0395901_0000131
639 Ga0395901_0087152
640 Ga0451843_0204349
641 Ga0451853_1296698
642 Ga0451853_1869091
643 Ga0451853_3454958
644 Ga0439448_0379228
645 Ga0466972_0324747
646 Ga0466963_0011625
647 Ga0466957_0277288
648 Ga0466967_0017556
649 Ga0466967_0385204
650 Ga0466967_0610713
651 Ga0495638_0028154
652 Ga0495638_0097715
653 Ga0495638_0112986
654 Ga0495596_0000226
655 Ga0495596_0003844
656 Ga0495610_0001472
657 Ga0495620_0178790
658 Ga0495631_0256651
659 Ga0495643_0026283
660 Ga0495643_0094254
661 Ga0495609_0017095
662 Ga0495621_0020526
663 Ga0495668_0051731
664 Ga0495668_0184342
665 Ga0495625_0010394
666 Ga0495625_0318407
667 Ga0495670_0049104
668 Ga0495671_0016625
669 Ga0495686_0523149
670 Ga0495615_0011944
671 Ga0495626_0000346
672 Ga0496100_0224231
673 Ga0496100_1478584
674 Ga0496101_0032170
675 Ga0496102_0656719
676 Ga0496103_0030838
677 Ga0496103_0085040
678 Ga0496104_0216369
679 Ga0496105_0040419
680 Ga0496106_0025330
681 Ga0496107_0000222
682 Ga0496108_0668022
683 Ga0496109_0139276
684 Ga0496110_0042442
685 Ga0496113_0068029
686 Ga0496114_0088885
687 Ga0496116_0000045
688 Ga0496116_0105157
689 Ga0496117_0015740
690 Ga0496117_0066447
691 Ga0496118_0027493
692 Ga0496119_0030505
693 Ga0496120_0134271
694 Ga0496121_0007888
695 Ga0496121_0044956
696 Ga0496121_0088816
697 Ga0496122_0006623
698 Ga0496123_0006282
699 Ga0496124_0064546
700 Ga0496124_0066544
701 Ga0496124_0120767
702 Ga0496124_0343690
703 Ga0496125_0011111
704 Ga0496125_0026441
705 Ga0496126_0000568
706 Ga0496126_0727325
707 Ga0495682_0208903
708 Ga0501031_0919128
709 Ga0501032_0323046
710 Ga0501033_0208943
711 Ga0501034_0182575
712 Ga0501034_0758761
713 Ga0501036_0961952
714 Ga0501037_0712920
715 Ga0501039_0222770
716 Ga0501042_0116023
717 Ga0501043_0267522
718 Ga0501047_0682530
719 Ga0501070_0736303
720 Ga0501035_0275868
721 Ga0501044_0016615
722 Ga0501044_0355335
723 nmdc:mga03683_193_c1
724 nmdc:mga03683_31940_c1
725 nmdc:mga03683_37_c1
726 nmdc:mga03n38_194_c1
727 nmdc:mga03n38_2320_c1
728 nmdc:mga00v17_210007_c1
729 nmdc:mga00v17_24287_c1
730 nmdc:mga00v17_3287_c1
731 nmdc:mga00v17_63149_c1
732 nmdc:mga00v17_853116_c1
733 nmdc:mga0yw44_121926_c1
734 nmdc:mga0k408_140671_c1
735 nmdc:mga0k408_18_c1
736 nmdc:mga06z11_4461_c1
737 nmdc:mga06z11_8840_c1
738 nmdc:mga04h51_320_c1
739 nmdc:mga07m45_169635_c1
740 nmdc:mga07m45_19_c1
741 nmdc:mga07m45_449_c1
742 nmdc:mga07m45_64_c1
743 nmdc:mga0sz30_157153_c1
744 nmdc:mga0sz30_508_c1
745 nmdc:mga0sz30_60916_c1
746 Ga0500643_000039
747 Ga0500643_023678
748 Ga0500562_076088
749 Ga0500592_011312
750 Ga0500594_0011659
751 Ga0500607_000152
752 Ga0500559_0000524
753 Ga0500616_0001209
754 Ga0500622_0001350
755 Ga0500637_0188159
756 Ga0500645_002769
757 Ga0500645_002911
758 2511130808
759 2882809504
760 2896185983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14588

YjgF_endoribonc

YjgF/chorismate_mutase-like, putative endoribonuclease

67

174

0.94

PF13476

AAA_23

AAA domain

6

72

0.91

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

67

174

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2otm-assembly1.cif.gz_C crystal structure of a putative endoribonuclease (so_1960) from shewanella oneidensis mr-1 at 1.85 a resolution 0.9415 1 150
3d01-assembly1.cif.gz_I error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9332 3 151
3d01-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9321 2 151
3d01-assembly2.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.932 2 151
3d01-assembly1.cif.gz_K error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9309 2 152
ID Description Score Start End Superfamily
af_A4I058_2_156_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9616 2 151 3.30.1330.40
af_A4I058_2_156_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9372 2 151 3.30.1330.40
af_I6YGW9_1_150_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9366 1 150 3.30.1330.40
2otmC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9342 1 150 3.30.1330.40
af_I6YGW9_1_150_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9306 1 150 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A382K155-F1-model_v4 Endoribonuclease L-PSP/chorismate mutase-like domain-containing protein 0.9989 57 151
AF-X1SC61-F1-model_v4 Endoribonuclease L-PSP/chorismate mutase-like domain-containing protein 0.9978 59 152
AF-A0A7R8WSA3-F1-model_v4 Endoribonuclease L-PSP/chorismate mutase-like domain-containing protein 0.9941 48 152
AF-A0A502X7X9-F1-model_v4 deleted 0.9937 59 151
AF-A0A847ZXD2-F1-model_v4 RidA family protein 0.9933 57 151

Map