F428702

General Info

Members Datasets Scaffolds Average Seq Length
380 238 760 108

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_11370779|Ga0268264_113707792
Length 129
Sequence MRRIVGWFDDRLGAARFARSSLDKVFEALASGPRRQILAYLAEAELSTSQLAERFSMSAPAISRHLSVLENAGLVSSERQGQFVLYRLNRDHLVNHLTGYAFELCPVGRPLKRESRALAKRRKTGASNA

Samples

Sample ID Description Type Environment
1 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
157 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
167 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
224 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
225 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
226 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
231 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
234 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 2643221585 Pelomonas sp. Root662 Isolate Unclassified
237 2643221656 Pelomonas sp. Root405 Isolate Unclassified
238 2818991436 Collimonas arenae 515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.63
Nodule 0.26
Rhizoplane 0.79
Rhizosphere 71.32
Stem 0
Stem Tuber 0
Unclassified 11.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268264_11370779 3300028381 Bacteria 718
2 JGI25159J45721_1000148 3300002987 Bacteria 32592
3 JGI25159J45721_1003614 3300002987 Bacteria 5398
4 JGI25151J46595_10014788 3300003187 Bacteria 3464
5 rootH1_10118329 3300003316 Bacteria 1958
6 rootL2_10322494 3300003322 Bacteria 1453
7 rootH1_10061288 3300003323 Bacteria 1233
8 JGI25160J50197_1000123 3300003354 Bacteria 70031
9 JGI25161J50226_1000032 3300003374 Bacteria 138440
10 Ga0055526_1000187 3300003771 Bacteria 54124
11 Ga0055524_1000094 3300003775 Bacteria 110394
12 Ga0055524_1091744 3300003775 Unclassified 525
13 Ga0055536_1016528 3300003781 Bacteria 2462
14 Ga0055534_1009778 3300003784 Bacteria 2055
15 Ga0055530_10000793 3300003791 Bacteria 26295
16 Ga0055530_10011533 3300003791 Bacteria 3165
17 Ga0055530_10048367 3300003791 Bacteria 999
18 Ga0055540_1000012 3300003792 Bacteria 262667
19 Ga0055540_1078309 3300003792 Bacteria 637
20 Ga0055540_1108990 3300003792 Unclassified 512
21 Ga0055531_10000002 3300003794 Bacteria 421971
22 Ga0055531_10001541 3300003794 Bacteria 16875
23 Ga0055543_1000294 3300004625 Bacteria 35881
24 Ga0065165_1003813 3300005262 Bacteria 10056
25 Ga0065165_1018183 3300005262 Bacteria 2556
26 Ga0065715_10842628 3300005293 Bacteria 594
27 Ga0070676_10688852 3300005328 Bacteria 745
28 Ga0070670_100091477 3300005331 Bacteria 2616
29 Ga0070670_100479444 3300005331 Bacteria 1105
30 Ga0070670_101457549 3300005331 Unclassified 628
31 Ga0068869_100292238 3300005334 Bacteria 1313
32 Ga0070666_11230843 3300005335 Bacteria 558
33 Ga0070682_100953145 3300005337 Unclassified 709
34 Ga0068868_101804710 3300005338 Bacteria 578
35 Ga0070689_101793042 3300005340 Unclassified 559
36 Ga0070671_100577413 3300005355 Bacteria 971
37 Ga0070674_100390176 3300005356 Bacteria 1135
38 Ga0070673_100057428 3300005364 Bacteria 3074
39 Ga0070688_100814239 3300005365 Bacteria 731
40 Ga0070659_100500520 3300005366 Bacteria 1036
41 Ga0070667_100052431 3300005367 Bacteria 3442
42 Ga0070667_100672418 3300005367 Bacteria 957
43 Ga0070663_100034295 3300005455 Bacteria 3514
44 Ga0070663_101779184 3300005455 Bacteria 552
45 Ga0070678_100181226 3300005456 Bacteria 1724
46 Ga0070662_100048805 3300005457 Bacteria 3051
47 Ga0068853_100099608 3300005539 Bacteria 2568
48 Ga0068853_100250504 3300005539 Bacteria 1625
49 Ga0070672_100153736 3300005543 Bacteria 1905
50 Ga0070672_100653130 3300005543 Bacteria 919
51 Ga0070693_100387694 3300005547 Unclassified 965
52 Ga0070665_100394291 3300005548 Bacteria 1392
53 Ga0070665_100471293 3300005548 Bacteria 1266
