F428698

General Info

Members Datasets Scaffolds Average Seq Length
380 220 760 343

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10002541|Ga0268266_1000254119
Length 400
Sequence MAITITSCNPGAMPAILSRVAGVHKGVQAGSNPSFFPSNLPGSIYLTLTMPTASIPSPKPPSKARRRWKAATLKVRELASIGWALASTGHPYMAQIVPMRRCNLACTYCNEYDDFSDPVPLDEMLRRIDHLGRLGTSVITISGGEPLLNPHLDEIIARIRKNGAIAGMITNGYLLMPDRIHRLNKAGLDHMQISIDNVMPDAVSKKSLKVLDKKLQMLADHAEFHVNINSVVGGGIANPDDARVVSERALGLGFSSTIGIIHDGSGQLKPLGDAERKVWDKVRSMTRRSYSRFNHFQEAIANGKTNDWRCRAGGRYLYVCENGLVHYCSQQRGFPGVPLSNYTTADVKREFLTEKGCAPSCTISCVHQVSYIDHWRAPQKDSVTPNSSHGAGEQELVQIQ

Samples

Sample ID Description Type Environment
1 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
220 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.84
Nodule 0
Rhizoplane 4.74
Rhizosphere 89.74
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268266_10002541 3300028379 Bacteria 19375
2 rootH1_10049638 3300003316 Bacteria 3791
3 rootH2_10162621 3300003320 Bacteria 1528
4 Ga0070658_10000101 3300005327 Bacteria 75550
5 Ga0070658_10026098 3300005327 Bacteria 4686
6 Ga0070658_10063392 3300005327 Bacteria 3013
7 Ga0070683_100045717 3300005329 Bacteria 4041
8 Ga0070680_100029891 3300005336 Bacteria 4375
9 Ga0068868_100013663 3300005338 Bacteria 5962
10 Ga0070661_100050778 3300005344 Bacteria 3035
11 Ga0070668_100400164 3300005347 Bacteria 1172
12 Ga0070671_100216904 3300005355 Bacteria 1623
13 Ga0070673_100246045 3300005364 Bacteria 1557
14 Ga0070659_100018303 3300005366 Bacteria 5286
15 Ga0070659_100066297 3300005366 Bacteria 2861
16 Ga0070659_100209575 3300005366 Bacteria 1606
17 Ga0070714_100000338 3300005435 Bacteria 35168
18 Ga0070714_100272213 3300005435 Bacteria 1571
19 Ga0070713_100016676 3300005436 Bacteria 5527
20 Ga0070713_100043699 3300005436 Bacteria 3665
21 Ga0070713_100060805 3300005436 Bacteria 3159
22 Ga0070711_100192003 3300005439 Unclassified 1570
23 Ga0070663_100022896 3300005455 Bacteria 4181
24 Ga0070662_100343407 3300005457 Bacteria 1222
25 Ga0070681_10056765 3300005458 Bacteria 3896
26 Ga0070706_100171319 3300005467 Bacteria 2027
27 Ga0070679_100001106 3300005530 Bacteria 23586
28 Ga0068853_100000087 3300005539 Bacteria 64293
29 Ga0068853_100010354 3300005539 Bacteria 7544
30 Ga0068853_100120350 3300005539 Bacteria 2341
31 Ga0068853_100233665 3300005539 Bacteria 1683
32 Ga0070665_100042719 3300005548 Bacteria 4557
33 Ga0070665_100063399 3300005548 Bacteria 3706
34 Ga0070665_100067214 3300005548 Bacteria 3594
35 Ga0070665_100094330 3300005548 Bacteria 2997
36 Ga0068855_100028854 3300005563 Bacteria 6638
37 Ga0068855_100056118 3300005563 Bacteria 4623
38 Ga0068855_100198390 3300005563 Bacteria 2260
39 Ga0068857_100003186 3300005577 Bacteria 13605
40 Ga0068854_100000037 3300005578 Bacteria 100242
41 Ga0068854_100012049 3300005578 Bacteria 5653
42 Ga0068856_100196015 3300005614 Bacteria 2034
43 Ga0068852_100024010 3300005616 Bacteria 4920
44 Ga0068851_10053821 3300005834 Bacteria 2050
45 Ga0068851_10096141 3300005834 Bacteria 1566
46 Ga0068863_100025950 3300005841 Bacteria 5590
47 Ga0081540_1007286 3300005983 Bacteria 7919
48 Ga0070717_10033376 3300006028 Bacteria 4153
49 Ga0070717_10085981 3300006028 Unclassified 2647
50 Ga0070715_10024527 3300006163 Unclassified 2378
51 Ga0070712_100012127 3300006175 Bacteria 5477
52 Ga0070712_100096935 3300006175 Unclassified 2172
53 Ga0075430_100019532 3300006846 Bacteria 5764
54 Ga0075431_100081732 3300006847 Bacteria 3336
55 Ga0075433_10081749 3300006852 Bacteria 2849
56 Ga0075436_100032651 3300006914 Bacteria 3588
57 Ga0105240_10000001 3300009093 Bacteria 2887840
58 Ga0105240_10000284 3300009093 Bacteria 99440
59 Ga0105240_10012026 3300009093 Bacteria 11997
60 Ga0105240_10012499 3300009093 Bacteria 11715
61 Ga0105240_10022438 3300009093 Bacteria 8366
62 Ga0105240_10111156 3300009093 Bacteria 3315
63 Ga0105240_10157977 3300009093 Bacteria 2695
64 Ga0105240_10229904 3300009093 Bacteria 2156
65 Ga0111539_10062125 3300009094 Bacteria 4423
