F428790
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 380 | 245 | 760 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0448662|Ga0501034_0448662_309_854 |
| Length | 181 |
| Sequence | LAHHRTKLEACNSTIRNQGFSDMRLALYQPDIAQNTGTILRLGACLGVAVDVIGPTGFDMSDRALKRAALDYLEHVDLTRHASFSDFINSRASGEASQQRGRLVLLSAHAETPHYEFAFDPNDTLMLGRESAGVPEAVHSAADARITIPMRPGLRSLNVAVTAALVLGEALRQTGGFPSGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 111 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 119 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 120 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 121 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 122 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 123 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 125 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 127 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 128 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 129 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 130 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 131 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 132 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 134 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 135 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 142 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 143 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 144 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 145 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 146 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 162 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 163 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 164 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 165 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 166 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 169 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 170 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 171 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 172 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 173 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 174 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 175 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 176 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 207 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 215 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 216 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 217 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 218 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 219 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 220 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 221 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 222 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 223 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 226 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 227 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 228 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 229 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 230 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 231 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 232 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 233 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 234 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 235 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 236 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 237 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 238 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 239 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 240 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 241 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 242 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 243 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 244 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 245 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.74 |
| Metatranscriptomes | 0 |
| Isolates | 5.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.89 |
| Nodule | 4.21 |
| Rhizoplane | 8.16 |
| Rhizosphere | 81.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0448662 | 3300049571 | Bacteria | 1208 |
| 2 | rootH2_10231415 | 3300003320 | Bacteria | 1661 |
| 3 | Ga0070658_10002782 | 3300005327 | Bacteria | 14541 |
| 4 | Ga0070690_100980302 | 3300005330 | Unclassified | 665 |
| 5 | Ga0070670_101124377 | 3300005331 | Bacteria | 717 |
| 6 | Ga0068869_100102669 | 3300005334 | Bacteria | 2165 |