54 Ga0070665_101490221 3300005548 Bacteria 685
55 Ga0070664_100586503 3300005564 Bacteria 1033
56 Ga0068857_100056593 3300005577 Bacteria 3480
57 Ga0068854_100009140 3300005578 Bacteria 6390
58 Ga0068854_100370097 3300005578 Bacteria 1178
59 Ga0068854_100606920 3300005578 Unclassified 935
60 Ga0070702_100347066 3300005615 Bacteria 1044
61 Ga0068852_100192344 3300005616 Bacteria 1926
62 Ga0068852_100265182 3300005616 Bacteria 1650
63 Ga0068852_100301559 3300005616 Unclassified 1551
64 Ga0068852_100322886 3300005616 Bacteria 1500
65 Ga0068852_100385410 3300005616 Bacteria 1376
66 Ga0068859_100543338 3300005617 Unclassified 1257
67 Ga0068859_102346161 3300005617 Bacteria 588
68 Ga0068864_100310810 3300005618 Bacteria 1477
69 Ga0068864_100823570 3300005618 Bacteria 913
70 Ga0068864_101327305 3300005618 Unclassified 720
71 Ga0068864_101755581 3300005618 Bacteria 625
72 Ga0068870_10457802 3300005840 Unclassified 842
73 Ga0068863_100004019 3300005841 Bacteria 14525
74 Ga0068863_100297770 3300005841 Bacteria 1564
75 Ga0068860_100000510 3300005843 Bacteria 48057
76 Ga0068860_100449460 3300005843 Bacteria 1281
77 Ga0081455_10002595 3300005937 Bacteria 21431
78 Ga0081455_10574538 3300005937 Bacteria 740
79 Ga0075365_10338684 3300006038 Bacteria 1060
80 Ga0075364_10179567 3300006051 Bacteria 1432
81 Ga0075362_10300140 3300006177 Bacteria 797
82 Ga0075367_10647464 3300006178 Bacteria 672
83 Ga0075366_10077396 3300006195 Bacteria 1985
84 Ga0075366_10129060 3300006195 Bacteria 1525
85 Ga0097621_100462450 3300006237 Bacteria 1144
86 Ga0097621_100731944 3300006237 Bacteria 912
87 Ga0075370_10086053 3300006353 Bacteria 1810
88 Ga0075370_10666429 3300006353 Bacteria 632
89 Ga0075370_10868812 3300006353 Bacteria 551
90 Ga0068865_100625030 3300006881 Bacteria 913
91 Ga0097620_100543316 3300006931 Unclassified 1257
92 Ga0097620_102346377 3300006931 Bacteria 588
93 Ga0079104_1038915 3300006946 Bacteria 1124
94 Ga0105250_10409688 3300009092 Unclassified 602
95 Ga0105240_10009929 3300009093 Bacteria 13423
96 Ga0105240_10112867 3300009093 Bacteria 3284
97 Ga0105240_10209964 3300009093 Unclassified 2276
98 Ga0105240_11456977 3300009093 Unclassified 719
99 Ga0105240_12113840 3300009093 Unclassified 584
100 Ga0105245_10409484 3300009098 Bacteria 1357
101 Ga0105245_12254301 3300009098 Bacteria 598
102 Ga0105243_11861191 3300009148 Bacteria 634
103 Ga0105241_10284779 3300009174 Bacteria 1413
104 Ga0105242_10029318 3300009176 Bacteria 4389
105 Ga0105242_10082222 3300009176 Unclassified 2695
106 Ga0105242_12944060 3300009176 Bacteria 527
107 Ga0105248_10628596 3300009177 Bacteria 1211
108 Ga0105237_10397881 3300009545 Unclassified 1382
109 Ga0105238_10003393 3300009551 Bacteria 15900
110 Ga0105249_10193970 3300009553 Bacteria 1984
111 Ga0105239_10009282 3300010375 Bacteria 11120
112 Ga0105239_10110020 3300010375 Bacteria 3054
113 Ga0105246_10258271 3300011119 Bacteria 1386
114 Ga0105246_10467768 3300011119 Unclassified 1064
115 Ga0157374_10000757 3300013296 Bacteria 28225
116 Ga0157374_10875205 3300013296 Bacteria 916
117 Ga0157378_11250577 3300013297 Bacteria 783
118 Ga0157378_11280101 3300013297 Bacteria 774
119 Ga0157378_11967698 3300013297 Bacteria 634
120 Ga0163162_10008818 3300013306 Bacteria 9806
121 Ga0163162_10036971 3300013306 Bacteria 4870
122 Ga0163162_10481988 3300013306 Bacteria 1372
123 Ga0157375_10108508 3300013308 Bacteria 2871
124 Ga0157375_10471410 3300013308 Bacteria 1421
125 Ga0157375_10952132 3300013308 Bacteria 1000
126 Ga0157375_12244261 3300013308 Bacteria 650
127 Ga0163163_10647927 3300014325 Bacteria 1120
128 Ga0163163_10877989 3300014325 Bacteria 960
129 Ga0163163_11055042 3300014325 Unclassified 876
130 Ga0163163_12878905 3300014325 Bacteria 537