66 Ga0105245_10007271 3300009098 Bacteria 9696
67 Ga0105245_10023721 3300009098 Bacteria 5385
68 Ga0114129_10458113 3300009147 Bacteria 1671
69 Ga0105248_10000666 3300009177 Bacteria 39007
70 Ga0105248_10023865 3300009177 Bacteria 6797
71 Ga0105248_10061490 3300009177 Bacteria 4217
72 Ga0105248_10203428 3300009177 Bacteria 2231
73 Ga0105237_10005705 3300009545 Bacteria 13994
74 Ga0105237_10197615 3300009545 Bacteria 2010
75 Ga0105238_10028771 3300009551 Bacteria 5660
76 Ga0105238_10062700 3300009551 Bacteria 3718
77 Ga0105238_10383272 3300009551 Bacteria 1397
78 Ga0105239_10000334 3300010375 Bacteria 68928
79 Ga0105239_10074740 3300010375 Unclassified 3726
80 Ga0157370_10022847 3300013104 Bacteria 6218
81 Ga0157370_10024705 3300013104 Bacteria 5950
82 Ga0157370_10030637 3300013104 Bacteria 5269
83 Ga0157370_10081865 3300013104 Bacteria 3037
84 Ga0157370_10092680 3300013104 Bacteria 2835
85 Ga0157370_10316553 3300013104 Bacteria 1440
86 Ga0157369_10000493 3300013105 Bacteria 52265
87 Ga0157369_10014314 3300013105 Bacteria 8959
88 Ga0157369_10036136 3300013105 Bacteria 5414
89 Ga0157369_10074160 3300013105 Bacteria 3650
90 Ga0157369_10169297 3300013105 Bacteria 2302
91 Ga0157374_10009573 3300013296 Bacteria 8322
92 Ga0157374_10219923 3300013296 Bacteria 1863
93 Ga0157378_10026245 3300013297 Bacteria 5135
94 Ga0163162_10026438 3300013306 Bacteria 5734
95 Ga0163162_10138976 3300013306 Bacteria 2541
96 Ga0157372_10007624 3300013307 Bacteria 11508
97 Ga0157372_10013516 3300013307 Bacteria 8724
98 Ga0157372_10111373 3300013307 Bacteria 3136
99 Ga0157372_10226892 3300013307 Bacteria 2165
100 Ga0157372_10349679 3300013307 Bacteria 1722
101 Ga0163163_10318946 3300014325 Bacteria 1608
102 Ga0157376_10010898 3300014969 Bacteria 6677
103 Ga0157376_10017216 3300014969 Bacteria 5507
104 Ga0157376_10049914 3300014969 Bacteria 3468
105 Ga0213872_10096404 3300021361 Bacteria 1320
106 Ga0213875_10005551 3300021388 Bacteria 6753
107 Ga0224572_1002416 3300024225 Bacteria 3009
108 Ga0209233_1002583 3300025261 Bacteria 6584
109 Ga0209233_1007762 3300025261 Bacteria 3371
110 Ga0207680_10009735 3300025903 Bacteria 4781
111 Ga0207647_10002648 3300025904 Bacteria 13523
112 Ga0207647_10013174 3300025904 Bacteria 5743
113 Ga0207699_10045527 3300025906 Unclassified 2561
114 Ga0207705_10000109 3300025909 Bacteria 93256
115 Ga0207705_10009375 3300025909 Bacteria 7117
116 Ga0207705_10019360 3300025909 Bacteria 4866
117 Ga0207705_10024264 3300025909 Bacteria 4329
118 Ga0207707_10142041 3300025912 Bacteria 2099
119 Ga0207707_10232448 3300025912 Bacteria 1604
120 Ga0207707_10286783 3300025912 Bacteria 1425
121 Ga0207695_10000001 3300025913 Bacteria 2888630
122 Ga0207695_10014790 3300025913 Bacteria 9219
123 Ga0207695_10020263 3300025913 Bacteria 7623
124 Ga0207695_10051710 3300025913 Bacteria 4311
125 Ga0207695_10072415 3300025913 Bacteria 3516
126 Ga0207695_10079222 3300025913 Bacteria 3331
127 Ga0207693_10240440 3300025915 Unclassified 1421
128 Ga0207657_10004594 3300025919 Bacteria 14591
129 Ga0207657_10077410 3300025919 Bacteria 2803
130 Ga0207657_10134899 3300025919 Bacteria 2021
131 Ga0207652_10001024 3300025921 Bacteria 25651
132 Ga0207652_10094372 3300025921 Bacteria 2634
133 Ga0207652_10305242 3300025921 Bacteria 1436
134 Ga0207646_10000044 3300025922 Bacteria 183369
135 Ga0207694_10000105 3300025924 Bacteria 89920
136 Ga0207694_10006015 3300025924 Bacteria 9283
137 Ga0207694_10044474 3300025924 Bacteria 3429
138 Ga0207650_10169832 3300025925 Bacteria 1733
139 Ga0207687_10034262 3300025927 Bacteria 3447
140 Ga0207687_10063381 3300025927 Bacteria 2617
141 Ga0207700_10010139 3300025928 Bacteria 5925
142 Ga0207700_10057132 3300025928 Bacteria 2941
143 Ga0207664_10131293 3300025929 Bacteria 2109
144 Ga0207644_10084107 3300025931 Bacteria 2358
145 Ga0207690_10001283 3300025932 Bacteria 15872
146 Ga0207690_10100334 3300025932 Bacteria 2066
147 Ga0207665_10002689 3300025939 Bacteria 11926