| 7 | Ga0070680_100004299 | 3300005336 | Bacteria | 10709 |
| 8 | Ga0070680_100093883 | 3300005336 | Bacteria | 2486 |
| 9 | Ga0070682_100011285 | 3300005337 | Bacteria | 5101 |
| 10 | Ga0070660_100009522 | 3300005339 | Bacteria | 6837 |
| 11 | Ga0070660_100016681 | 3300005339 | Bacteria | 5338 |
| 12 | Ga0070689_100829813 | 3300005340 | Bacteria | 814 |
| 13 | Ga0070691_10001427 | 3300005341 | Bacteria | 10202 |
| 14 | Ga0070691_10013433 | 3300005341 | Bacteria | 3750 |
| 15 | Ga0070692_10087728 | 3300005345 | Bacteria | 1686 |
| 16 | Ga0070668_101430609 | 3300005347 | Bacteria | 631 |
| 17 | Ga0070669_100234069 | 3300005353 | Bacteria | 1457 |
| 18 | Ga0070669_100424376 | 3300005353 | Bacteria | 1092 |
| 19 | Ga0070659_100297697 | 3300005366 | Bacteria | 1345 |
| 20 | Ga0070667_101049198 | 3300005367 | Bacteria | 761 |
| 21 | Ga0070709_10003240 | 3300005434 | Bacteria | 8732 |
| 22 | Ga0070713_100000016 | 3300005436 | Bacteria | 121229 |
| 23 | Ga0070705_100168598 | 3300005440 | Bacteria | 1471 |
| 24 | Ga0070700_100806971 | 3300005441 | Bacteria | 756 |
| 25 | Ga0070694_100086470 | 3300005444 | Bacteria | 2191 |
| 26 | Ga0070708_100788037 | 3300005445 | Unclassified | 894 |
| 27 | Ga0070663_100002647 | 3300005455 | Bacteria | 10133 |
| 28 | Ga0070663_100079156 | 3300005455 | Bacteria | 2411 |
| 29 | Ga0070663_100160064 | 3300005455 | Bacteria | 1732 |
| 30 | Ga0070663_100458197 | 3300005455 | Bacteria | 1052 |
| 31 | Ga0070678_100112862 | 3300005456 | Bacteria | 2129 |
| 32 | Ga0070662_100383988 | 3300005457 | Bacteria | 1156 |
| 33 | Ga0070681_10052459 | 3300005458 | Bacteria | 4067 |
| 34 | Ga0070681_10347963 | 3300005458 | Unclassified | 1392 |
| 35 | Ga0070679_100070068 | 3300005530 | Bacteria | 3498 |
| 36 | Ga0068853_100002720 | 3300005539 | Bacteria | 13352 |
| 37 | Ga0070686_100188302 | 3300005544 | Bacteria | 1471 |
| 38 | Ga0070696_100033380 | 3300005546 | Bacteria | 3536 |
| 39 | Ga0070693_100003701 | 3300005547 | Bacteria | 7150 |
| 40 | Ga0070693_100376725 | 3300005547 | Bacteria | 978 |
| 41 | Ga0070704_100364439 | 3300005549 | Bacteria | 1223 |
| 42 | Ga0068855_100103514 | 3300005563 | Bacteria | 3275 |
| 43 | Ga0068855_100163698 | 3300005563 | Bacteria | 2523 |
| 44 | Ga0068855_100165320 | 3300005563 | Bacteria | 2509 |
| 45 | Ga0070664_100118383 | 3300005564 | Bacteria | 2317 |
| 46 | Ga0068857_100201951 | 3300005577 | Bacteria | 1812 |
| 47 | Ga0068857_100300303 | 3300005577 | Bacteria | 1480 |
| 48 | Ga0068854_100065020 | 3300005578 | Bacteria | 2651 |
| 49 | Ga0068854_100717150 | 3300005578 | Bacteria | 865 |
| 50 | Ga0068856_100007521 | 3300005614 | Bacteria | 10634 |
| 51 | Ga0068856_100073952 | 3300005614 | Bacteria | 3374 |
| 52 | Ga0068856_101074563 | 3300005614 | Bacteria | 822 |
| 53 | Ga0070702_100040273 | 3300005615 | Bacteria | 2613 |
| 54 | Ga0068852_100328531 | 3300005616 | Bacteria | 1487 |
| 55 | Ga0068852_101148729 | 3300005616 | Bacteria | 797 |
| 56 | Ga0068859_100322702 | 3300005617 | Bacteria | 1638 |
| 57 | Ga0068864_100156578 | 3300005618 | Bacteria | 2068 |
| 58 | Ga0068864_100224835 | 3300005618 | Bacteria | 1733 |
| 59 | Ga0068864_100371254 | 3300005618 | Bacteria | 1354 |
| 60 | Ga0068861_100305921 | 3300005719 | Bacteria | 1379 |
| 61 | Ga0068870_10048816 | 3300005840 | Bacteria | 2230 |
| 62 | Ga0068858_100105313 | 3300005842 | Bacteria | 2632 |
| 63 | Ga0068858_100638513 | 3300005842 | Bacteria | 1034 |
| 64 | Ga0068860_100264857 | 3300005843 | Bacteria | 1676 |
| 65 | Ga0068862_100617501 | 3300005844 | Bacteria | 1043 |
| 66 | Ga0081455_10000291 | 3300005937 | Bacteria | 66446 |
| 67 | Ga0075364_10004906 | 3300006051 | Bacteria | 7753 |
| 68 | Ga0070715_10007631 | 3300006163 | Bacteria | 3732 |
| 69 | Ga0070712_100000617 | 3300006175 | Bacteria | 20907 |
| 70 | Ga0068871_100428861 | 3300006358 | Bacteria | 1182 |
| 71 | Ga0068871_100519851 | 3300006358 | Bacteria | 1075 |
| 72 | Ga0068871_100690083 | 3300006358 | Unclassified | 935 |
| 73 | Ga0075428_101774949 | 3300006844 | Bacteria | 643 |
| 74 | Ga0075430_100042915 | 3300006846 | Bacteria | 3823 |
| 75 | Ga0075430_100415647 | 3300006846 | Bacteria | 1110 |
| 76 | Ga0075431_100040549 | 3300006847 | Bacteria | 4799 |
| 77 | Ga0075433_10025944 | 3300006852 | Bacteria | 4957 |
| 78 | Ga0075433_10124915 | 3300006852 | Bacteria | 2285 |
| 79 | Ga0075434_100000268 | 3300006871 | Bacteria | 37082 |
| 80 | Ga0075434_100144453 | 3300006871 | Bacteria | 2399 |
| 81 | Ga0075434_100601510 | 3300006871 | Unclassified | 1119 |
| 82 | Ga0075429_100016522 | 3300006880 | Bacteria | 6394 |
| 83 | Ga0075436_100000270 | 3300006914 | Bacteria | 32650 |