131 Ga0157380_10660205 3300014326 Bacteria 1045
132 Ga0157380_12344441 3300014326 Bacteria 599
133 Ga0182008_10023506 3300014497 Bacteria 3147
134 Ga0157379_10345689 3300014968 Bacteria 1361
135 Ga0157379_11878765 3300014968 Bacteria 590
136 Ga0157376_10649877 3300014969 Bacteria 1055
137 Ga0182006_1007199 3300015261 Bacteria 5111
138 Ga0182007_10005358 3300015262 Bacteria 5651
139 Ga0182005_1004111 3300015265 Bacteria 4760
140 Ga0163161_10096758 3300017792 Bacteria 2192
141 Ga0209436_103392 3300025208 Bacteria 4259
142 Ga0207425_1011876 3300025245 Bacteria 2061
143 Ga0209129_1005872 3300025258 Bacteria 4170
144 Ga0209565_1008490 3300025263 Bacteria 2682
145 Ga0209565_1014566 3300025263 Bacteria 1801
146 Ga0209130_1000050 3300025284 Bacteria 222092
147 Ga0209130_1000082 3300025284 Bacteria 164441
148 Ga0209675_1009291 3300025291 Bacteria 3489
149 Ga0209675_1009831 3300025291 Bacteria 3335
150 Ga0209675_1011229 3300025291 Bacteria 2985
151 Ga0209676_1000029 3300025292 Bacteria 520536
152 Ga0209676_1004456 3300025292 Bacteria 7787
153 Ga0209025_1005031 3300025294 Bacteria 11033
154 Ga0209564_1000028 3300025295 Bacteria 510986
155 Ga0209564_1000154 3300025295 Bacteria 166849
156 Ga0209564_1085091 3300025295 Bacteria 602
157 Ga0209050_1000003 3300025298 Bacteria 1609245
158 Ga0209050_1002246 3300025298 Bacteria 17232
159 Ga0209050_1003209 3300025298 Bacteria 12372
160 Ga0209050_1009468 3300025298 Bacteria 4981
161 Ga0209050_1011834 3300025298 Bacteria 4080
162 Ga0209256_1000071 3300025299 Bacteria 242618
163 Ga0209256_1016934 3300025299 Bacteria 2453
164 Ga0207426_1000071 3300025302 Bacteria 329539
165 Ga0207426_1001744 3300025302 Bacteria 16547
166 Ga0209051_1000003 3300025303 Bacteria 1609245
167 Ga0209051_1016209 3300025303 Bacteria 3387
168 Ga0209051_1078032 3300025303 Bacteria 967
169 Ga0209257_1000018 3300025304 Bacteria 836016
170 Ga0209257_1000049 3300025304 Bacteria 441224
171 Ga0209257_1044925 3300025304 Bacteria 1286
172 Ga0209257_1053255 3300025304 Bacteria 1133
173 Ga0209257_1055562 3300025304 Bacteria 1097
174 Ga0207680_10132936 3300025903 Bacteria 1641
175 Ga0207680_10223266 3300025903 Bacteria 1292
176 Ga0207680_10830079 3300025903 Bacteria 663
177 Ga0207647_10092345 3300025904 Bacteria 1805
178 Ga0207654_10151908 3300025911 Bacteria 1487
179 Ga0207707_11114344 3300025912 Unclassified 643
180 Ga0207695_10008170 3300025913 Bacteria 13149
181 Ga0207695_10223665 3300025913 Unclassified 1789
182 Ga0207695_11593577 3300025913 Unclassified 533
183 Ga0207671_10212414 3300025914 Bacteria 1514
184 Ga0207694_10791674 3300025924 Bacteria 801
185 Ga0207694_11315297 3300025924 Bacteria 611
186 Ga0207694_11853370 3300025924 Bacteria 506
187 Ga0207650_10116729 3300025925 Bacteria 2073
188 Ga0207650_10896161 3300025925 Bacteria 753
189 Ga0207687_10483108 3300025927 Bacteria 1032
190 Ga0207687_11190311 3300025927 Bacteria 655
191 Ga0207644_10102714 3300025931 Bacteria 2151
192 Ga0207706_10008972 3300025933 Bacteria 9203
193 Ga0207686_10016213 3300025934 Bacteria 4178
194 Ga0207709_10904478 3300025935 Bacteria 717
195 Ga0207669_10076399 3300025937 Bacteria 2126
196 Ga0207704_10135170 3300025938 Bacteria 1715
197 Ga0207691_10024718 3300025940 Bacteria 5648
198 Ga0207711_10879066 3300025941 Bacteria 834
199 Ga0207689_10450665 3300025942 Bacteria 1075
200 Ga0207679_10213246 3300025945 Bacteria 1620
201 Ga0207679_10470135 3300025945 Bacteria 1118
202 Ga0207679_10521860 3300025945 Bacteria 1062
203 Ga0207640_10012061 3300025981 Bacteria 4913
204 Ga0207640_10431668 3300025981 Bacteria 1081
205 Ga0207640_11149083 3300025981 Bacteria 689
206 Ga0207658_10014258 3300025986 Bacteria 5442
207 Ga0207658_10984814 3300025986 Bacteria 769