148 Ga0207665_10083780 3300025939 Bacteria 2200
149 Ga0207711_10000014 3300025941 Bacteria 506753
150 Ga0207711_10000606 3300025941 Bacteria 36174
151 Ga0207711_10017586 3300025941 Bacteria 5939
152 Ga0207661_10024098 3300025944 Unclassified 4606
153 Ga0207679_10173366 3300025945 Bacteria 1778
154 Ga0207667_10005429 3300025949 Bacteria 15542
155 Ga0207667_10043023 3300025949 Bacteria 4795
156 Ga0207667_10056370 3300025949 Bacteria 4128
157 Ga0207667_10219203 3300025949 Bacteria 1950
158 Ga0207640_10000002 3300025981 Bacteria 524211
159 Ga0207640_10003704 3300025981 Bacteria 8241
160 Ga0207640_10135897 3300025981 Bacteria 1785
161 Ga0207639_10000071 3300026041 Bacteria 94980
162 Ga0207639_10022782 3300026041 Unclassified 4515
163 Ga0207639_10064133 3300026041 Bacteria 2847
164 Ga0207639_10178497 3300026041 Bacteria 1804
165 Ga0207678_10011984 3300026067 Bacteria 7613
166 Ga0207678_10189674 3300026067 Bacteria 1756
167 Ga0207678_10222031 3300026067 Bacteria 1618
168 Ga0207702_10066294 3300026078 Bacteria 3094
169 Ga0207641_10006824 3300026088 Bacteria 9562
170 Ga0207674_10002385 3300026116 Bacteria 23750
171 Ga0207698_10045026 3300026142 Bacteria 3321
172 Ga0268266_10024683 3300028379 Bacteria 5114
173 Ga0265323_10032855 3300028653 Bacteria 1924
174 Ga0265336_10001922 3300028666 Bacteria 8976
175 Ga0265338_10118311 3300028800 Bacteria 2118
176 Ga0265338_10121980 3300028800 Bacteria 2075
177 Ga0265330_10114389 3300031235 Unclassified 1151
178 Ga0265340_10015697 3300031247 Unclassified 3932
179 Ga0265339_10004422 3300031249 Bacteria 9594
180 Ga0265316_10023873 3300031344 Bacteria 5135
181 Ga0265316_10025821 3300031344 Bacteria 4895
182 Ga0265316_10182656 3300031344 Bacteria 1561
183 Ga0265316_10199062 3300031344 Bacteria 1486
184 Ga0265316_10207386 3300031344 Bacteria 1451
185 Ga0265314_10090549 3300031711 Bacteria 1992
186 Ga0265342_10014307 3300031712 Bacteria 5272
187 Ga0265342_10064194 3300031712 Bacteria 2156
188 Ga0265342_10149178 3300031712 Bacteria 1299
189 Ga0307510_10027300 3300033180 Bacteria 6543
190 Ga0373955_0007765 3300035172 Unclassified 4944
191 Ga0373955_0069357 3300035172 Bacteria 1967
192 Ga0373924_0000480 3300035410 Bacteria 12207
193 Ga0373924_0017803 3300035410 Bacteria 2731
194 Ga0373924_0112556 3300035410 Bacteria 1177
195 Ga0373935_0002908 3300035692 Bacteria 9862
196 Ga0373927_0090353 3300035695 Bacteria 1989
197 Ga0373933_0191727 3300035724 Bacteria 1306
198 Ga0373947_0002500 3300035725 Bacteria 11052
199 Ga0373937_0005568 3300036401 Bacteria 10806
200 Ga0373937_0045966 3300036401 Bacteria 3991
201 Ga0373925_0010869 3300037068 Bacteria 6601
202 Ga0373925_0028029 3300037068 Bacteria 4125
203 Ga0395900_0155592 3300037418 Bacteria 2335
204 Ga0395898_0100335 3300037466 Bacteria 2780
205 Ga0395905_0021089 3300037471 Bacteria 6170
206 Ga0436364_0220151 3300037853 Unclassified 1986
207 Ga0436364_0350882 3300037853 Bacteria 5317
208 Ga0436365_0702050 3300039437 Bacteria 4020
209 Ga0436360_1093448 3300039438 Bacteria 6148
210 Ga0436361_0927715 3300039447 Bacteria 13008
211 Ga0436363_0305441 3300039450 Bacteria 3047
212 Ga0436363_0317733 3300039450 Bacteria 4505
213 Ga0436363_1719984 3300039450 Bacteria 2626
214 Ga0436362_1024607 3300039453 Bacteria 5517
215 Ga0466966_0102499 3300044684 Bacteria 1769
216 Ga0466957_0000190 3300044842 Bacteria 28163
217 Ga0466959_0044258 3300045049 Bacteria 3281
218 Ga0466959_0045149 3300045049 Bacteria 3246
219 Ga0451576_0213212 3300045051 Unclassified 2017
220 Ga0466958_0043520 3300045836 Bacteria 2705
221 Ga0466967_0236164 3300045976 Bacteria 1742
222 Ga0495592_0013833 3300046454 Bacteria 6135
223 Ga0495603_0001136 3300046455 Bacteria 15542
224 Ga0495629_0005458 3300046459 Bacteria 9485
225 Ga0495629_0007756 3300046459 Bacteria 7898
226 Ga0495651_0011980 3300046462 Bacteria 6674
227 Ga0495651_0040058 3300046462 Unclassified 3645
228 Ga0495651_0074686 3300046462 Bacteria 2572
229 Ga0495651_0082832 3300046462 Bacteria 2420