| 84 | Ga0075436_100158984 | 3300006914 | Bacteria | 1592 |
| 85 | Ga0097620_100322714 | 3300006931 | Bacteria | 1638 |
| 86 | Ga0075435_100051030 | 3300007076 | Bacteria | 3331 |
| 87 | Ga0075435_100237332 | 3300007076 | Bacteria | 1550 |
| 88 | Ga0075435_100317807 | 3300007076 | Bacteria | 1333 |
| 89 | Ga0111539_10012926 | 3300009094 | Bacteria | 10447 |
| 90 | Ga0111539_10217322 | 3300009094 | Bacteria | 2226 |
| 91 | Ga0105245_10514426 | 3300009098 | Bacteria | 1215 |
| 92 | Ga0105247_10908454 | 3300009101 | Bacteria | 681 |
| 93 | Ga0105243_10047568 | 3300009148 | Bacteria | 3378 |
| 94 | Ga0105241_10031831 | 3300009174 | Bacteria | 3950 |
| 95 | Ga0105241_10245506 | 3300009174 | Unclassified | 1515 |
| 96 | Ga0105241_10511104 | 3300009174 | Bacteria | 1073 |
| 97 | Ga0105242_10258217 | 3300009176 | Bacteria | 1573 |
| 98 | Ga0105237_10013621 | 3300009545 | Bacteria | 8517 |
| 99 | Ga0105238_10023535 | 3300009551 | Bacteria | 6276 |
| 100 | Ga0105238_10039520 | 3300009551 | Bacteria | 4785 |
| 101 | Ga0105249_11102848 | 3300009553 | Bacteria | 864 |
| 102 | Ga0099796_10035990 | 3300010159 | Bacteria | 1646 |
| 103 | Ga0105239_10659730 | 3300010375 | Bacteria | 1195 |
| 104 | Ga0105239_10861518 | 3300010375 | Bacteria | 1039 |
| 105 | Ga0105239_12676535 | 3300010375 | Unclassified | 582 |
| 106 | Ga0105246_10016784 | 3300011119 | Bacteria | 4643 |
| 107 | Ga0157373_10040551 | 3300013100 | Bacteria | 3331 |
| 108 | Ga0157373_10699154 | 3300013100 | Bacteria | 743 |
| 109 | Ga0157370_10169150 | 3300013104 | Bacteria | 2032 |
| 110 | Ga0157370_10217255 | 3300013104 | Bacteria | 1771 |
| 111 | Ga0157372_10029169 | 3300013307 | Bacteria | 6022 |
| 112 | Ga0157372_11569286 | 3300013307 | Bacteria | 758 |
| 113 | Ga0157375_10131847 | 3300013308 | Bacteria | 2619 |
| 114 | Ga0157379_10183266 | 3300014968 | Bacteria | 1891 |
| 115 | Ga0157379_10189538 | 3300014968 | Bacteria | 1858 |
| 116 | Ga0157379_10896749 | 3300014968 | Bacteria | 841 |
| 117 | Ga0157379_11474644 | 3300014968 | Unclassified | 661 |
| 118 | Ga0157376_10521851 | 3300014969 | Bacteria | 1171 |
| 119 | Ga0163161_10081488 | 3300017792 | Bacteria | 2383 |
| 120 | Ga0207692_10059080 | 3300025898 | Bacteria | 1979 |
| 121 | Ga0207647_10034380 | 3300025904 | Bacteria | 3236 |
| 122 | Ga0207699_10000295 | 3300025906 | Bacteria | 26738 |
| 123 | Ga0207643_10385251 | 3300025908 | Bacteria | 884 |
| 124 | Ga0207705_10000158 | 3300025909 | Bacteria | 73213 |
| 125 | Ga0207654_10016546 | 3300025911 | Bacteria | 3842 |
| 126 | Ga0207707_10018654 | 3300025912 | Bacteria | 6049 |
| 127 | Ga0207671_10052518 | 3300025914 | Bacteria | 3020 |
| 128 | Ga0207693_10008961 | 3300025915 | Bacteria | 8164 |
| 129 | Ga0207660_10002303 | 3300025917 | Bacteria | 12578 |
| 130 | Ga0207657_10000813 | 3300025919 | Bacteria | 32997 |
| 131 | Ga0207657_10031208 | 3300025919 | Bacteria | 4829 |
| 132 | Ga0207694_10048462 | 3300025924 | Bacteria | 3287 |
| 133 | Ga0207694_10080669 | 3300025924 | Bacteria | 2554 |
| 134 | Ga0207700_10000005 | 3300025928 | Bacteria | 394836 |
| 135 | Ga0207670_10592571 | 3300025936 | Bacteria | 909 |
| 136 | Ga0207704_10845224 | 3300025938 | Bacteria | 767 |
| 137 | Ga0207689_10229822 | 3300025942 | Bacteria | 1533 |
| 138 | Ga0207679_10324857 | 3300025945 | Bacteria | 1333 |
| 139 | Ga0207667_10020575 | 3300025949 | Bacteria | 7333 |
| 140 | Ga0207667_10122040 | 3300025949 | Bacteria | 2685 |
| 141 | Ga0207667_10223881 | 3300025949 | Bacteria | 1927 |
| 142 | Ga0207640_10114808 | 3300025981 | Bacteria | 1917 |
| 143 | Ga0207640_10935172 | 3300025981 | Bacteria | 759 |
| 144 | Ga0207658_10445423 | 3300025986 | Bacteria | 1146 |
| 145 | Ga0207703_10205984 | 3300026035 | Bacteria | 1751 |
| 146 | Ga0207703_10666412 | 3300026035 | Bacteria | 988 |
| 147 | Ga0207639_10002122 | 3300026041 | Bacteria | 13359 |
| 148 | Ga0207639_10040205 | 3300026041 | Bacteria | 3489 |
| 149 | Ga0207678_10000647 | 3300026067 | Bacteria | 32061 |
| 150 | Ga0207678_10056727 | 3300026067 | Bacteria | 3372 |
| 151 | Ga0207678_10100836 | 3300026067 | Bacteria | 2466 |
| 152 | Ga0207678_10462080 | 3300026067 | Bacteria | 1104 |
| 153 | Ga0207708_10877890 | 3300026075 | Bacteria | 775 |
| 154 | Ga0207702_10000102 | 3300026078 | Bacteria | 99313 |
| 155 | Ga0207648_10783605 | 3300026089 | Bacteria | 887 |
| 156 | Ga0207676_10223295 | 3300026095 | Bacteria | 1679 |
| 157 | Ga0207676_11376913 | 3300026095 | Bacteria | 701 |
| 158 | Ga0207674_10163255 | 3300026116 | Bacteria | 2182 |
| 159 | Ga0207683_10114165 | 3300026121 | Bacteria | 2420 |
| 160 | Ga0207698_10247490 | 3300026142 | Bacteria | 1629 |