208 Ga0207677_10576156 3300026023 Bacteria 984
209 Ga0207703_10361853 3300026035 Bacteria 1338
210 Ga0207639_10235657 3300026041 Bacteria 1589
211 Ga0207639_10271652 3300026041 Bacteria 1487
212 Ga0207639_11266569 3300026041 Bacteria 692
213 Ga0207639_11645040 3300026041 Unclassified 602
214 Ga0207678_10019199 3300026067 Bacteria 6002
215 Ga0207678_11546722 3300026067 Bacteria 585
216 Ga0207702_11806978 3300026078 Unclassified 603
217 Ga0207641_10000821 3300026088 Bacteria 33006
218 Ga0207641_10231906 3300026088 Bacteria 1716
219 Ga0207641_11051921 3300026088 Unclassified 812
220 Ga0207648_10088207 3300026089 Bacteria 2709
221 Ga0207676_10326576 3300026095 Bacteria 1410
222 Ga0207676_11247902 3300026095 Bacteria 737
223 Ga0207676_11909606 3300026095 Bacteria 592
224 Ga0207674_10081062 3300026116 Bacteria 3247
225 Ga0207675_102689467 3300026118 Bacteria 506
226 Ga0207683_10246543 3300026121 Bacteria 1630
227 Ga0207683_10403699 3300026121 Bacteria 1257
228 Ga0207698_10048538 3300026142 Bacteria 3224
229 Ga0207698_10210116 3300026142 Bacteria 1750
230 Ga0207698_10220351 3300026142 Bacteria 1714
231 Ga0207698_12225929 3300026142 Bacteria 561
232 Ga0268266_10095614 3300028379 Bacteria 2610
233 Ga0268266_10459241 3300028379 Unclassified 1212
234 Ga0268264_10000025 3300028381 Bacteria 468619
235 Ga0268264_12427569 3300028381 Bacteria 530
236 Ga0265336_10001533 3300028666 Bacteria 10390
237 Ga0307517_10166079 3300028786 Bacteria 1466
238 Ga0265324_10001433 3300029957 Bacteria 13672
239 Ga0265324_10023732 3300029957 Unclassified 2183
240 Ga0307513_10000486 3300031456 Bacteria 57184
241 Ga0307509_10292096 3300031507 Bacteria 1384
242 Ga0307408_100098583 3300031548 Bacteria 2222
243 Ga0307408_102520118 3300031548 Unclassified 500
244 Ga0307516_10752166 3300031730 Bacteria 634
245 Ga0307405_10510364 3300031731 Bacteria 965
246 Ga0307410_10024929 3300031852 Bacteria 3744
247 Ga0307406_10018095 3300031901 Bacteria 4111
248 Ga0307409_100031520 3300031995 Bacteria 3828
249 Ga0307409_102147627 3300031995 Bacteria 588
250 Ga0307414_10102795 3300032004 Bacteria 2154
251 Ga0307414_11317195 3300032004 Bacteria 670
252 Ga0307411_10024387 3300032005 Bacteria 3605
253 Ga0307411_10536562 3300032005 Bacteria 996
254 Ga0307411_11110109 3300032005 Unclassified 713
255 Ga0307510_10094571 3300033180 Bacteria 2813
256 Ga0395898_0049187 3300037466 Bacteria 4132
257 Ga0395905_0128984 3300037471 Bacteria 2378
258 Ga0395905_1017653 3300037471 Bacteria 732
259 Ga0436365_1153183 3300039437 Bacteria 620
260 Ga0436361_1160070 3300039447 Bacteria 1262
261 Ga0439465_0148980 3300041413 Bacteria 835
262 Ga0451798_0354479 3300041458 Bacteria 904
263 Ga0451800_0099571 3300041459 Bacteria 1273
264 Ga0451851_0959056 3300041507 Unclassified 841
265 Ga0451853_1981532 3300041512 Unclassified 1029
266 Ga0451853_2872608 3300041512 Unclassified 923
267 Ga0450898_023079 3300042134 Bacteria 1104
268 Ga0450898_103623 3300042134 Bacteria 596
269 Ga0439464_0142042 3300042439 Bacteria 748
270 Ga0466969_0000157 3300044656 Bacteria 36880
271 Ga0466972_0068477 3300044658 Bacteria 1695
272 Ga0466965_0214583 3300044683 Bacteria 1024
273 Ga0466966_0004340 3300044684 Bacteria 9348
274 Ga0466966_0014314 3300044684 Bacteria 5252
275 Ga0466966_0064659 3300044684 Bacteria 2302
276 Ga0466961_0014705 3300044693 Bacteria 5029
277 Ga0466961_0113866 3300044693 Bacteria 1700
278 Ga0466970_0029772 3300044765 Bacteria 2877
279 Ga0466970_0088699 3300044765 Bacteria 1677
280 Ga0466970_0096593 3300044765 Bacteria 1607
281 Ga0466959_0049957 3300045049 Bacteria 3072
282 Ga0466967_0229329 3300045976 Bacteria 1768
283 Ga0495617_000011 3300046452 Bacteria 301936
284 Ga0495627_056083 3300046453 Bacteria 1175