230 Ga0495653_0000990 3300046463 Bacteria 21873
231 Ga0495650_0000037 3300046471 Bacteria 390090
232 Ga0495650_0003543 3300046471 Bacteria 11304
233 Ga0495580_0006575 3300046472 Bacteria 9450
234 Ga0495580_0011991 3300046472 Bacteria 6678
235 Ga0495580_0012833 3300046472 Bacteria 6420
236 Ga0495582_0001593 3300046473 Bacteria 12794
237 Ga0495582_0021365 3300046473 Bacteria 3543
238 Ga0495639_0001600 3300046475 Bacteria 10075
239 Ga0495639_0062174 3300046475 Bacteria 1713
240 Ga0495639_0068792 3300046475 Bacteria 1633
241 Ga0495662_0001212 3300046476 Bacteria 12703
242 Ga0495664_0038969 3300046477 Bacteria 2807
243 Ga0495664_0060156 3300046477 Bacteria 2261
244 Ga0495585_0014002 3300046492 Bacteria 4684
245 Ga0495585_0088320 3300046492 Bacteria 1672
246 Ga0495594_0000357 3300046499 Bacteria 22945
247 Ga0495594_0001145 3300046499 Bacteria 13845
248 Ga0495583_0045346 3300046506 Bacteria 2034
249 Ga0495606_0100233 3300046507 Bacteria 1765
250 Ga0495606_0183406 3300046507 Bacteria 1205
251 Ga0495628_0021455 3300046516 Bacteria 5312
252 Ga0495628_0043748 3300046516 Bacteria 3565
253 Ga0495630_0195270 3300046517 Bacteria 1544
254 Ga0495630_0295553 3300046517 Bacteria 1238
255 Ga0495643_0062087 3300046522 Bacteria 1979
256 Ga0495644_0000004 3300046523 Bacteria 158166
257 Ga0495666_0001214 3300046526 Bacteria 12453
258 Ga0495642_0031077 3300046528 Bacteria 2140
259 Ga0495652_0002436 3300046529 Bacteria 19168
260 Ga0495665_0004967 3300046531 Bacteria 7166
261 Ga0495665_0193255 3300046531 Bacteria 1056
262 Ga0495640_0009155 3300046533 Bacteria 7728
263 Ga0495586_0000610 3300046535 Bacteria 20684
264 Ga0495587_0036728 3300046536 Bacteria 2946
265 Ga0495609_0007019 3300046538 Bacteria 5677
266 Ga0495645_0003197 3300046543 Bacteria 11104
267 Ga0495645_0011176 3300046543 Bacteria 6314
268 Ga0495645_0022866 3300046543 Bacteria 4525
269 Ga0495622_0026289 3300046557 Bacteria 2719
270 Ga0495633_0016249 3300046558 Bacteria 3844
271 Ga0495667_0003403 3300046559 Bacteria 10659
272 Ga0495668_0030486 3300046616 Bacteria 3045
273 Ga0495634_0003182 3300046642 Bacteria 13283
274 Ga0495611_0060758 3300046648 Bacteria 1717
275 Ga0495625_0000166 3300046660 Bacteria 102927
276 Ga0495625_0003450 3300046660 Bacteria 15757
277 Ga0495625_0012010 3300046660 Bacteria 7030
278 Ga0495625_0041280 3300046660 Bacteria 3359
279 Ga0495635_0005990 3300046663 Bacteria 8485
280 Ga0495635_0064550 3300046663 Bacteria 2513
281 Ga0495661_0200063 3300046665 Bacteria 1047
282 Ga0495657_0046027 3300046675 Bacteria 2957
283 Ga0495599_0039228 3300046678 Bacteria 2975
284 Ga0495623_0033016 3300046679 Bacteria 3323
285 Ga0495623_0216596 3300046679 Bacteria 1093
286 Ga0495646_0034039 3300046680 Bacteria 3165
287 Ga0495658_0088096 3300046683 Bacteria 1834
288 Ga0495669_0001203 3300046684 Bacteria 10764
289 Ga0495669_0077092 3300046684 Bacteria 1526
290 Ga0495613_0013042 3300046689 Bacteria 6177
291 Ga0495613_0058457 3300046689 Bacteria 2829
292 Ga0495624_0005056 3300046690 Bacteria 9541
293 Ga0495670_0014600 3300046691 Bacteria 3862
294 Ga0495670_0149111 3300046691 Bacteria 1226
295 Ga0495671_0124204 3300046692 Bacteria 1259
296 Ga0495649_0020989 3300046694 Bacteria 3661
297 Ga0495649_0062838 3300046694 Bacteria 1996
298 Ga0495600_0006144 3300046809 Bacteria 7278
299 Ga0495581_0000872 3300047315 Bacteria 16106
300 Ga0495581_0125375 3300047315 Bacteria 1495
301 Ga0495604_0006716 3300047317 Bacteria 9120
302 Ga0495604_0046086 3300047317 Bacteria 3400
303 Ga0495604_0114489 3300047317 Bacteria 1961
304 Ga0495674_0050585 3300047319 Bacteria 3666
305 Ga0495674_0078675 3300047319 Bacteria 2833
306 Ga0495672_0004803 3300047320 Bacteria 10899
307 Ga0495676_0004397 3300047321 Bacteria 12878
308 Ga0495680_0005428 3300047322 Bacteria 12004
309 Ga0495675_0001672 3300047444 Bacteria 13294
310 Ga0495684_0059910 3300047471 Bacteria 2898
311 Ga0495684_0099679 3300047471 Bacteria 2196
312 Ga0495684_0225375 3300047471 Bacteria 1373
