F428671

General Info

Members Datasets Scaffolds Average Seq Length
380 232 760 291

Family's Representative Sequence

Representative Sequence 3300025233|Ga0209437_103578|Ga0209437_1035782
Length 331
Sequence MTWMTRRNFNVTAAIAAAAPLTVNRDDSSTGTTVRQEPRLKIVPRMEFRLVDVFSKEPLSGNGLVVFMSNERVSPDMMQALTREMRQFESIFLESTNNPSVVKARVFTMEEELDFAGHPLLGAAAALHEQRLPEKQVASWTIELRHKTIPVTTTREKSWYRANMNQGEAEFGKTLSMEESKPFLAALNLKTTQVAKSLPLQQVSTGLPYLIVPISDGLENARIVQSDFESLLATVGAKFVYVLDVNQREGRTWDNQGLVEDVATGSAAGPVGAYLVRQKIIEPGHELVLRQGRFVGRPSLLFVTVQATATGRFEVSVAGDVRLIARGRLGA

Samples

Sample ID Description Type Environment
1 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
166 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
167 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
168 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
169 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
170 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
220 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
222 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
223 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
230 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
231 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
232 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.26
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.32
Nodule 0
Rhizoplane 3.95
Rhizosphere 74.21
Stem 0
Stem Tuber 0
Unclassified 17.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209437_103578 3300025233 Bacteria 2793
2 JGI24736J21556_1001290 3300001904 Bacteria 4594
3 JGI24740J21852_10000328 3300001979 Bacteria 20047
4 JGI25155J39150_1000098 3300002704 Bacteria 48725
5 JGI25156J39149_1000163 3300002705 Bacteria 48762
6 JGI25154J39366_1000183 3300002738 Bacteria 48762
7 JGI25157J39369_1000209 3300002741 Bacteria 48762
8 JGI25150J39212_1001877 3300002774 Bacteria 5537
9 JGI25159J45721_1001207 3300002987 Bacteria 10956
10 JGI25159J45721_1004564 3300002987 Bacteria 4562
11 JGI25151J46595_10002055 3300003187 Bacteria 12566
12 rootH1_10152290 3300003316 Unclassified 1917
13 rootH1_10034446 3300003323 Bacteria 2526
14 rootH1_10282976 3300003323 Unclassified 1230
15 JGI25160J50197_1000212 3300003354 Bacteria 47984
16 JGI25161J50226_1000151 3300003374 Bacteria 47984
17 Ga0055526_1000958 3300003771 Bacteria 21286
18 Ga0055526_1005848 3300003771 Bacteria 6907
19 Ga0055537_1000084 3300003773 Bacteria 68680
20 Ga0055537_1007230 3300003773 Bacteria 2703
21 Ga0055524_1000082 3300003775 Bacteria 119749
22 Ga0055534_1002638 3300003784 Bacteria 6088
23 Ga0055528_1001888 3300003790 Bacteria 11933
24 Ga0055530_10001442 3300003791 Bacteria 17391
25 Ga0055540_1000010 3300003792 Bacteria 290865
26 Ga0055531_10000461 3300003794 Bacteria 37626
27 Ga0055543_1000394 3300004625 Bacteria 27958
28 Ga0065165_1005448 3300005262 Bacteria 7147
29 Ga0065165_1010042 3300005262 Bacteria 4157
30 Ga0065165_1023417 3300005262 Bacteria 2095
31 Ga0065165_1042841 3300005262 Bacteria 1333
32 Ga0070658_10000059 3300005327 Bacteria 112781
33 Ga0070683_100008694 3300005329 Bacteria 8634
34 Ga0070690_100109738 3300005330 Bacteria 1839
35 Ga0070666_10016597 3300005335 Unclassified 4711
36 Ga0070680_100064016 3300005336 Unclassified 3013
37 Ga0070680_100354177 3300005336 Unclassified 1248
38 Ga0070682_100030079 3300005337 Bacteria 3274
39 Ga0068868_100384980 3300005338 Bacteria 1207
40 Ga0070660_100002661 3300005339 Bacteria 12268
41 Ga0070691_10000433 3300005341 Bacteria 15463
42 Ga0070671_100003166 3300005355 Bacteria 12836
43 Ga0070671_100013393 3300005355 Bacteria 6611
44 Ga0070659_100019554 3300005366 Bacteria 5134
45 Ga0070667_100013576 3300005367 Bacteria 6731
46 Ga0070713_100000603 3300005436 Bacteria 22834
47 Ga0070713_100152272 3300005436 Bacteria 2058