| 161 | Ga0207428_10039217 | 3300027907 | Bacteria | 3845 |
| 162 | Ga0207428_10066860 | 3300027907 | Bacteria | 2831 |
| 163 | Ga0268265_10321327 | 3300028380 | Bacteria | 1402 |
| 164 | Ga0268264_10492341 | 3300028381 | Bacteria | 1194 |
| 165 | Ga0265328_10030234 | 3300031239 | Bacteria | 2019 |
| 166 | Ga0265331_10000007 | 3300031250 | Bacteria | 331074 |
| 167 | Ga0265327_10123884 | 3300031251 | Bacteria | 1222 |
| 168 | Ga0307408_101097818 | 3300031548 | Bacteria | 738 |
| 169 | Ga0265314_10013579 | 3300031711 | Bacteria | 6571 |
| 170 | Ga0307415_100922096 | 3300032126 | Unclassified | 807 |
| 171 | Ga0373928_0013193 | 3300035084 | Bacteria | 1657 |
| 172 | Ga0373929_0130378 | 3300035085 | Bacteria | 659 |
| 173 | Ga0373949_0047922 | 3300035090 | Bacteria | 1069 |
| 174 | Ga0373951_0025948 | 3300035091 | Bacteria | 1363 |
| 175 | Ga0373932_0039919 | 3300035112 | Bacteria | 1348 |
| 176 | Ga0373932_0150356 | 3300035112 | Bacteria | 798 |
| 177 | Ga0373932_0368535 | 3300035112 | Bacteria | 550 |
| 178 | Ga0373939_0022774 | 3300035114 | Bacteria | 1729 |
| 179 | Ga0373941_0032472 | 3300035115 | Bacteria | 1563 |
| 180 | Ga0373941_0165329 | 3300035115 | Bacteria | 821 |
| 181 | Ga0373956_0459150 | 3300035119 | Bacteria | 608 |
| 182 | Ga0373957_0024295 | 3300035120 | Bacteria | 2176 |
| 183 | Ga0373960_0131207 | 3300035121 | Bacteria | 840 |
| 184 | Ga0373955_0417865 | 3300035172 | Unclassified | 816 |
| 185 | Ga0373962_0082670 | 3300035242 | Bacteria | 977 |
| 186 | Ga0373924_0080251 | 3300035410 | Bacteria | 1387 |
| 187 | Ga0373931_0007893 | 3300035691 | Bacteria | 5033 |
| 188 | Ga0373931_0036076 | 3300035691 | Bacteria | 2575 |
| 189 | Ga0373931_0497734 | 3300035691 | Bacteria | 786 |
| 190 | Ga0373935_0112415 | 3300035692 | Bacteria | 1809 |
| 191 | Ga0373933_0011395 | 3300035724 | Bacteria | 4898 |
| 192 | Ga0373933_0083236 | 3300035724 | Bacteria | 1965 |
| 193 | Ga0373937_0285663 | 3300036401 | Bacteria | 1558 |
| 194 | Ga0373925_0523509 | 3300037068 | Bacteria | 974 |
| 195 | Ga0395899_0205918 | 3300037312 | Bacteria | 1369 |
| 196 | Ga0395899_0601668 | 3300037312 | Unclassified | 700 |
| 197 | Ga0395898_0525499 | 3300037466 | Bacteria | 1125 |
| 198 | Ga0436364_0183465 | 3300037853 | Bacteria | 1055 |
| 199 | Ga0395901_0621620 | 3300038443 | Unclassified | 1087 |
| 200 | Ga0400490_17418 | 3300038726 | Bacteria | 1905 |
| 201 | Ga0400485_03793 | 3300038735 | Unclassified | 1167 |
| 202 | Ga0400485_12104 | 3300038735 | Bacteria | 2407 |
| 203 | Ga0400486_23404 | 3300038742 | Unclassified | 3088 |
| 204 | Ga0436365_0608492 | 3300039437 | Bacteria | 1403 |
| 205 | Ga0439448_0168040 | 3300042005 | Bacteria | 765 |
| 206 | Ga0495603_0577191 | 3300046455 | Bacteria | 644 |
| 207 | Ga0495638_0155924 | 3300046460 | Bacteria | 1321 |
| 208 | Ga0495638_0203355 | 3300046460 | Bacteria | 1117 |
| 209 | Ga0495664_0452335 | 3300046477 | Unclassified | 769 |
| 210 | Ga0495585_0088201 | 3300046492 | Bacteria | 1673 |
| 211 | Ga0495620_0124963 | 3300046515 | Bacteria | 1012 |
| 212 | Ga0495648_0192592 | 3300046524 | Bacteria | 1027 |
| 213 | Ga0495633_0360056 | 3300046558 | Bacteria | 659 |
| 214 | Ga0495667_0482407 | 3300046559 | Unclassified | 777 |
| 215 | Ga0495588_0215559 | 3300046674 | Bacteria | 1013 |
| 216 | Ga0495623_0083288 | 3300046679 | Bacteria | 1976 |
| 217 | Ga0495672_0062037 | 3300047320 | Bacteria | 2152 |
| 218 | Ga0495672_0080468 | 3300047320 | Bacteria | 1817 |
| 219 | Ga0495672_0181398 | 3300047320 | Bacteria | 1066 |
| 220 | Ga0495680_0508564 | 3300047322 | Unclassified | 817 |
| 221 | Ga0496100_0230599 | 3300048903 | Bacteria | 1362 |
| 222 | Ga0496101_0050800 | 3300048904 | Bacteria | 2986 |
| 223 | Ga0496101_0075560 | 3300048904 | Bacteria | 2480 |
| 224 | Ga0496102_0024970 | 3300048905 | Bacteria | 5316 |
| 225 | Ga0496102_0099845 | 3300048905 | Bacteria | 2695 |
| 226 | Ga0496102_0194314 | 3300048905 | Bacteria | 1912 |
| 227 | Ga0496102_0466056 | 3300048905 | Bacteria | 1184 |
| 228 | Ga0496103_0006658 | 3300048906 | Bacteria | 6896 |
| 229 | Ga0496103_0454912 | 3300048906 | Bacteria | 821 |
| 230 | Ga0496104_0003196 | 3300048907 | Bacteria | 14081 |
| 231 | Ga0496104_0077271 | 3300048907 | Bacteria | 3172 |
| 232 | Ga0496105_0153120 | 3300048908 | Bacteria | 1895 |
| 233 | Ga0496105_0165888 | 3300048908 | Bacteria | 1812 |
| 234 | Ga0496105_0198189 | 3300048908 | Bacteria | 1639 |
| 235 | Ga0496106_0005631 | 3300048909 | Bacteria | 9269 |
| 236 | Ga0496106_0029256 | 3300048909 | Bacteria | 4105 |
| 237 | Ga0496106_0128750 | 3300048909 | Bacteria | 1984 |
| 238 | Ga0496106_0149558 | 3300048909 | Bacteria | 1841 |