313 Ga0495686_0000009 3300047472 Bacteria 661643
314 Ga0495686_0002116 3300047472 Bacteria 19445
315 Ga0495686_0032716 3300047472 Bacteria 3364
316 Ga0495686_0042323 3300047472 Bacteria 2897
317 Ga0495593_0024129 3300047673 Bacteria 3374
318 Ga0495614_0005797 3300048089 Bacteria 5563
319 Ga0495614_0015701 3300048089 Bacteria 3299
320 Ga0495614_0048383 3300048089 Unclassified 1823
321 Ga0496102_0059469 3300048905 Bacteria 3495
322 Ga0496103_0046981 3300048906 Bacteria 2666
323 Ga0496104_0000031 3300048907 Bacteria 194537
324 Ga0496104_0155423 3300048907 Bacteria 2195
325 Ga0496105_0011971 3300048908 Bacteria 6869
326 Ga0496105_0033714 3300048908 Bacteria 4207
327 Ga0496105_0136835 3300048908 Bacteria 2018
328 Ga0496108_0096180 3300048911 Bacteria 2522
329 Ga0496108_0427374 3300048911 Bacteria 1157
330 Ga0496109_0049253 3300048912 Bacteria 3835
331 Ga0496110_0051871 3300048913 Unclassified 3605
332 Ga0496111_0005350 3300048914 Bacteria 8206
333 Ga0496112_0006152 3300048915 Bacteria 10493
334 Ga0496112_0041195 3300048915 Bacteria 4517
335 Ga0496112_0077168 3300048915 Bacteria 3295
336 Ga0496113_0001005 3300048916 Bacteria 15120
337 Ga0496113_0029410 3300048916 Bacteria 3967
338 Ga0496115_0063980 3300048918 Bacteria 2969
339 Ga0496126_0000024 3300048929 Bacteria 462877
340 Ga0496126_0000111 3300048929 Bacteria 195620
341 Ga0496126_0000855 3300048929 Bacteria 53653
342 Ga0496126_0001781 3300048929 Bacteria 31809
343 Ga0495682_0035298 3300049460 Bacteria 1842
344 Ga0495682_0039735 3300049460 Bacteria 1727
345 Ga0501296_001888 3300049519 Bacteria 2139
346 Ga0501032_0002119 3300049569 Bacteria 15644
347 Ga0501033_0018089 3300049570 Bacteria 5324
348 Ga0501034_0030535 3300049571 Bacteria 5478
349 Ga0501036_0001980 3300049572 Bacteria 15885
350 Ga0501037_0043247 3300049573 Bacteria 3311
351 Ga0501037_0189575 3300049573 Bacteria 1456
352 Ga0501038_0017174 3300049574 Bacteria 6542
353 Ga0501038_0065445 3300049574 Bacteria 3097
354 Ga0501039_0044004 3300049575 Bacteria 3449
355 Ga0501041_0121186 3300049577 Bacteria 1626
356 Ga0501043_0000430 3300049579 Bacteria 37723
357 Ga0501046_0000371 3300049580 Bacteria 45434
358 Ga0501047_0013169 3300049581 Bacteria 7833
359 Ga0501070_0102455 3300049586 Bacteria 2368
360 Ga0501073_0008963 3300049589 Bacteria 7390
361 Ga0501079_0120750 3300049741 Bacteria 2038
362 Ga0501080_0096673 3300049742 Bacteria 2742
363 Ga0501080_0207214 3300049742 Bacteria 1798
364 Ga0501035_0002370 3300049822 Bacteria 18512
365 Ga0501035_0158172 3300049822 Bacteria 1963
366 Ga0501044_0012096 3300049823 Bacteria 9347
367 Ga0501044_0139960 3300049823 Bacteria 2409
368 nmdc:mga08y16_67519_c1 3300050511 Unclassified 3729
369 nmdc:mga08x19_230034_c1 3300050514 Bacteria 1276
370 nmdc:mga08x19_5161_c1 3300050514 Bacteria 7722
371 nmdc:mga08x19_91282_c1 3300050514 Unclassified 2010
372 nmdc:mga0a205_81826_c1 3300050515 Bacteria 3119
373 Ga0495601_0005560 3300053077 Bacteria 7350
374 Ga0495601_0039003 3300053077 Bacteria 2973
375 Ga0500644_0005231 3300053088 Bacteria 3268
376 Ga0500651_0000009 3300053093 Bacteria 270362
377 Ga0500572_019872 3300053111 Bacteria 1760
378 Ga0500595_000072 3300053119 Bacteria 71795
379 Ga0500661_001132 3300055283 Bacteria 4996
380 2884218523 2884215851 Bacteria 4554841
381 Ga0268266_10002541
382 rootH1_10049638
383 rootH2_10162621
384 Ga0070658_10000101
385 Ga0070658_10026098
386 Ga0070658_10063392
387 Ga0070683_100045717
388 Ga0070680_100029891
389 Ga0068868_100013663
390 Ga0070661_100050778
391 Ga0070668_100400164
392 Ga0070671_100216904
393 Ga0070673_100246045
394 Ga0070659_100018303
395 Ga0070659_100066297
396 Ga0070659_100209575
397 Ga0070714_100000338
398 Ga0070714_100272213
399 Ga0070713_100016676
400 Ga0070713_100043699
401 Ga0070713_100060805
402 Ga0070711_100192003
403 Ga0070663_100022896
404 Ga0070662_100343407
405 Ga0070681_10056765
406 Ga0070706_100171319
407 Ga0070679_100001106
408 Ga0068853_100000087
409 Ga0068853_100010354
410 Ga0068853_100120350