48 Ga0070713_100160124 3300005436 Bacteria 2008
49 Ga0070711_100040670 3300005439 Unclassified 3136
50 Ga0070708_100229404 3300005445 Bacteria 1742
51 Ga0070681_10057167 3300005458 Bacteria 3881
52 Ga0070681_10111687 3300005458 Unclassified 2672
53 Ga0070681_10261772 3300005458 Bacteria 1641
54 Ga0070681_10306941 3300005458 Bacteria 1496
55 Ga0070681_10610877 3300005458 Bacteria 1005
56 Ga0070679_100032218 3300005530 Bacteria 5182
57 Ga0070679_100082804 3300005530 Bacteria 3198
58 Ga0070679_100101386 3300005530 Unclassified 2865
59 Ga0070684_100000079 3300005535 Bacteria 63157
60 Ga0070684_100139105 3300005535 Bacteria 2195
61 Ga0068853_100031597 3300005539 Bacteria 4479
62 Ga0070672_100467127 3300005543 Bacteria 1088
63 Ga0070696_100210192 3300005546 Unclassified 1456
64 Ga0070665_100000002 3300005548 Bacteria 849037
65 Ga0068855_100011557 3300005563 Bacteria 10662
66 Ga0068855_100227601 3300005563 Unclassified 2089
67 Ga0070664_100032000 3300005564 Bacteria 4399
68 Ga0068857_100001971 3300005577 Bacteria 16594
69 Ga0068857_100025208 3300005577 Bacteria 5237
70 Ga0068856_100036841 3300005614 Bacteria 4797
71 Ga0068856_100052677 3300005614 Unclassified 4013
72 Ga0068856_100059111 3300005614 Bacteria 3786
73 Ga0068856_100074285 3300005614 Unclassified 3366
74 Ga0068852_100089523 3300005616 Bacteria 2751
75 Ga0068852_100148855 3300005616 Bacteria 2175
76 Ga0068852_100261053 3300005616 Bacteria 1663
77 Ga0068864_100026930 3300005618 Bacteria 4850
78 Ga0068864_100056346 3300005618 Bacteria 3395
79 Ga0068851_10009522 3300005834 Unclassified 4520
80 Ga0068863_100055538 3300005841 Unclassified 3750
81 Ga0068863_100280724 3300005841 Bacteria 1614
82 Ga0068858_100116675 3300005842 Bacteria 2495
83 Ga0068858_100211894 3300005842 Unclassified 1833
84 Ga0068860_100000019 3300005843 Bacteria 299860
85 Ga0068860_100209985 3300005843 Unclassified 1888
86 Ga0068862_100041126 3300005844 Bacteria 3932
87 Ga0075362_10023486 3300006177 Bacteria 2608
88 Ga0075370_10146151 3300006353 Bacteria 1384
89 Ga0068871_100158296 3300006358 Bacteria 1935
90 Ga0075428_100064568 3300006844 Bacteria 4009
91 Ga0075431_100028837 3300006847 Bacteria 5707
92 Ga0105240_10000607 3300009093 Bacteria 66455
93 Ga0105240_10046895 3300009093 Bacteria 5472
94 Ga0105240_10165405 3300009093 Bacteria 2624
95 Ga0105240_10290640 3300009093 Unclassified 1874
96 Ga0105247_10015185 3300009101 Bacteria 4617
97 Ga0105241_10011338 3300009174 Bacteria 6534
98 Ga0105241_10170958 3300009174 Bacteria 1795
99 Ga0105241_10172883 3300009174 Bacteria 1786
100 Ga0105242_10028876 3300009176 Unclassified 4419
101 Ga0105248_10001858 3300009177 Bacteria 23422
102 Ga0105248_10007623 3300009177 Bacteria 11890
103 Ga0105248_10055784 3300009177 Bacteria 4433
104 Ga0105248_10125720 3300009177 Unclassified 2893
105 Ga0105248_10126478 3300009177 Unclassified 2883
106 Ga0105237_10002039 3300009545 Bacteria 25680
107 Ga0105237_10019463 3300009545 Bacteria 7010
108 Ga0105237_10070699 3300009545 Bacteria 3486
109 Ga0105237_10192432 3300009545 Bacteria 2039
110 Ga0105237_10328889 3300009545 Bacteria 1532
111 Ga0105238_10023933 3300009551 Bacteria 6225
112 Ga0105238_10063887 3300009551 Unclassified 3682
113 Ga0105238_10132638 3300009551 Unclassified 2469
114 Ga0105238_10275769 3300009551 Bacteria 1662
115 Ga0105238_10431647 3300009551 Bacteria 1313
116 Ga0105239_10000195 3300010375 Bacteria 88195
117 Ga0105239_10008295 3300010375 Bacteria 11841
118 Ga0105239_10120633 3300010375 Bacteria 2912
119 Ga0105239_10362408 3300010375 Bacteria 1637
120 Ga0105239_10543359 3300010375 Unclassified 1323
121 Ga0105239_10776179 3300010375 Bacteria 1097
122 Ga0157326_1002087 3300012513 Bacteria 2165
123 Ga0157373_10056327 3300013100 Bacteria 2792
124 Ga0157373_10078214 3300013100 Bacteria 2333
125 Ga0157370_10001646 3300013104 Bacteria 27589