| 239 | Ga0496107_0013254 | 3300048910 | Bacteria | 5761 |
| 240 | Ga0496108_0695780 | 3300048911 | Bacteria | 882 |
| 241 | Ga0496109_0061066 | 3300048912 | Bacteria | 3445 |
| 242 | Ga0496110_0256030 | 3300048913 | Bacteria | 1593 |
| 243 | Ga0496111_0389011 | 3300048914 | Bacteria | 1031 |
| 244 | Ga0496112_0088145 | 3300048915 | Bacteria | 3071 |
| 245 | Ga0496113_0023402 | 3300048916 | Bacteria | 4380 |
| 246 | Ga0496113_0108009 | 3300048916 | Bacteria | 2163 |
| 247 | Ga0496114_0051168 | 3300048917 | Bacteria | 3439 |
| 248 | Ga0496114_0547552 | 3300048917 | Bacteria | 1022 |
| 249 | Ga0496114_0661597 | 3300048917 | Bacteria | 918 |
| 250 | Ga0496115_0004881 | 3300048918 | Bacteria | 9736 |
| 251 | Ga0496115_0017012 | 3300048918 | Bacteria | 5547 |
| 252 | Ga0496116_0049903 | 3300048919 | Bacteria | 2793 |
| 253 | Ga0496121_0005812 | 3300048924 | Bacteria | 15639 |
| 254 | Ga0496121_0525414 | 3300048924 | Bacteria | 746 |
| 255 | Ga0501031_0011496 | 3300049568 | Bacteria | 5770 |
| 256 | Ga0501032_0003478 | 3300049569 | Bacteria | 12055 |
| 257 | Ga0501032_0189744 | 3300049569 | Bacteria | 1343 |
| 258 | Ga0501032_0564143 | 3300049569 | Viruses | 725 |
| 259 | Ga0501033_0115769 | 3300049570 | Bacteria | 1948 |
| 260 | Ga0501033_1021553 | 3300049570 | Bacteria | 552 |
| 261 | Ga0501034_0000031 | 3300049571 | Bacteria | 244022 |
| 262 | Ga0501034_0065711 | 3300049571 | Bacteria | 3640 |
| 263 | Ga0501034_0917226 | 3300049571 | Bacteria | 763 |
| 264 | Ga0501036_0342071 | 3300049572 | Unclassified | 1249 |
| 265 | Ga0501036_0503526 | 3300049572 | Bacteria | 1008 |
| 266 | Ga0501037_0019123 | 3300049573 | Bacteria | 5050 |
| 267 | Ga0501037_0095429 | 3300049573 | Bacteria | 2150 |
| 268 | Ga0501038_0087372 | 3300049574 | Bacteria | 2618 |
| 269 | Ga0501038_0101961 | 3300049574 | Bacteria | 2389 |
| 270 | Ga0501038_0533177 | 3300049574 | Bacteria | 895 |
| 271 | Ga0501039_0008937 | 3300049575 | Bacteria | 7634 |
| 272 | Ga0501039_0172741 | 3300049575 | Bacteria | 1699 |
| 273 | Ga0501040_0144712 | 3300049576 | Bacteria | 1675 |
| 274 | Ga0501040_0260709 | 3300049576 | Bacteria | 1237 |
| 275 | Ga0501041_0092595 | 3300049577 | Bacteria | 1866 |
| 276 | Ga0501043_0020025 | 3300049579 | Bacteria | 5250 |
| 277 | Ga0501043_0578917 | 3300049579 | Unclassified | 831 |
| 278 | Ga0501046_0005738 | 3300049580 | Bacteria | 11079 |
| 279 | Ga0501046_0011152 | 3300049580 | Bacteria | 7698 |
| 280 | Ga0501046_0055637 | 3300049580 | Bacteria | 3108 |
| 281 | Ga0501047_0002152 | 3300049581 | Bacteria | 18843 |
| 282 | Ga0501047_0070961 | 3300049581 | Bacteria | 3353 |
| 283 | Ga0501047_0103763 | 3300049581 | Bacteria | 2724 |
| 284 | Ga0501047_0104918 | 3300049581 | Bacteria | 2707 |
| 285 | Ga0501047_0161983 | 3300049581 | Bacteria | 2109 |
| 286 | Ga0501048_0005689 | 3300049582 | Bacteria | 9478 |
| 287 | Ga0501067_0001011 | 3300049583 | Bacteria | 15105 |
| 288 | Ga0501067_0007817 | 3300049583 | Bacteria | 5947 |
| 289 | Ga0501067_0211124 | 3300049583 | Bacteria | 1081 |
| 290 | Ga0501068_0712793 | 3300049584 | Bacteria | 656 |
| 291 | Ga0501070_0000345 | 3300049586 | Bacteria | 42150 |
| 292 | Ga0501070_0017149 | 3300049586 | Bacteria | 6078 |
| 293 | Ga0501070_0079269 | 3300049586 | Bacteria | 2718 |
| 294 | Ga0501070_0155049 | 3300049586 | Bacteria | 1889 |
| 295 | Ga0501070_0711352 | 3300049586 | Bacteria | 794 |
| 296 | Ga0501070_0750887 | 3300049586 | Bacteria | 769 |
| 297 | Ga0501071_0045748 | 3300049587 | Bacteria | 3142 |
| 298 | Ga0501071_1341524 | 3300049587 | Unclassified | 552 |
| 299 | Ga0501072_0096766 | 3300049588 | Bacteria | 2346 |
| 300 | Ga0501073_0022223 | 3300049589 | Bacteria | 4571 |
| 301 | Ga0501073_0253691 | 3300049589 | Bacteria | 1214 |
| 302 | Ga0501074_0778718 | 3300049590 | Bacteria | 674 |
| 303 | Ga0501075_0413985 | 3300049591 | Bacteria | 1028 |
| 304 | Ga0501076_0025076 | 3300049592 | Bacteria | 4612 |
| 305 | Ga0501077_0047649 | 3300049593 | Bacteria | 2723 |
| 306 | Ga0501079_0002885 | 3300049741 | Bacteria | 12552 |
| 307 | Ga0501079_0462076 | 3300049741 | Bacteria | 997 |
| 308 | Ga0501079_1055569 | 3300049741 | Unclassified | 640 |
| 309 | Ga0501080_0000629 | 3300049742 | Bacteria | 27961 |
| 310 | Ga0501080_0001220 | 3300049742 | Bacteria | 21353 |
| 311 | Ga0501080_0004144 | 3300049742 | Bacteria | 12855 |
| 312 | Ga0501080_0574025 | 3300049742 | Bacteria | 1003 |
| 313 | Ga0501081_0181008 | 3300049743 | Bacteria | 1524 |
| 314 | Ga0501081_0228480 | 3300049743 | Bacteria | 1355 |
| 315 | Ga0501083_0043049 | 3300049744 | Bacteria | 3060 |
| 316 | Ga0501035_0000054 | 3300049822 | Bacteria | 142023 |