285 Ga0495590_0002586 3300046457 Bacteria 7478
286 Ga0495638_0000099 3300046460 Bacteria 139325
287 Ga0495638_0061753 3300046460 Bacteria 2315
288 Ga0495638_0212087 3300046460 Bacteria 1087
289 Ga0495650_0001477 3300046471 Bacteria 22549
290 Ga0495650_0012050 3300046471 Bacteria 4678
291 Ga0495639_0046741 3300046475 Bacteria 1960
292 Ga0495584_0084031 3300046491 Bacteria 1603
293 Ga0495585_0001778 3300046492 Bacteria 16374
294 Ga0495607_0008465 3300046501 Bacteria 7029
295 Ga0495607_0236350 3300046501 Bacteria 886
296 Ga0495583_0000220 3300046506 Bacteria 96267
297 Ga0495583_0003920 3300046506 Bacteria 11007
298 Ga0495606_0008326 3300046507 Bacteria 9035
299 Ga0495606_0409322 3300046507 Unclassified 704
300 Ga0495610_0000007 3300046512 Bacteria 820919
301 Ga0495620_0258164 3300046515 Unclassified 664
302 Ga0495632_0053136 3300046519 Unclassified 1990
303 Ga0495632_0447602 3300046519 Unclassified 561
304 Ga0495643_0196394 3300046522 Bacteria 971
305 Ga0495648_0000004 3300046524 Bacteria 373639
306 Ga0495648_0013967 3300046524 Bacteria 5908
307 Ga0495642_0009931 3300046528 Bacteria 3646
308 Ga0495654_0004713 3300046530 Bacteria 8035
309 Ga0495622_0000157 3300046557 Bacteria 57030
310 Ga0495633_0000327 3300046558 Bacteria 53707
311 Ga0495633_0001416 3300046558 Bacteria 18679
312 Ga0495633_0051464 3300046558 Bacteria 1940
313 Ga0495668_0012207 3300046616 Bacteria 5105
314 Ga0495668_0050387 3300046616 Bacteria 2308
315 Ga0495625_0000412 3300046660 Bacteria 64883
316 Ga0495661_0002829 3300046665 Bacteria 13143
317 Ga0495661_0069339 3300046665 Bacteria 2066
318 Ga0495670_0330556 3300046691 Unclassified 819
319 Ga0495670_0673576 3300046691 Unclassified 564
320 Ga0495671_0113317 3300046692 Bacteria 1324
321 Ga0495649_0012587 3300046694 Bacteria 4911
322 Ga0495589_0014996 3300046794 Bacteria 3988
323 Ga0495589_0129310 3300046794 Bacteria 1213
324 Ga0495660_0086040 3300046810 Bacteria 1641
325 Ga0495636_0024567 3300047318 Bacteria 2445
326 Ga0495683_0006778 3300047323 Bacteria 6227
327 Ga0495687_001413 3300047443 Bacteria 22111
328 Ga0495687_147922 3300047443 Unclassified 807
329 Ga0495677_0030918 3300047445 Bacteria 1949
330 Ga0495679_013734 3300047446 Bacteria 3025
331 Ga0495679_028169 3300047446 Bacteria 1844
332 Ga0495673_0000173 3300047469 Bacteria 106086
333 Ga0495686_0335218 3300047472 Bacteria 826
334 Ga0495686_0700860 3300047472 Bacteria 516
335 Ga0495615_0048026 3300048090 Bacteria 1089
336 Ga0495626_0162890 3300048091 Bacteria 934
337 Ga0496114_0001921 3300048917 Bacteria 15826
338 Ga0496116_0156621 3300048919 Bacteria 1256
339 Ga0496119_0006641 3300048922 Bacteria 10642
340 Ga0496120_0000018 3300048923 Bacteria 263952
341 Ga0496126_0927120 3300048929 Unclassified 658
342 Ga0495678_012163 3300049459 Bacteria 4087
343 Ga0501041_0375299 3300049577 Bacteria 900
344 Ga0501042_0238382 3300049578 Bacteria 1312
345 Ga0501042_0474901 3300049578 Bacteria 907
346 Ga0501048_0253502 3300049582 Bacteria 1250
347 Ga0501069_0556718 3300049585 Bacteria 686
348 Ga0501070_0395851 3300049586 Bacteria 1118
349 Ga0501071_0403439 3300049587 Bacteria 1044
350 Ga0501071_1409928 3300049587 Bacteria 538
351 Ga0501076_1000846 3300049592 Bacteria 689
352 Ga0501076_1044368 3300049592 Bacteria 673
353 Ga0501044_0486272 3300049823 Bacteria 1137
354 Ga0501044_1106543 3300049823 Bacteria 661
355 nmdc:mga03683_110003_c1 3300050489 Bacteria 1217
356 nmdc:mga0yw44_272356_c1 3300050492 Bacteria 1130
357 nmdc:mga0k408_177357_c1 3300050493 Bacteria 1270
358 nmdc:mga0k408_236494_c1 3300050493 Bacteria 1091
359 nmdc:mga07m45_105485_c1 3300050496 Bacteria 1621
360 Ga0500578_0018847 3300053086 Bacteria 4433
361 Ga0500578_0217507 3300053086 Bacteria 1163