126 Ga0157370_10018539 3300013104 Bacteria 6997
127 Ga0157370_10068197 3300013104 Unclassified 3362
128 Ga0157370_10108255 3300013104 Unclassified 2599
129 Ga0157369_10006631 3300013105 Bacteria 13389
130 Ga0157369_10235321 3300013105 Bacteria 1914
131 Ga0157374_10128423 3300013296 Bacteria 2451
132 Ga0157374_10521587 3300013296 Bacteria 1194
133 Ga0157378_10172624 3300013297 Bacteria 2029
134 Ga0163162_10000625 3300013306 Bacteria 32864
135 Ga0163162_10013855 3300013306 Bacteria 7875
136 Ga0163162_10058120 3300013306 Bacteria 3896
137 Ga0163162_10072773 3300013306 Bacteria 3492
138 Ga0157372_10005642 3300013307 Bacteria 13304
139 Ga0157372_10038992 3300013307 Bacteria 5243
140 Ga0157372_10050687 3300013307 Bacteria 4617
141 Ga0157372_10094125 3300013307 Unclassified 3411
142 Ga0157372_10132357 3300013307 Bacteria 2870
143 Ga0157372_10173772 3300013307 Bacteria 2493
144 Ga0157372_10481864 3300013307 Unclassified 1446
145 Ga0157375_10007976 3300013308 Bacteria 9270
146 Ga0157375_10324551 3300013308 Unclassified 1704
147 Ga0157379_10032440 3300014968 Bacteria 4657
148 Ga0157379_10334459 3300014968 Bacteria 1384
149 Ga0157376_10017327 3300014969 Bacteria 5491
150 Ga0157376_10138410 3300014969 Unclassified 2181
151 Ga0157376_10176201 3300014969 Bacteria 1951
152 Ga0157376_10390250 3300014969 Bacteria 1343
153 Ga0163161_10016559 3300017792 Bacteria 5148
154 Ga0154015_1199638 3300020610 Bacteria 4150
155 Ga0213876_10047465 3300021384 Bacteria 2270
156 Ga0209435_100010 3300025206 Bacteria 475373
157 Ga0207425_1008307 3300025245 Bacteria 2667
158 Ga0209646_1000001 3300025246 Bacteria 3092932
159 Ga0209026_1000001 3300025250 Bacteria 1228671
160 Ga0209759_1000001 3300025256 Bacteria 2799452
161 Ga0209233_1000799 3300025261 Bacteria 14109
162 Ga0209565_1000036 3300025263 Bacteria 293334
163 Ga0209565_1000686 3300025263 Bacteria 21039
164 Ga0209130_1000042 3300025284 Bacteria 257581
165 Ga0209130_1000151 3300025284 Bacteria 107021
166 Ga0209675_1000751 3300025291 Bacteria 21867
167 Ga0209675_1001480 3300025291 Bacteria 13498
168 Ga0209675_1022494 3300025291 Bacteria 1655
169 Ga0209676_1000007 3300025292 Bacteria 1029371
170 Ga0209676_1002711 3300025292 Bacteria 11932
171 Ga0209025_1001245 3300025294 Bacteria 35389
172 Ga0209025_1001980 3300025294 Bacteria 23509
173 Ga0209025_1002721 3300025294 Bacteria 17941
174 Ga0209025_1028725 3300025294 Bacteria 2715
175 Ga0209564_1000729 3300025295 Bacteria 46947
176 Ga0209564_1000903 3300025295 Bacteria 38881
177 Ga0209564_1002398 3300025295 Bacteria 14955
178 Ga0209758_1009443 3300025297 Bacteria 6065
179 Ga0209050_1000003 3300025298 Bacteria 1609245
180 Ga0209050_1001985 3300025298 Bacteria 19184
181 Ga0209256_1000001 3300025299 Bacteria 2166974
182 Ga0207426_1000097 3300025302 Bacteria 265930
183 Ga0209051_1000003 3300025303 Bacteria 1609245
184 Ga0209257_1000020 3300025304 Bacteria 773356
185 Ga0207642_10022822 3300025899 Unclassified 2489
186 Ga0207647_10003540 3300025904 Bacteria 11711
187 Ga0207705_10000216 3300025909 Bacteria 57377
188 Ga0207705_10002735 3300025909 Bacteria 13520
189 Ga0207654_10012517 3300025911 Bacteria 4348
190 Ga0207654_10032061 3300025911 Unclassified 2899
191 Ga0207707_10001178 3300025912 Bacteria 24639
192 Ga0207707_10106019 3300025912 Unclassified 2457
193 Ga0207707_10125271 3300025912 Bacteria 2247
194 Ga0207707_10169719 3300025912 Bacteria 1907
195 Ga0207695_10001170 3300025913 Bacteria 45242
196 Ga0207695_10116195 3300025913 Bacteria 2649
197 Ga0207695_10314229 3300025913 Unclassified 1457
198 Ga0207671_10001902 3300025914 Bacteria 23210
199 Ga0207671_10010501 3300025914 Bacteria 7634
200 Ga0207671_10042211 3300025914 Bacteria 3376
201 Ga0207671_10148490 3300025914 Bacteria 1810
202 Ga0207671_10207310 3300025914 Bacteria 1532