| 317 | Ga0501035_0003869 | 3300049822 | Bacteria | 14283 |
| 318 | Ga0501035_0168720 | 3300049822 | Bacteria | 1892 |
| 319 | Ga0501044_0000013 | 3300049823 | Bacteria | 248795 |
| 320 | Ga0501044_0002940 | 3300049823 | Bacteria | 19377 |
| 321 | Ga0501044_0013916 | 3300049823 | Bacteria | 8694 |
| 322 | Ga0501044_0038410 | 3300049823 | Bacteria | 4999 |
| 323 | Ga0501044_0167281 | 3300049823 | Bacteria | 2172 |
| 324 | Ga0501044_0206724 | 3300049823 | Bacteria | 1919 |
| 325 | Ga0501044_0701780 | 3300049823 | Viruses | 897 |
| 326 | Ga0501045_0056000 | 3300049824 | Bacteria | 2884 |
| 327 | Ga0501045_0165882 | 3300049824 | Bacteria | 1645 |
| 328 | nmdc:mga00v17_33338_c1 | 3300050491 | Bacteria | 3051 |
| 329 | nmdc:mga0qj67_392181_c1 | 3300050509 | Bacteria | 1121 |
| 330 | nmdc:mga06r32_2657_c1 | 3300050510 | Bacteria | 15975 |
| 331 | nmdc:mga06r32_360503_c1 | 3300050510 | Bacteria | 1438 |
| 332 | nmdc:mga06r32_537619_c1 | 3300050510 | Bacteria | 1143 |
| 333 | nmdc:mga08y16_11215_c1 | 3300050511 | Bacteria | 9415 |
| 334 | nmdc:mga08y16_75011_c1 | 3300050511 | Bacteria | 3526 |
| 335 | nmdc:mga08y16_751378_c1 | 3300050511 | Bacteria | 971 |
| 336 | nmdc:mga0n895_2979_c1 | 3300050512 | Bacteria | 13434 |
| 337 | nmdc:mga0n895_304706_c1 | 3300050512 | Bacteria | 1615 |
| 338 | nmdc:mga0rr50_113977_c1 | 3300050513 | Bacteria | 2143 |
| 339 | nmdc:mga0rr50_281497_c1 | 3300050513 | Bacteria | 1388 |
| 340 | nmdc:mga08x19_160_c1 | 3300050514 | Bacteria | 55694 |
| 341 | nmdc:mga08x19_523953_c1 | 3300050514 | Unclassified | 838 |
| 342 | nmdc:mga0a205_2843_c1 | 3300050515 | Bacteria | 15314 |
| 343 | nmdc:mga0a205_607670_c1 | 3300050515 | Bacteria | 946 |
| 344 | Ga0500643_000017 | 3300053087 | Bacteria | 305781 |
| 345 | Ga0500646_0118325 | 3300053090 | Unclassified | 849 |
| 346 | Ga0500592_005594 | 3300053116 | Bacteria | 2002 |
| 347 | Ga0500595_023575 | 3300053119 | Bacteria | 2161 |
| 348 | Ga0500568_0031810 | 3300053139 | Bacteria | 2174 |
| 349 | Ga0500616_0009556 | 3300053153 | Bacteria | 5892 |
| 350 | Ga0500611_053402 | 3300053727 | Bacteria | 933 |
| 351 | Ga0500625_044720 | 3300053729 | Bacteria | 2070 |
| 352 | Ga0500645_039041 | 3300053730 | Bacteria | 1408 |
| 353 | Ga0501084_0001539 | 3300054114 | Bacteria | 18342 |
| 354 | Ga0501084_0182835 | 3300054114 | Bacteria | 1770 |
| 355 | Ga0501084_1013262 | 3300054114 | Bacteria | 698 |
| 356 | Ga0501082_0175519 | 3300060353 | Bacteria | 1863 |
| 357 | Ga0501082_0185568 | 3300060353 | Bacteria | 1810 |
| 358 | Ga0501082_0749398 | 3300060353 | Unclassified | 855 |
| 359 | Ga0501082_0940064 | 3300060353 | Bacteria | 756 |
| 360 | Ga0530510_0032160 | 3300061734 | Bacteria | 3773 |
| 361 | 2523470751 | 2523231067 | Bacteria | 5230452 |
| 362 | 2524611195 | 2524023250 | Bacteria | 5457705 |
| 363 | 2739349072 | 2738543031 | Bacteria | 5769731 |
| 364 | 2935683354 | 2935675223 | Bacteria | 9928132 |
| 365 | 2935771052 | 2935769743 | Bacteria | 7878163 |
| 366 | 2935781220 | 2935777560 | Bacteria | 8077691 |
| 367 | 2935786247 | 2935785616 | Bacteria | 7962367 |
| 368 | 2935793956 | 2935793552 | Bacteria | 8012592 |
| 369 | 2941531676 | 2941531003 | Bacteria | 7653939 |
| 370 | 8016528027 | 8016522445 | Bacteria | 8156687 |
| 371 | 8016533151 | 8016530956 | Bacteria | 8155261 |
| 372 | 8016555736 | 8016548790 | Bacteria | 8155074 |
| 373 | 8016564089 | 8016557553 | Bacteria | 8154380 |
| 374 | 8016571471 | 8016566248 | Bacteria | 8158151 |
| 375 | 8016575726 | 8016575299 | Bacteria | 8154085 |
| 376 | 8016601795 | 8016595262 | Bacteria | 8149947 |
| 377 | 8016608454 | 8016603502 | Bacteria | 8731218 |
| 378 | 8016616412 | 8016613128 | Bacteria | 8794220 |
| 379 | 8019532948 | 8019530166 | Bacteria | 8155624 |
| 380 | 8045864485 | 8045864390 | Bacteria | 5043873 |
| 381 | Ga0501034_0448662 | |||
| 382 | rootH2_10231415 | |||
| 383 | Ga0070658_10002782 | |||
| 384 | Ga0070690_100980302 | |||
| 385 | Ga0070670_101124377 | |||
| 386 | Ga0068869_100102669 | |||
| 387 | Ga0070680_100004299 | |||
| 388 | Ga0070680_100093883 | |||
| 389 | Ga0070682_100011285 | |||
| 390 | Ga0070660_100009522 | |||
| 391 | Ga0070660_100016681 | |||
| 392 | Ga0070689_100829813 | |||
| 393 | Ga0070691_10001427 | |||
| 394 | Ga0070691_10013433 | |||
| 395 | Ga0070692_10087728 | |||
| 396 | Ga0070668_101430609 | |||
| 397 | Ga0070669_100234069 | |||
| 398 | Ga0070669_100424376 | |||
| 399 | Ga0070659_100297697 | |||
| 400 | Ga0070667_101049198 | |||
| 401 | Ga0070709_10003240 | |||
| 402 | Ga0070713_100000016 | |||
| 403 | Ga0070705_100168598 | |||
| 404 | Ga0070700_100806971 | |||
| 405 | Ga0070694_100086470 | |||