362 Ga0500644_0058335 3300053088 Bacteria 1350
363 Ga0500651_0008892 3300053093 Bacteria 5940
364 Ga0500566_0214699 3300053094 Bacteria 961
365 Ga0500650_0206793 3300053098 Unclassified 892
366 Ga0500650_0251780 3300053098 Bacteria 792
367 Ga0500555_016457 3300053103 Bacteria 2130
368 Ga0500595_003100 3300053119 Bacteria 7870
369 Ga0500652_123560 3300053131 Bacteria 1081
370 Ga0500568_0013147 3300053139 Unclassified 3780
371 Ga0500577_0234159 3300053142 Bacteria 796
372 Ga0500586_020279 3300053145 Bacteria 2080
373 Ga0500616_0017218 3300053153 Bacteria 4103
374 Ga0500616_0202964 3300053153 Unclassified 877
375 Ga0500622_0064380 3300053156 Unclassified 1865
376 Ga0500576_231389 3300053725 Bacteria 595
377 Ga0500645_003416 3300053730 Bacteria 6456
378 2643932321 2643221585 Bacteria 5812563
379 2644313572 2643221656 Bacteria 5809961
380 2819541926 2818991436 Bacteria 5376622
381 Ga0268264_11370779
382 JGI25159J45721_1000148
383 JGI25159J45721_1003614
384 JGI25151J46595_10014788
385 rootH1_10118329
386 rootL2_10322494
387 rootH1_10061288
388 JGI25160J50197_1000123
389 JGI25161J50226_1000032
390 Ga0055526_1000187
391 Ga0055524_1000094
392 Ga0055524_1091744
393 Ga0055536_1016528
394 Ga0055534_1009778
395 Ga0055530_10000793
396 Ga0055530_10011533
397 Ga0055530_10048367
398 Ga0055540_1000012
399 Ga0055540_1078309
400 Ga0055540_1108990
401 Ga0055531_10000002
402 Ga0055531_10001541
403 Ga0055543_1000294
404 Ga0065165_1003813
405 Ga0065165_1018183
406 Ga0065715_10842628
407 Ga0070676_10688852
408 Ga0070670_100091477
409 Ga0070670_100479444
410 Ga0070670_101457549
411 Ga0068869_100292238
412 Ga0070666_11230843
413 Ga0070682_100953145
414 Ga0068868_101804710
415 Ga0070689_101793042
416 Ga0070671_100577413
417 Ga0070674_100390176
418 Ga0070673_100057428
419 Ga0070688_100814239
420 Ga0070659_100500520
421 Ga0070667_100052431
422 Ga0070667_100672418
423 Ga0070663_100034295
424 Ga0070663_101779184
425 Ga0070678_100181226
426 Ga0070662_100048805
427 Ga0068853_100099608
428 Ga0068853_100250504
429 Ga0070672_100153736
430 Ga0070672_100653130
431 Ga0070693_100387694
432 Ga0070665_100394291
433 Ga0070665_100471293
434 Ga0070665_101490221
435 Ga0070664_100586503
436 Ga0068857_100056593
437 Ga0068854_100009140
438 Ga0068854_100370097
439 Ga0068854_100606920
440 Ga0070702_100347066
441 Ga0068852_100192344
442 Ga0068852_100265182
443 Ga0068852_100301559
444 Ga0068852_100322886
445 Ga0068852_100385410
446 Ga0068859_100543338
447 Ga0068859_102346161
448 Ga0068864_100310810
449 Ga0068864_100823570
450 Ga0068864_101327305
451 Ga0068864_101755581
452 Ga0068870_10457802
453 Ga0068863_100004019
454 Ga0068863_100297770
455 Ga0068860_100000510
456 Ga0068860_100449460
457 Ga0081455_10002595
458 Ga0081455_10574538
459 Ga0075365_10338684
460 Ga0075364_10179567
461 Ga0075362_10300140
462 Ga0075367_10647464
463 Ga0075366_10077396
464 Ga0075366_10129060
465 Ga0097621_100462450
466 Ga0097621_100731944
467 Ga0075370_10086053
468 Ga0075370_10666429
469 Ga0075370_10868812
470 Ga0068865_100625030
471 Ga0097620_100543316
472 Ga0097620_102346377
473 Ga0079104_1038915
474 Ga0105250_10409688
475 Ga0105240_10009929
476 Ga0105240_10112867
477 Ga0105240_10209964
478 Ga0105240_11456977
479 Ga0105240_12113840
480 Ga0105245_10409484
481 Ga0105245_12254301
482 Ga0105243_11861191
483 Ga0105241_10284779
484 Ga0105242_10029318
485 Ga0105242_10082222
486 Ga0105242_12944060
487 Ga0105248_10628596
488 Ga0105237_10397881
489 Ga0105238_10003393
490 Ga0105249_10193970
491 Ga0105239_10009282
492 Ga0105239_10110020
493 Ga0105246_10258271
494 Ga0105246_10467768
495 Ga0157374_10000757
496 Ga0157374_10875205
497 Ga0157378_11250577
498 Ga0157378_11280101
499 Ga0157378_11967698
500 Ga0163162_10008818