203 Ga0207671_10269742 3300025914 Bacteria 1340
204 Ga0207693_10009625 3300025915 Bacteria 7868
205 Ga0207693_10013867 3300025915 Bacteria 6491
206 Ga0207663_10086780 3300025916 Bacteria 2064
207 Ga0207660_10002385 3300025917 Bacteria 12353
208 Ga0207660_10031380 3300025917 Bacteria 3658
209 Ga0207660_10395268 3300025917 Unclassified 1113
210 Ga0207660_10433811 3300025917 Unclassified 1061
211 Ga0207657_10019927 3300025919 Bacteria 6355
212 Ga0207652_10018241 3300025921 Bacteria 5754
213 Ga0207652_10148272 3300025921 Unclassified 2100
214 Ga0207646_10194766 3300025922 Bacteria 1830
215 Ga0207694_10155116 3300025924 Bacteria 1846
216 Ga0207700_10191772 3300025928 Unclassified 1718
217 Ga0207644_10005922 3300025931 Bacteria 7970
218 Ga0207644_10021204 3300025931 Bacteria 4423
219 Ga0207644_10078791 3300025931 Unclassified 2429
220 Ga0207644_10321483 3300025931 Bacteria 1251
221 Ga0207690_10063954 3300025932 Bacteria 2510
222 Ga0207686_10006347 3300025934 Bacteria 6362
223 Ga0207686_10086584 3300025934 Bacteria 2058
224 Ga0207704_10027490 3300025938 Unclassified 3140
225 Ga0207711_10032283 3300025941 Bacteria 4427
226 Ga0207711_10048891 3300025941 Bacteria 3619
227 Ga0207661_10003737 3300025944 Bacteria 10603
228 Ga0207661_10026349 3300025944 Bacteria 4428
229 Ga0207661_10066693 3300025944 Bacteria 2924
230 Ga0207661_10101337 3300025944 Unclassified 2419
231 Ga0207679_10020473 3300025945 Bacteria 4465
232 Ga0207679_10335228 3300025945 Bacteria 1314
233 Ga0207667_10007296 3300025949 Bacteria 13321
234 Ga0207667_10360264 3300025949 Bacteria 1483
235 Ga0207651_10054021 3300025960 Unclassified 2750
236 Ga0207658_10172915 3300025986 Bacteria 1781
237 Ga0207703_10295629 3300026035 Bacteria 1475
238 Ga0207639_10001785 3300026041 Bacteria 14494
239 Ga0207639_10024084 3300026041 Bacteria 4401
240 Ga0207639_10042031 3300026041 Bacteria 3425
241 Ga0207678_10084601 3300026067 Bacteria 2712
242 Ga0207702_10004913 3300026078 Bacteria 11756
243 Ga0207676_10044425 3300026095 Bacteria 3428
244 Ga0207676_10067570 3300026095 Bacteria 2856
245 Ga0207674_10001794 3300026116 Bacteria 27378
246 Ga0207674_10021487 3300026116 Bacteria 6950
247 Ga0207674_10034882 3300026116 Bacteria 5254
248 Ga0207683_10028606 3300026121 Bacteria 4820
249 Ga0207683_10054761 3300026121 Unclassified 3497
250 Ga0207683_10102049 3300026121 Bacteria 2562
251 Ga0268266_10000022 3300028379 Bacteria 508060
252 Ga0268265_10008890 3300028380 Bacteria 6790
253 Ga0268264_10000115 3300028381 Bacteria 202634
254 Ga0268264_10034104 3300028381 Unclassified 4185
255 Ga0268264_10258090 3300028381 Unclassified 1622
256 Ga0307517_10007263 3300028786 Bacteria 16208
257 Ga0307517_10008092 3300028786 Bacteria 15151
258 Ga0307513_10000011 3300031456 Bacteria 354929
259 Ga0307509_10310104 3300031507 Bacteria 1321
260 Ga0307408_100010648 3300031548 Bacteria 6066
261 Ga0307408_100087554 3300031548 Bacteria 2344
262 Ga0307408_100091424 3300031548 Unclassified 2298
263 Ga0307516_10000111 3300031730 Bacteria 94707
264 Ga0307516_10013516 3300031730 Bacteria 8686
265 Ga0307405_10059359 3300031731 Bacteria 2410
266 Ga0307413_10382718 3300031824 Bacteria 1097
267 Ga0307406_10072950 3300031901 Bacteria 2255
268 Ga0307406_10098605 3300031901 Unclassified 1984
269 Ga0307407_10066597 3300031903 Bacteria 2125
270 Ga0307412_10021574 3300031911 Bacteria 3937
271 Ga0307409_100070698 3300031995 Bacteria 2771
272 Ga0307409_100390327 3300031995 Unclassified 1326
273 Ga0307416_100026332 3300032002 Bacteria 4284
274 Ga0307416_100125361 3300032002 Bacteria 2299
275 Ga0307414_10403167 3300032004 Unclassified 1188
276 Ga0307411_10006512 3300032005 Bacteria 5851
277 Ga0307411_10043487 3300032005 Bacteria 2874
278 Ga0307415_100034520 3300032126 Unclassified 3294
279 Ga0307415_100053530 3300032126 Bacteria 2750