| 406 | Ga0070708_100788037 | |||
| 407 | Ga0070663_100002647 | |||
| 408 | Ga0070663_100079156 | |||
| 409 | Ga0070663_100160064 | |||
| 410 | Ga0070663_100458197 | |||
| 411 | Ga0070678_100112862 | |||
| 412 | Ga0070662_100383988 | |||
| 413 | Ga0070681_10052459 | |||
| 414 | Ga0070681_10347963 | |||
| 415 | Ga0070679_100070068 | |||
| 416 | Ga0068853_100002720 | |||
| 417 | Ga0070686_100188302 | |||
| 418 | Ga0070696_100033380 | |||
| 419 | Ga0070693_100003701 | |||
| 420 | Ga0070693_100376725 | |||
| 421 | Ga0070704_100364439 | |||
| 422 | Ga0068855_100103514 | |||
| 423 | Ga0068855_100163698 | |||
| 424 | Ga0068855_100165320 | |||
| 425 | Ga0070664_100118383 | |||
| 426 | Ga0068857_100201951 | |||
| 427 | Ga0068857_100300303 | |||
| 428 | Ga0068854_100065020 | |||
| 429 | Ga0068854_100717150 | |||
| 430 | Ga0068856_100007521 | |||
| 431 | Ga0068856_100073952 | |||
| 432 | Ga0068856_101074563 | |||
| 433 | Ga0070702_100040273 | |||
| 434 | Ga0068852_100328531 | |||
| 435 | Ga0068852_101148729 | |||
| 436 | Ga0068859_100322702 | |||
| 437 | Ga0068864_100156578 | |||
| 438 | Ga0068864_100224835 | |||
| 439 | Ga0068864_100371254 | |||
| 440 | Ga0068861_100305921 | |||
| 441 | Ga0068870_10048816 | |||
| 442 | Ga0068858_100105313 | |||
| 443 | Ga0068858_100638513 | |||
| 444 | Ga0068860_100264857 | |||
| 445 | Ga0068862_100617501 | |||
| 446 | Ga0081455_10000291 | |||
| 447 | Ga0075364_10004906 | |||
| 448 | Ga0070715_10007631 | |||
| 449 | Ga0070712_100000617 | |||
| 450 | Ga0068871_100428861 | |||
| 451 | Ga0068871_100519851 | |||
| 452 | Ga0068871_100690083 | |||
| 453 | Ga0075428_101774949 | |||
| 454 | Ga0075430_100042915 | |||
| 455 | Ga0075430_100415647 | |||
| 456 | Ga0075431_100040549 | |||
| 457 | Ga0075433_10025944 | |||
| 458 | Ga0075433_10124915 | |||
| 459 | Ga0075434_100000268 | |||
| 460 | Ga0075434_100144453 | |||
| 461 | Ga0075434_100601510 | |||
| 462 | Ga0075429_100016522 | |||
| 463 | Ga0075436_100000270 | |||
| 464 | Ga0075436_100158984 | |||
| 465 | Ga0097620_100322714 | |||
| 466 | Ga0075435_100051030 | |||
| 467 | Ga0075435_100237332 | |||
| 468 | Ga0075435_100317807 | |||
| 469 | Ga0111539_10012926 | |||
| 470 | Ga0111539_10217322 | |||
| 471 | Ga0105245_10514426 | |||
| 472 | Ga0105247_10908454 | |||
| 473 | Ga0105243_10047568 | |||
| 474 | Ga0105241_10031831 | |||
| 475 | Ga0105241_10245506 | |||
| 476 | Ga0105241_10511104 | |||
| 477 | Ga0105242_10258217 | |||
| 478 | Ga0105237_10013621 | |||
| 479 | Ga0105238_10023535 | |||
| 480 | Ga0105238_10039520 | |||
| 481 | Ga0105249_11102848 | |||
| 482 | Ga0099796_10035990 | |||
| 483 | Ga0105239_10659730 | |||
| 484 | Ga0105239_10861518 | |||
| 485 | Ga0105239_12676535 | |||
| 486 | Ga0105246_10016784 | |||
| 487 | Ga0157373_10040551 | |||
| 488 | Ga0157373_10699154 | |||
| 489 | Ga0157370_10169150 | |||
| 490 | Ga0157370_10217255 | |||
| 491 | Ga0157372_10029169 | |||
| 492 | Ga0157372_11569286 | |||
| 493 | Ga0157375_10131847 | |||
| 494 | Ga0157379_10183266 | |||
| 495 | Ga0157379_10189538 | |||
| 496 | Ga0157379_10896749 | |||
| 497 | Ga0157379_11474644 | |||
| 498 | Ga0157376_10521851 | |||
| 499 | Ga0163161_10081488 | |||
| 500 | Ga0207692_10059080 | |||
| 501 | Ga0207647_10034380 | |||
| 502 | Ga0207699_10000295 | |||
| 503 | Ga0207643_10385251 | |||
| 504 | Ga0207705_10000158 | |||
| 505 | Ga0207654_10016546 | |||
| 506 | Ga0207707_10018654 | |||
| 507 | Ga0207671_10052518 | |||
| 508 | Ga0207693_10008961 | |||
| 509 | Ga0207660_10002303 | |||
| 510 | Ga0207657_10000813 | |||
| 511 | Ga0207657_10031208 | |||
| 512 | Ga0207694_10048462 | |||
| 513 | Ga0207694_10080669 | |||
| 514 | Ga0207700_10000005 | |||
| 515 | Ga0207670_10592571 | |||
| 516 | Ga0207704_10845224 | |||
| 517 | Ga0207689_10229822 | |||
| 518 | Ga0207679_10324857 | |||
| 519 | Ga0207667_10020575 | |||
| 520 | Ga0207667_10122040 | |||
| 521 | Ga0207667_10223881 | |||
| 522 | Ga0207640_10114808 | |||
| 523 | Ga0207640_10935172 | |||
| 524 | Ga0207658_10445423 | |||
| 525 | Ga0207703_10205984 | |||
| 526 | Ga0207703_10666412 | |||
| 527 | Ga0207639_10002122 | |||
| 528 | Ga0207639_10040205 | |||
| 529 | Ga0207678_10000647 | |||
| 530 | Ga0207678_10056727 | |||
| 531 | Ga0207678_10100836 | |||
| 532 | Ga0207678_10462080 | |||
| 533 | Ga0207708_10877890 | |||
| 534 | Ga0207702_10000102 | |||
| 535 | Ga0207648_10783605 | |||
| 536 | Ga0207676_10223295 | |||
| 537 | Ga0207676_11376913 | |||
| 538 | Ga0207674_10163255 | |||
| 539 | Ga0207683_10114165 | |||
| 540 | Ga0207698_10247490 | |||
| 541 | Ga0207428_10039217 | |||
| 542 | Ga0207428_10066860 | |||
| 543 | Ga0268265_10321327 | |||
| 544 | Ga0268264_10492341 | |||