501 Ga0163162_10036971
502 Ga0163162_10481988
503 Ga0157375_10108508
504 Ga0157375_10471410
505 Ga0157375_10952132
506 Ga0157375_12244261
507 Ga0163163_10647927
508 Ga0163163_10877989
509 Ga0163163_11055042
510 Ga0163163_12878905
511 Ga0157380_10660205
512 Ga0157380_12344441
513 Ga0182008_10023506
514 Ga0157379_10345689
515 Ga0157379_11878765
516 Ga0157376_10649877
517 Ga0182006_1007199
518 Ga0182007_10005358
519 Ga0182005_1004111
520 Ga0163161_10096758
521 Ga0209436_103392
522 Ga0207425_1011876
523 Ga0209129_1005872
524 Ga0209565_1008490
525 Ga0209565_1014566
526 Ga0209130_1000050
527 Ga0209130_1000082
528 Ga0209675_1009291
529 Ga0209675_1009831
530 Ga0209675_1011229
531 Ga0209676_1000029
532 Ga0209676_1004456
533 Ga0209025_1005031
534 Ga0209564_1000028
535 Ga0209564_1000154
536 Ga0209564_1085091
537 Ga0209050_1000003
538 Ga0209050_1002246
539 Ga0209050_1003209
540 Ga0209050_1009468
541 Ga0209050_1011834
542 Ga0209256_1000071
543 Ga0209256_1016934
544 Ga0207426_1000071
545 Ga0207426_1001744
546 Ga0209051_1000003
547 Ga0209051_1016209
548 Ga0209051_1078032
549 Ga0209257_1000018
550 Ga0209257_1000049
551 Ga0209257_1044925
552 Ga0209257_1053255
553 Ga0209257_1055562
554 Ga0207680_10132936
555 Ga0207680_10223266
556 Ga0207680_10830079
557 Ga0207647_10092345
558 Ga0207654_10151908
559 Ga0207707_11114344
560 Ga0207695_10008170
561 Ga0207695_10223665
562 Ga0207695_11593577
563 Ga0207671_10212414
564 Ga0207694_10791674
565 Ga0207694_11315297
566 Ga0207694_11853370
567 Ga0207650_10116729
568 Ga0207650_10896161
569 Ga0207687_10483108
570 Ga0207687_11190311
571 Ga0207644_10102714
572 Ga0207706_10008972
573 Ga0207686_10016213
574 Ga0207709_10904478
575 Ga0207669_10076399
576 Ga0207704_10135170
577 Ga0207691_10024718
578 Ga0207711_10879066
579 Ga0207689_10450665
580 Ga0207679_10213246
581 Ga0207679_10470135
582 Ga0207679_10521860
583 Ga0207640_10012061
584 Ga0207640_10431668
585 Ga0207640_11149083
586 Ga0207658_10014258
587 Ga0207658_10984814
588 Ga0207677_10576156
589 Ga0207703_10361853
590 Ga0207639_10235657
591 Ga0207639_10271652
592 Ga0207639_11266569
593 Ga0207639_11645040
594 Ga0207678_10019199
595 Ga0207678_11546722
596 Ga0207702_11806978
597 Ga0207641_10000821
598 Ga0207641_10231906
599 Ga0207641_11051921
600 Ga0207648_10088207
601 Ga0207676_10326576
602 Ga0207676_11247902
603 Ga0207676_11909606
604 Ga0207674_10081062
605 Ga0207675_102689467
606 Ga0207683_10246543
607 Ga0207683_10403699
608 Ga0207698_10048538
609 Ga0207698_10210116
610 Ga0207698_10220351
611 Ga0207698_12225929
612 Ga0268266_10095614
613 Ga0268266_10459241
614 Ga0268264_10000025
615 Ga0268264_12427569
616 Ga0265336_10001533
617 Ga0307517_10166079
618 Ga0265324_10001433
619 Ga0265324_10023732
620 Ga0307513_10000486
621 Ga0307509_10292096
622 Ga0307408_100098583
623 Ga0307408_102520118
624 Ga0307516_10752166
625 Ga0307405_10510364
626 Ga0307410_10024929
627 Ga0307406_10018095
628 Ga0307409_100031520
629 Ga0307409_102147627
630 Ga0307414_10102795
631 Ga0307414_11317195
632 Ga0307411_10024387
633 Ga0307411_10536562
634 Ga0307411_11110109
635 Ga0307510_10094571
636 Ga0395898_0049187
637 Ga0395905_0128984
638 Ga0395905_1017653
639 Ga0436365_1153183
640 Ga0436361_1160070
641 Ga0439465_0148980
642 Ga0451798_0354479
643 Ga0451800_0099571
644 Ga0451851_0959056
645 Ga0451853_1981532
646 Ga0451853_2872608
647 Ga0450898_023079
648 Ga0450898_103623
649 Ga0439464_0142042
650 Ga0466969_0000157
651 Ga0466972_0068477
652 Ga0466965_0214583
653 Ga0466966_0004340
654 Ga0466966_0014314
655 Ga0466966_0064659
656 Ga0466961_0014705
657 Ga0466961_0113866
658 Ga0466970_0029772
659 Ga0466970_0088699
660 Ga0466970_0096593
661 Ga0466959_0049957
662 Ga0466967_0229329
663 Ga0495617_000011