280 Ga0307510_10001091 3300033180 Bacteria 28923
281 Ga0373923_0027958 3300035111 Unclassified 2253
282 Ga0373955_0023597 3300035172 Bacteria 3136
283 Ga0316574_0194666 3300035398 Bacteria 1303
284 Ga0373927_0021485 3300035695 Bacteria 4231
285 Ga0373933_0054077 3300035724 Unclassified 2405
286 Ga0373937_0075975 3300036401 Unclassified 3102
287 Ga0373937_0113925 3300036401 Bacteria 2517
288 Ga0373937_0254484 3300036401 Unclassified 1655
289 Ga0373937_0265248 3300036401 Unclassified 1620
290 Ga0395899_0047992 3300037312 Bacteria 3178
291 Ga0395900_0081877 3300037418 Bacteria 3316
292 Ga0395905_0002075 3300037471 Bacteria 22818
293 Ga0436365_1407042 3300039437 Bacteria 4827
294 Ga0439436_0000541 3300041404 Bacteria 9930
295 Ga0439438_002969 3300041405 Bacteria 7024
296 Ga0439447_005313 3300041407 Bacteria 4293
297 Ga0439466_0002747 3300041411 Bacteria 6890
298 Ga0439466_0008185 3300041411 Bacteria 3941
299 Ga0439432_017779 3300042006 Bacteria 2383
300 Ga0439452_001586 3300042010 Bacteria 9005
301 Ga0450923_000846 3300042125 Bacteria 3719
302 Ga0439446_0000239 3300042156 Bacteria 10146
303 Ga0439434_0007500 3300042435 Bacteria 3195
304 Ga0466972_0004623 3300044658 Bacteria 6893
305 Ga0466967_0077090 3300045976 Bacteria 3000
306 Ga0466967_0292817 3300045976 Unclassified 1564
307 Ga0495580_0000306 3300046472 Bacteria 39953
308 Ga0495580_0000832 3300046472 Bacteria 26751
309 Ga0495580_0006977 3300046472 Bacteria 9110
310 Ga0495580_0091598 3300046472 Bacteria 2116
311 Ga0495582_0060333 3300046473 Unclassified 2093
312 Ga0495648_0004023 3300046524 Bacteria 12700
313 Ga0495663_0008285 3300046525 Bacteria 2878
314 Ga0495640_0018012 3300046533 Bacteria 5251
315 Ga0495586_0004855 3300046535 Bacteria 7191
316 Ga0495668_0008955 3300046616 Bacteria 6187
317 Ga0495611_0000224 3300046648 Bacteria 39649
318 Ga0495635_0163641 3300046663 Bacteria 1514
319 Ga0495635_0193118 3300046663 Unclassified 1382
320 Ga0495599_0188447 3300046678 Bacteria 1270
321 Ga0495623_0168512 3300046679 Unclassified 1281
322 Ga0495658_0116114 3300046683 Bacteria 1614
323 Ga0495669_0007065 3300046684 Bacteria 4701
324 Ga0495613_0125052 3300046689 Bacteria 1845
325 Ga0495624_0019363 3300046690 Bacteria 4546
326 Ga0495581_0027415 3300047315 Bacteria 3304
327 Ga0495674_0229157 3300047319 Bacteria 1534
328 Ga0495687_002453 3300047443 Bacteria 14872
329 Ga0495677_0011126 3300047445 Bacteria 3293
330 Ga0495684_0174727 3300047471 Bacteria 1595
331 Ga0496101_0183745 3300048904 Bacteria 1611
332 Ga0496104_0088066 3300048907 Unclassified 2965
333 Ga0496105_0016550 3300048908 Bacteria 5887
334 Ga0496105_0303618 3300048908 Bacteria 1283
335 Ga0496107_0019641 3300048910 Bacteria 4767
336 Ga0496107_0041539 3300048910 Unclassified 3302
337 Ga0496108_0093043 3300048911 Unclassified 2564
338 Ga0496111_0329123 3300048914 Bacteria 1131
339 Ga0496112_0001654 3300048915 Bacteria 17322
340 Ga0496114_0029386 3300048917 Bacteria 4517
341 Ga0496114_0060104 3300048917 Bacteria 3176
342 Ga0496114_0541831 3300048917 Bacteria 1028
343 Ga0496115_0044227 3300048918 Unclassified 3551
344 Ga0496115_0084932 3300048918 Bacteria 2581
345 Ga0496115_0270494 3300048918 Bacteria 1396
346 Ga0501032_0046980 3300049569 Bacteria 2916
347 Ga0501033_0438105 3300049570 Bacteria 909
348 Ga0501034_0228036 3300049571 Bacteria 1813
349 Ga0501034_0252414 3300049571 Bacteria 1708
350 Ga0501037_0067802 3300049573 Bacteria 2598
351 Ga0501043_0301065 3300049579 Unclassified 1225
352 Ga0501047_0040395 3300049581 Bacteria 4512
353 Ga0501048_0069419 3300049582 Bacteria 2489
354 Ga0501070_0066681 3300049586 Bacteria 2981
355 Ga0501070_0242755 3300049586 Bacteria 1474
356 Ga0501071_0010984 3300049587 Bacteria 6081
357 Ga0501075_0013160 3300049591 Bacteria 5898
358 Ga0501081_0084389 3300049743 Bacteria 2228