411 Ga0068853_100233665
412 Ga0070665_100042719
413 Ga0070665_100063399
414 Ga0070665_100067214
415 Ga0070665_100094330
416 Ga0068855_100028854
417 Ga0068855_100056118
418 Ga0068855_100198390
419 Ga0068857_100003186
420 Ga0068854_100000037
421 Ga0068854_100012049
422 Ga0068856_100196015
423 Ga0068852_100024010
424 Ga0068851_10053821
425 Ga0068851_10096141
426 Ga0068863_100025950
427 Ga0081540_1007286
428 Ga0070717_10033376
429 Ga0070717_10085981
430 Ga0070715_10024527
431 Ga0070712_100012127
432 Ga0070712_100096935
433 Ga0075430_100019532
434 Ga0075431_100081732
435 Ga0075433_10081749
436 Ga0075436_100032651
437 Ga0105240_10000001
438 Ga0105240_10000284
439 Ga0105240_10012026
440 Ga0105240_10012499
441 Ga0105240_10022438
442 Ga0105240_10111156
443 Ga0105240_10157977
444 Ga0105240_10229904
445 Ga0111539_10062125
446 Ga0105245_10007271
447 Ga0105245_10023721
448 Ga0114129_10458113
449 Ga0105248_10000666
450 Ga0105248_10023865
451 Ga0105248_10061490
452 Ga0105248_10203428
453 Ga0105237_10005705
454 Ga0105237_10197615
455 Ga0105238_10028771
456 Ga0105238_10062700
457 Ga0105238_10383272
458 Ga0105239_10000334
459 Ga0105239_10074740
460 Ga0157370_10022847
461 Ga0157370_10024705
462 Ga0157370_10030637
463 Ga0157370_10081865
464 Ga0157370_10092680
465 Ga0157370_10316553
466 Ga0157369_10000493
467 Ga0157369_10014314
468 Ga0157369_10036136
469 Ga0157369_10074160
470 Ga0157369_10169297
471 Ga0157374_10009573
472 Ga0157374_10219923
473 Ga0157378_10026245
474 Ga0163162_10026438
475 Ga0163162_10138976
476 Ga0157372_10007624
477 Ga0157372_10013516
478 Ga0157372_10111373
479 Ga0157372_10226892
480 Ga0157372_10349679
481 Ga0163163_10318946
482 Ga0157376_10010898
483 Ga0157376_10017216
484 Ga0157376_10049914
485 Ga0213872_10096404
486 Ga0213875_10005551
487 Ga0224572_1002416
488 Ga0209233_1002583
489 Ga0209233_1007762
490 Ga0207680_10009735
491 Ga0207647_10002648
492 Ga0207647_10013174
493 Ga0207699_10045527
494 Ga0207705_10000109
495 Ga0207705_10009375
496 Ga0207705_10019360
497 Ga0207705_10024264
498 Ga0207707_10142041
499 Ga0207707_10232448
500 Ga0207707_10286783
501 Ga0207695_10000001
502 Ga0207695_10014790
503 Ga0207695_10020263
504 Ga0207695_10051710
505 Ga0207695_10072415
506 Ga0207695_10079222
507 Ga0207693_10240440
508 Ga0207657_10004594
509 Ga0207657_10077410
510 Ga0207657_10134899
511 Ga0207652_10001024
512 Ga0207652_10094372
513 Ga0207652_10305242
514 Ga0207646_10000044
515 Ga0207694_10000105
516 Ga0207694_10006015
517 Ga0207694_10044474
518 Ga0207650_10169832
519 Ga0207687_10034262
520 Ga0207687_10063381
521 Ga0207700_10010139
522 Ga0207700_10057132
523 Ga0207664_10131293
524 Ga0207644_10084107
525 Ga0207690_10001283
526 Ga0207690_10100334
527 Ga0207665_10002689
528 Ga0207665_10083780
529 Ga0207711_10000014
530 Ga0207711_10000606
531 Ga0207711_10017586
532 Ga0207661_10024098
533 Ga0207679_10173366
534 Ga0207667_10005429
535 Ga0207667_10043023
536 Ga0207667_10056370
537 Ga0207667_10219203
538 Ga0207640_10000002
539 Ga0207640_10003704
540 Ga0207640_10135897
541 Ga0207639_10000071
542 Ga0207639_10022782
543 Ga0207639_10064133
544 Ga0207639_10178497
545 Ga0207678_10011984
546 Ga0207678_10189674
547 Ga0207678_10222031
548 Ga0207702_10066294
549 Ga0207641_10006824
550 Ga0207674_10002385
551 Ga0207698_10045026
552 Ga0268266_10024683
553 Ga0265323_10032855
554 Ga0265336_10001922
555 Ga0265338_10118311
556 Ga0265338_10121980
557 Ga0265330_10114389
558 Ga0265340_10015697
559 Ga0265339_10004422
560 Ga0265316_10023873
561 Ga0265316_10025821
562 Ga0265316_10182656
563 Ga0265316_10199062
564 Ga0265316_10207386
565 Ga0265314_10090549
566 Ga0265342_10014307
567 Ga0265342_10064194
568 Ga0265342_10149178
569 Ga0307510_10027300
570 Ga0373955_0007765
571 Ga0373955_0069357
572 Ga0373924_0000480
573 Ga0373924_0017803
574 Ga0373924_0112556
575 Ga0373935_0002908
576 Ga0373927_0090353
577 Ga0373933_0191727
578 Ga0373947_0002500
579 Ga0373937_0005568
580 Ga0373937_0045966
581 Ga0373925_0010869