664 Ga0495627_056083
665 Ga0495590_0002586
666 Ga0495638_0000099
667 Ga0495638_0061753
668 Ga0495638_0212087
669 Ga0495650_0001477
670 Ga0495650_0012050
671 Ga0495639_0046741
672 Ga0495584_0084031
673 Ga0495585_0001778
674 Ga0495607_0008465
675 Ga0495607_0236350
676 Ga0495583_0000220
677 Ga0495583_0003920
678 Ga0495606_0008326
679 Ga0495606_0409322
680 Ga0495610_0000007
681 Ga0495620_0258164
682 Ga0495632_0053136
683 Ga0495632_0447602
684 Ga0495643_0196394
685 Ga0495648_0000004
686 Ga0495648_0013967
687 Ga0495642_0009931
688 Ga0495654_0004713
689 Ga0495622_0000157
690 Ga0495633_0000327
691 Ga0495633_0001416
692 Ga0495633_0051464
693 Ga0495668_0012207
694 Ga0495668_0050387
695 Ga0495625_0000412
696 Ga0495661_0002829
697 Ga0495661_0069339
698 Ga0495670_0330556
699 Ga0495670_0673576
700 Ga0495671_0113317
701 Ga0495649_0012587
702 Ga0495589_0014996
703 Ga0495589_0129310
704 Ga0495660_0086040
705 Ga0495636_0024567
706 Ga0495683_0006778
707 Ga0495687_001413
708 Ga0495687_147922
709 Ga0495677_0030918
710 Ga0495679_013734
711 Ga0495679_028169
712 Ga0495673_0000173
713 Ga0495686_0335218
714 Ga0495686_0700860
715 Ga0495615_0048026
716 Ga0495626_0162890
717 Ga0496114_0001921
718 Ga0496116_0156621
719 Ga0496119_0006641
720 Ga0496120_0000018
721 Ga0496126_0927120
722 Ga0495678_012163
723 Ga0501041_0375299
724 Ga0501042_0238382
725 Ga0501042_0474901
726 Ga0501048_0253502
727 Ga0501069_0556718
728 Ga0501070_0395851
729 Ga0501071_0403439
730 Ga0501071_1409928
731 Ga0501076_1000846
732 Ga0501076_1044368
733 Ga0501044_0486272
734 Ga0501044_1106543
735 nmdc:mga03683_110003_c1
736 nmdc:mga0yw44_272356_c1
737 nmdc:mga0k408_177357_c1
738 nmdc:mga0k408_236494_c1
739 nmdc:mga07m45_105485_c1
740 Ga0500578_0018847
741 Ga0500578_0217507
742 Ga0500644_0058335
743 Ga0500651_0008892
744 Ga0500566_0214699
745 Ga0500650_0206793
746 Ga0500650_0251780
747 Ga0500555_016457
748 Ga0500595_003100
749 Ga0500652_123560
750 Ga0500568_0013147
751 Ga0500577_0234159
752 Ga0500586_020279
753 Ga0500616_0017218
754 Ga0500616_0202964
755 Ga0500622_0064380
756 Ga0500576_231389
757 Ga0500645_003416
758 2643932321
759 2644313572
760 2819541926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

31

77

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

33

76

0.96

PF12840

HTH_20

Helix-turn-helix domain

29

78

0.93

PF17782

DprA_WH

DprA winged helix domain

22

81

0.93

PF12802

MarR_2

MarR family

31

82

0.91

PF09339

HTH_IclR

IclR helix-turn-helix domain

24

79

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9242 2 89
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9124 17 71
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9122 17 71
3cuq-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.9058 17 72
2zme-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.9022 17 72
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.957 14 70 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.95 7 72 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.949 2 82 1.10.10.10
af_P76066_81_136_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9365 19 71 1.10.10.10
2oqgC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9346 2 90 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0P6XVP7-F1-model_v4 ArsR family transcriptional regulator 0.9967 3 81 GO:0003677
GO:0003700
AF-A0A1Z5HTH1-F1-model_v4 ArsR family transcriptional regulator 0.9892 2 87 GO:0003700
AF-X0YLD0-F1-model_v4 HTH arsR-type domain-containing protein 0.9804 3 87 GO:0003700
AF-A0A7W5D2Z2-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.9797 3 87 GO:0003677
GO:0003700
AF-A0A0M3R905-F1-model_v4 ArsR family transcriptional regulator 0.9795 3 85 GO:0003677
GO:0003700

Map