359 Ga0495601_0082881 3300053077 Bacteria 2059
360 Ga0495595_0005538 3300053084 Bacteria 5113
361 Ga0495619_0265648 3300053085 Bacteria 1189
362 Ga0500644_0005249 3300053088 Bacteria 3264
363 Ga0500583_0013491 3300053092 Unclassified 3163
364 Ga0500583_0031911 3300053092 Unclassified 2320
365 Ga0500593_000131 3300053117 Bacteria 29789
366 Ga0500658_0005616 3300053134 Plasmid 4669
367 Ga0500588_0028473 3300053146 Unclassified 1584
368 Ga0500604_0001825 3300053151 Bacteria 5927
369 Ga0500616_0075837 3300053153 Bacteria 1701
370 Ga0500622_0007176 3300053156 Bacteria 6353
371 Ga0500645_000397 3300053730 Bacteria 30509
372 Ga0500645_000644 3300053730 Bacteria 22175
373 Ga0500645_008173 3300053730 Bacteria 3593
374 Ga0500645_065172 3300053730 Unclassified 1050
375 Ga0501084_0191230 3300054114 Bacteria 1727
376 Ga0466962_0035938 3300061719 Bacteria 2371
377 Ga0530510_0053480 3300061734 Bacteria 2918
378 2511247227 2511231002 Bacteria 5042903
379 2812368789 2811994881 Bacteria 6298475
380 2923522856 2923519811 Bacteria 6298479
381 Ga0209437_103578
382 JGI24736J21556_1001290
383 JGI24740J21852_10000328
384 JGI25155J39150_1000098
385 JGI25156J39149_1000163
386 JGI25154J39366_1000183
387 JGI25157J39369_1000209
388 JGI25150J39212_1001877
389 JGI25159J45721_1001207
390 JGI25159J45721_1004564
391 JGI25151J46595_10002055
392 rootH1_10152290
393 rootH1_10034446
394 rootH1_10282976
395 JGI25160J50197_1000212
396 JGI25161J50226_1000151
397 Ga0055526_1000958
398 Ga0055526_1005848
399 Ga0055537_1000084
400 Ga0055537_1007230
401 Ga0055524_1000082
402 Ga0055534_1002638
403 Ga0055528_1001888
404 Ga0055530_10001442
405 Ga0055540_1000010
406 Ga0055531_10000461
407 Ga0055543_1000394
408 Ga0065165_1005448
409 Ga0065165_1010042
410 Ga0065165_1023417
411 Ga0065165_1042841
412 Ga0070658_10000059
413 Ga0070683_100008694
414 Ga0070690_100109738
415 Ga0070666_10016597
416 Ga0070680_100064016
417 Ga0070680_100354177
418 Ga0070682_100030079
419 Ga0068868_100384980
420 Ga0070660_100002661
421 Ga0070691_10000433
422 Ga0070671_100003166
423 Ga0070671_100013393
424 Ga0070659_100019554
425 Ga0070667_100013576
426 Ga0070713_100000603
427 Ga0070713_100152272
428 Ga0070713_100160124
429 Ga0070711_100040670
430 Ga0070708_100229404
431 Ga0070681_10057167
432 Ga0070681_10111687
433 Ga0070681_10261772
434 Ga0070681_10306941
435 Ga0070681_10610877
436 Ga0070679_100032218
437 Ga0070679_100082804
438 Ga0070679_100101386
439 Ga0070684_100000079
440 Ga0070684_100139105
441 Ga0068853_100031597
442 Ga0070672_100467127
443 Ga0070696_100210192
444 Ga0070665_100000002
445 Ga0068855_100011557
446 Ga0068855_100227601
447 Ga0070664_100032000
448 Ga0068857_100001971
449 Ga0068857_100025208
450 Ga0068856_100036841
451 Ga0068856_100052677
452 Ga0068856_100059111
453 Ga0068856_100074285
454 Ga0068852_100089523
455 Ga0068852_100148855
456 Ga0068852_100261053
457 Ga0068864_100026930
458 Ga0068864_100056346
459 Ga0068851_10009522
460 Ga0068863_100055538
461 Ga0068863_100280724
462 Ga0068858_100116675
463 Ga0068858_100211894
464 Ga0068860_100000019
465 Ga0068860_100209985
466 Ga0068862_100041126
467 Ga0075362_10023486
468 Ga0075370_10146151
469 Ga0068871_100158296
470 Ga0075428_100064568
471 Ga0075431_100028837
472 Ga0105240_10000607
473 Ga0105240_10046895
474 Ga0105240_10165405
475 Ga0105240_10290640
476 Ga0105247_10015185
477 Ga0105241_10011338
478 Ga0105241_10170958
479 Ga0105241_10172883
480 Ga0105242_10028876
481 Ga0105248_10001858
482 Ga0105248_10007623
483 Ga0105248_10055784
484 Ga0105248_10125720
485 Ga0105248_10126478
486 Ga0105237_10002039
487 Ga0105237_10019463
488 Ga0105237_10070699
489 Ga0105237_10192432
490 Ga0105237_10328889
491 Ga0105238_10023933
492 Ga0105238_10063887
493 Ga0105238_10132638
494 Ga0105238_10275769
495 Ga0105238_10431647
496 Ga0105239_10000195