582 Ga0373925_0028029
583 Ga0395900_0155592
584 Ga0395898_0100335
585 Ga0395905_0021089
586 Ga0436364_0220151
587 Ga0436364_0350882
588 Ga0436365_0702050
589 Ga0436360_1093448
590 Ga0436361_0927715
591 Ga0436363_0305441
592 Ga0436363_0317733
593 Ga0436363_1719984
594 Ga0436362_1024607
595 Ga0466966_0102499
596 Ga0466957_0000190
597 Ga0466959_0044258
598 Ga0466959_0045149
599 Ga0451576_0213212
600 Ga0466958_0043520
601 Ga0466967_0236164
602 Ga0495592_0013833
603 Ga0495603_0001136
604 Ga0495629_0005458
605 Ga0495629_0007756
606 Ga0495651_0011980
607 Ga0495651_0040058
608 Ga0495651_0074686
609 Ga0495651_0082832
610 Ga0495653_0000990
611 Ga0495650_0000037
612 Ga0495650_0003543
613 Ga0495580_0006575
614 Ga0495580_0011991
615 Ga0495580_0012833
616 Ga0495582_0001593
617 Ga0495582_0021365
618 Ga0495639_0001600
619 Ga0495639_0062174
620 Ga0495639_0068792
621 Ga0495662_0001212
622 Ga0495664_0038969
623 Ga0495664_0060156
624 Ga0495585_0014002
625 Ga0495585_0088320
626 Ga0495594_0000357
627 Ga0495594_0001145
628 Ga0495583_0045346
629 Ga0495606_0100233
630 Ga0495606_0183406
631 Ga0495628_0021455
632 Ga0495628_0043748
633 Ga0495630_0195270
634 Ga0495630_0295553
635 Ga0495643_0062087
636 Ga0495644_0000004
637 Ga0495666_0001214
638 Ga0495642_0031077
639 Ga0495652_0002436
640 Ga0495665_0004967
641 Ga0495665_0193255
642 Ga0495640_0009155
643 Ga0495586_0000610
644 Ga0495587_0036728
645 Ga0495609_0007019
646 Ga0495645_0003197
647 Ga0495645_0011176
648 Ga0495645_0022866
649 Ga0495622_0026289
650 Ga0495633_0016249
651 Ga0495667_0003403
652 Ga0495668_0030486
653 Ga0495634_0003182
654 Ga0495611_0060758
655 Ga0495625_0000166
656 Ga0495625_0003450
657 Ga0495625_0012010
658 Ga0495625_0041280
659 Ga0495635_0005990
660 Ga0495635_0064550
661 Ga0495661_0200063
662 Ga0495657_0046027
663 Ga0495599_0039228
664 Ga0495623_0033016
665 Ga0495623_0216596
666 Ga0495646_0034039
667 Ga0495658_0088096
668 Ga0495669_0001203
669 Ga0495669_0077092
670 Ga0495613_0013042
671 Ga0495613_0058457
672 Ga0495624_0005056
673 Ga0495670_0014600
674 Ga0495670_0149111
675 Ga0495671_0124204
676 Ga0495649_0020989
677 Ga0495649_0062838
678 Ga0495600_0006144
679 Ga0495581_0000872
680 Ga0495581_0125375
681 Ga0495604_0006716
682 Ga0495604_0046086
683 Ga0495604_0114489
684 Ga0495674_0050585
685 Ga0495674_0078675
686 Ga0495672_0004803
687 Ga0495676_0004397
688 Ga0495680_0005428
689 Ga0495675_0001672
690 Ga0495684_0059910
691 Ga0495684_0099679
692 Ga0495684_0225375
693 Ga0495686_0000009
694 Ga0495686_0002116
695 Ga0495686_0032716
696 Ga0495686_0042323
697 Ga0495593_0024129
698 Ga0495614_0005797
699 Ga0495614_0015701
700 Ga0495614_0048383
701 Ga0496102_0059469
702 Ga0496103_0046981
703 Ga0496104_0000031
704 Ga0496104_0155423
705 Ga0496105_0011971
706 Ga0496105_0033714
707 Ga0496105_0136835
708 Ga0496108_0096180
709 Ga0496108_0427374
710 Ga0496109_0049253
711 Ga0496110_0051871
712 Ga0496111_0005350
713 Ga0496112_0006152
714 Ga0496112_0041195
715 Ga0496112_0077168
716 Ga0496113_0001005
717 Ga0496113_0029410
718 Ga0496115_0063980
719 Ga0496126_0000024
720 Ga0496126_0000111
721 Ga0496126_0000855
722 Ga0496126_0001781
723 Ga0495682_0035298
724 Ga0495682_0039735
725 Ga0501296_001888
726 Ga0501032_0002119
727 Ga0501033_0018089
728 Ga0501034_0030535
729 Ga0501036_0001980
730 Ga0501037_0043247
731 Ga0501037_0189575
732 Ga0501038_0017174
733 Ga0501038_0065445
734 Ga0501039_0044004
735 Ga0501041_0121186
736 Ga0501043_0000430
737 Ga0501046_0000371
738 Ga0501047_0013169
739 Ga0501070_0102455
740 Ga0501073_0008963
741 Ga0501079_0120750
742 Ga0501080_0096673
743 Ga0501080_0207214
744 Ga0501035_0002370
745 Ga0501035_0158172
746 Ga0501044_0012096
747 Ga0501044_0139960
748 nmdc:mga08y16_67519_c1
749 nmdc:mga08x19_230034_c1
750 nmdc:mga08x19_5161_c1
751 nmdc:mga08x19_91282_c1
752 nmdc:mga0a205_81826_c1
753 Ga0495601_0005560
754 Ga0495601_0039003
755 Ga0500644_0005231
756 Ga0500651_0000009
757 Ga0500572_019872
758 Ga0500595_000072
759 Ga0500661_001132
760 2884218523