497 Ga0105239_10008295
498 Ga0105239_10120633
499 Ga0105239_10362408
500 Ga0105239_10543359
501 Ga0105239_10776179
502 Ga0157326_1002087
503 Ga0157373_10056327
504 Ga0157373_10078214
505 Ga0157370_10001646
506 Ga0157370_10018539
507 Ga0157370_10068197
508 Ga0157370_10108255
509 Ga0157369_10006631
510 Ga0157369_10235321
511 Ga0157374_10128423
512 Ga0157374_10521587
513 Ga0157378_10172624
514 Ga0163162_10000625
515 Ga0163162_10013855
516 Ga0163162_10058120
517 Ga0163162_10072773
518 Ga0157372_10005642
519 Ga0157372_10038992
520 Ga0157372_10050687
521 Ga0157372_10094125
522 Ga0157372_10132357
523 Ga0157372_10173772
524 Ga0157372_10481864
525 Ga0157375_10007976
526 Ga0157375_10324551
527 Ga0157379_10032440
528 Ga0157379_10334459
529 Ga0157376_10017327
530 Ga0157376_10138410
531 Ga0157376_10176201
532 Ga0157376_10390250
533 Ga0163161_10016559
534 Ga0154015_1199638
535 Ga0213876_10047465
536 Ga0209435_100010
537 Ga0207425_1008307
538 Ga0209646_1000001
539 Ga0209026_1000001
540 Ga0209759_1000001
541 Ga0209233_1000799
542 Ga0209565_1000036
543 Ga0209565_1000686
544 Ga0209130_1000042
545 Ga0209130_1000151
546 Ga0209675_1000751
547 Ga0209675_1001480
548 Ga0209675_1022494
549 Ga0209676_1000007
550 Ga0209676_1002711
551 Ga0209025_1001245
552 Ga0209025_1001980
553 Ga0209025_1002721
554 Ga0209025_1028725
555 Ga0209564_1000729
556 Ga0209564_1000903
557 Ga0209564_1002398
558 Ga0209758_1009443
559 Ga0209050_1000003
560 Ga0209050_1001985
561 Ga0209256_1000001
562 Ga0207426_1000097
563 Ga0209051_1000003
564 Ga0209257_1000020
565 Ga0207642_10022822
566 Ga0207647_10003540
567 Ga0207705_10000216
568 Ga0207705_10002735
569 Ga0207654_10012517
570 Ga0207654_10032061
571 Ga0207707_10001178
572 Ga0207707_10106019
573 Ga0207707_10125271
574 Ga0207707_10169719
575 Ga0207695_10001170
576 Ga0207695_10116195
577 Ga0207695_10314229
578 Ga0207671_10001902
579 Ga0207671_10010501
580 Ga0207671_10042211
581 Ga0207671_10148490
582 Ga0207671_10207310
583 Ga0207671_10269742
584 Ga0207693_10009625
585 Ga0207693_10013867
586 Ga0207663_10086780
587 Ga0207660_10002385
588 Ga0207660_10031380
589 Ga0207660_10395268
590 Ga0207660_10433811
591 Ga0207657_10019927
592 Ga0207652_10018241
593 Ga0207652_10148272
594 Ga0207646_10194766
595 Ga0207694_10155116
596 Ga0207700_10191772
597 Ga0207644_10005922
598 Ga0207644_10021204
599 Ga0207644_10078791
600 Ga0207644_10321483
601 Ga0207690_10063954
602 Ga0207686_10006347
603 Ga0207686_10086584
604 Ga0207704_10027490
605 Ga0207711_10032283
606 Ga0207711_10048891
607 Ga0207661_10003737
608 Ga0207661_10026349
609 Ga0207661_10066693
610 Ga0207661_10101337
611 Ga0207679_10020473
612 Ga0207679_10335228
613 Ga0207667_10007296
614 Ga0207667_10360264
615 Ga0207651_10054021
616 Ga0207658_10172915
617 Ga0207703_10295629
618 Ga0207639_10001785
619 Ga0207639_10024084
620 Ga0207639_10042031
621 Ga0207678_10084601
622 Ga0207702_10004913
623 Ga0207676_10044425
624 Ga0207676_10067570
625 Ga0207674_10001794
626 Ga0207674_10021487
627 Ga0207674_10034882
628 Ga0207683_10028606
629 Ga0207683_10054761
630 Ga0207683_10102049
631 Ga0268266_10000022
632 Ga0268265_10008890
633 Ga0268264_10000115
634 Ga0268264_10034104
635 Ga0268264_10258090
636 Ga0307517_10007263
637 Ga0307517_10008092
638 Ga0307513_10000011
639 Ga0307509_10310104
640 Ga0307408_100010648
641 Ga0307408_100087554
642 Ga0307408_100091424
643 Ga0307516_10000111
644 Ga0307516_10013516
645 Ga0307405_10059359
646 Ga0307413_10382718
647 Ga0307406_10072950
648 Ga0307406_10098605
649 Ga0307407_10066597
650 Ga0307412_10021574
651 Ga0307409_100070698
652 Ga0307409_100390327
653 Ga0307416_100026332
654 Ga0307416_100125361
655 Ga0307414_10403167
656 Ga0307411_10006512
657 Ga0307411_10043487
658 Ga0307415_100034520
659 Ga0307415_100053530
660 Ga0307510_10001091
661 Ga0373923_0027958