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

96

240

0.9

PF13353

Fer4_12

4Fe-4S single cluster domain

93

219

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6efn-assembly1.cif.gz_A-2 structure of a ripp maturase, skfb 0.7626 41 298
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.7371 44 237
2a5h-assembly1.cif.gz_D 2.1 angstrom x-ray crystal structure of lysine-2,3-aminomutase from clostridium subterminale sb4, with michaelis analog (l-alpha-lysine external aldimine form of pyridoxal-5'-phosphate). 0.7294 41 207
5ff4-assembly1.cif.gz_A hyde from t. maritima in complex with (2r,4r)-tmetda 0.7264 42 211
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.7255 44 237
ID Description Score Start End Superfamily
af_Q59026_29_239_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7639 46 237 3.20.20.70
af_Q57888_1_320_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.763 41 211 3.20.20.70
af_Q2FX16_20_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7278 41 237 3.20.20.70
2a5hB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7265 41 207 3.20.20.70
af_P0CH67_115_331_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7239 42 214 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3N5XMT7-F1-model_v4 Radical SAM protein 0.9635 17 321 GO:0003824
GO:0046872
GO:0051536
AF-A0A3N5XMT7-F1-model_v4 Radical SAM protein 0.9543 17 321 GO:0003824
GO:0046872
GO:0051536
AF-A0A7C2X8A6-F1-model_v4 Radical SAM protein 0.9506 32 341 GO:0003824
GO:0046872
GO:0051536
AF-A0A2V8FWE1-F1-model_v4 Radical SAM protein 0.9456 44 332 GO:0003824
GO:0046872
GO:0051536
AF-A0A2V9TXE9-F1-model_v4 Radical SAM protein 0.9409 16 236 GO:0003824
GO:0046872
GO:0051536

Map