662 Ga0373955_0023597
663 Ga0316574_0194666
664 Ga0373927_0021485
665 Ga0373933_0054077
666 Ga0373937_0075975
667 Ga0373937_0113925
668 Ga0373937_0254484
669 Ga0373937_0265248
670 Ga0395899_0047992
671 Ga0395900_0081877
672 Ga0395905_0002075
673 Ga0436365_1407042
674 Ga0439436_0000541
675 Ga0439438_002969
676 Ga0439447_005313
677 Ga0439466_0002747
678 Ga0439466_0008185
679 Ga0439432_017779
680 Ga0439452_001586
681 Ga0450923_000846
682 Ga0439446_0000239
683 Ga0439434_0007500
684 Ga0466972_0004623
685 Ga0466967_0077090
686 Ga0466967_0292817
687 Ga0495580_0000306
688 Ga0495580_0000832
689 Ga0495580_0006977
690 Ga0495580_0091598
691 Ga0495582_0060333
692 Ga0495648_0004023
693 Ga0495663_0008285
694 Ga0495640_0018012
695 Ga0495586_0004855
696 Ga0495668_0008955
697 Ga0495611_0000224
698 Ga0495635_0163641
699 Ga0495635_0193118
700 Ga0495599_0188447
701 Ga0495623_0168512
702 Ga0495658_0116114
703 Ga0495669_0007065
704 Ga0495613_0125052
705 Ga0495624_0019363
706 Ga0495581_0027415
707 Ga0495674_0229157
708 Ga0495687_002453
709 Ga0495677_0011126
710 Ga0495684_0174727
711 Ga0496101_0183745
712 Ga0496104_0088066
713 Ga0496105_0016550
714 Ga0496105_0303618
715 Ga0496107_0019641
716 Ga0496107_0041539
717 Ga0496108_0093043
718 Ga0496111_0329123
719 Ga0496112_0001654
720 Ga0496114_0029386
721 Ga0496114_0060104
722 Ga0496114_0541831
723 Ga0496115_0044227
724 Ga0496115_0084932
725 Ga0496115_0270494
726 Ga0501032_0046980
727 Ga0501033_0438105
728 Ga0501034_0228036
729 Ga0501034_0252414
730 Ga0501037_0067802
731 Ga0501043_0301065
732 Ga0501047_0040395
733 Ga0501048_0069419
734 Ga0501070_0066681
735 Ga0501070_0242755
736 Ga0501071_0010984
737 Ga0501075_0013160
738 Ga0501081_0084389
739 Ga0495601_0082881
740 Ga0495595_0005538
741 Ga0495619_0265648
742 Ga0500644_0005249
743 Ga0500583_0013491
744 Ga0500583_0031911
745 Ga0500593_000131
746 Ga0500658_0005616
747 Ga0500588_0028473
748 Ga0500604_0001825
749 Ga0500616_0075837
750 Ga0500622_0007176
751 Ga0500645_000397
752 Ga0500645_000644
753 Ga0500645_008173
754 Ga0500645_065172
755 Ga0501084_0191230
756 Ga0466962_0035938
757 Ga0530510_0053480
758 2511247227
759 2812368789
760 2923522856

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

51

327

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u0k-assembly1.cif.gz_B the structure of a predicted epimerase pa4716 from pseudomonas aeruginosa 0.9654 15 303
1u0k-assembly1.cif.gz_B the structure of a predicted epimerase pa4716 from pseudomonas aeruginosa 0.9587 15 303
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.8785 16 300
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8765 16 300
1u1x-assembly1.cif.gz_B structure and function of phenazine-biosynthesis protein phzf from pseudomonas fluorescens 2-79 0.8756 16 300
ID Description Score Start End Superfamily
1u0kB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9561 135 288 3.10.310.10
1u0kB01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9521 15 130 3.10.310.10
1u0kB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9375 135 288 3.10.310.10
1u1vA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9016 16 126 3.10.310.10
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8937 17 119 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A2Z6AYQ1-F1-model_v4 Uncharacterized isomerase yddE 0.9833 14 300 GO:0005737
GO:0009058
GO:0016853
AF-A0A7W1GIH8-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9807 17 82 GO:0003824
GO:0009058
AF-A0A6N4T0V0-F1-model_v4 Phenazine biosynthesis protein PhzF 0.9728 14 300 GO:0005737
GO:0009058
GO:0016853
AF-A0A231ZHJ7-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9724 14 303 GO:0005737
GO:0009058
GO:0016853
AF-A0A5B8UQG9-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9714 14 302 GO:0005737
GO:0009058
GO:0016853

Map