| 545 | Ga0265328_10030234 | |||
| 546 | Ga0265331_10000007 | |||
| 547 | Ga0265327_10123884 | |||
| 548 | Ga0307408_101097818 | |||
| 549 | Ga0265314_10013579 | |||
| 550 | Ga0307415_100922096 | |||
| 551 | Ga0373928_0013193 | |||
| 552 | Ga0373929_0130378 | |||
| 553 | Ga0373949_0047922 | |||
| 554 | Ga0373951_0025948 | |||
| 555 | Ga0373932_0039919 | |||
| 556 | Ga0373932_0150356 | |||
| 557 | Ga0373932_0368535 | |||
| 558 | Ga0373939_0022774 | |||
| 559 | Ga0373941_0032472 | |||
| 560 | Ga0373941_0165329 | |||
| 561 | Ga0373956_0459150 | |||
| 562 | Ga0373957_0024295 | |||
| 563 | Ga0373960_0131207 | |||
| 564 | Ga0373955_0417865 | |||
| 565 | Ga0373962_0082670 | |||
| 566 | Ga0373924_0080251 | |||
| 567 | Ga0373931_0007893 | |||
| 568 | Ga0373931_0036076 | |||
| 569 | Ga0373931_0497734 | |||
| 570 | Ga0373935_0112415 | |||
| 571 | Ga0373933_0011395 | |||
| 572 | Ga0373933_0083236 | |||
| 573 | Ga0373937_0285663 | |||
| 574 | Ga0373925_0523509 | |||
| 575 | Ga0395899_0205918 | |||
| 576 | Ga0395899_0601668 | |||
| 577 | Ga0395898_0525499 | |||
| 578 | Ga0436364_0183465 | |||
| 579 | Ga0395901_0621620 | |||
| 580 | Ga0400490_17418 | |||
| 581 | Ga0400485_03793 | |||
| 582 | Ga0400485_12104 | |||
| 583 | Ga0400486_23404 | |||
| 584 | Ga0436365_0608492 | |||
| 585 | Ga0439448_0168040 | |||
| 586 | Ga0495603_0577191 | |||
| 587 | Ga0495638_0155924 | |||
| 588 | Ga0495638_0203355 | |||
| 589 | Ga0495664_0452335 | |||
| 590 | Ga0495585_0088201 | |||
| 591 | Ga0495620_0124963 | |||
| 592 | Ga0495648_0192592 | |||
| 593 | Ga0495633_0360056 | |||
| 594 | Ga0495667_0482407 | |||
| 595 | Ga0495588_0215559 | |||
| 596 | Ga0495623_0083288 | |||
| 597 | Ga0495672_0062037 | |||
| 598 | Ga0495672_0080468 | |||
| 599 | Ga0495672_0181398 | |||
| 600 | Ga0495680_0508564 | |||
| 601 | Ga0496100_0230599 | |||
| 602 | Ga0496101_0050800 | |||
| 603 | Ga0496101_0075560 | |||
| 604 | Ga0496102_0024970 | |||
| 605 | Ga0496102_0099845 | |||
| 606 | Ga0496102_0194314 | |||
| 607 | Ga0496102_0466056 | |||
| 608 | Ga0496103_0006658 | |||
| 609 | Ga0496103_0454912 | |||
| 610 | Ga0496104_0003196 | |||
| 611 | Ga0496104_0077271 | |||
| 612 | Ga0496105_0153120 | |||
| 613 | Ga0496105_0165888 | |||
| 614 | Ga0496105_0198189 | |||
| 615 | Ga0496106_0005631 | |||
| 616 | Ga0496106_0029256 | |||
| 617 | Ga0496106_0128750 | |||
| 618 | Ga0496106_0149558 | |||
| 619 | Ga0496107_0013254 | |||
| 620 | Ga0496108_0695780 | |||
| 621 | Ga0496109_0061066 | |||
| 622 | Ga0496110_0256030 | |||
| 623 | Ga0496111_0389011 | |||
| 624 | Ga0496112_0088145 | |||
| 625 | Ga0496113_0023402 | |||
| 626 | Ga0496113_0108009 | |||
| 627 | Ga0496114_0051168 | |||
| 628 | Ga0496114_0547552 | |||
| 629 | Ga0496114_0661597 | |||
| 630 | Ga0496115_0004881 | |||
| 631 | Ga0496115_0017012 | |||
| 632 | Ga0496116_0049903 | |||
| 633 | Ga0496121_0005812 | |||
| 634 | Ga0496121_0525414 | |||
| 635 | Ga0501031_0011496 | |||
| 636 | Ga0501032_0003478 | |||
| 637 | Ga0501032_0189744 | |||
| 638 | Ga0501032_0564143 | |||
| 639 | Ga0501033_0115769 | |||
| 640 | Ga0501033_1021553 | |||
| 641 | Ga0501034_0000031 | |||
| 642 | Ga0501034_0065711 | |||
| 643 | Ga0501034_0917226 | |||
| 644 | Ga0501036_0342071 | |||
| 645 | Ga0501036_0503526 | |||
| 646 | Ga0501037_0019123 | |||
| 647 | Ga0501037_0095429 | |||
| 648 | Ga0501038_0087372 | |||
| 649 | Ga0501038_0101961 | |||
| 650 | Ga0501038_0533177 | |||
| 651 | Ga0501039_0008937 | |||
| 652 | Ga0501039_0172741 | |||
| 653 | Ga0501040_0144712 | |||
| 654 | Ga0501040_0260709 | |||
| 655 | Ga0501041_0092595 | |||
| 656 | Ga0501043_0020025 | |||
| 657 | Ga0501043_0578917 | |||
| 658 | Ga0501046_0005738 | |||
| 659 | Ga0501046_0011152 | |||
| 660 | Ga0501046_0055637 | |||
| 661 | Ga0501047_0002152 | |||
| 662 | Ga0501047_0070961 | |||
| 663 | Ga0501047_0103763 | |||
| 664 | Ga0501047_0104918 | |||
| 665 | Ga0501047_0161983 | |||
| 666 | Ga0501048_0005689 | |||
| 667 | Ga0501067_0001011 | |||
| 668 | Ga0501067_0007817 | |||
| 669 | Ga0501067_0211124 | |||
| 670 | Ga0501068_0712793 | |||
| 671 | Ga0501070_0000345 | |||
| 672 | Ga0501070_0017149 | |||
| 673 | Ga0501070_0079269 | |||
| 674 | Ga0501070_0155049 | |||
| 675 | Ga0501070_0711352 | |||
| 676 | Ga0501070_0750887 | |||
| 677 | Ga0501071_0045748 | |||
| 678 | Ga0501071_1341524 | |||
| 679 | Ga0501072_0096766 | |||
| 680 | Ga0501073_0022223 | |||
| 681 | Ga0501073_0253691 | |||
| 682 | Ga0501074_0778718 | |||
| 683 | Ga0501075_0413985 | |||
| 684 | Ga0501076_0025076 | |||
| 685 | Ga0501077_0047649 | |||
| 686 | Ga0501079_0002885 | |||
| 687 | Ga0501079_0462076 | |||
| 688 | Ga0501079_1055569 | |||
| 689 | Ga0501080_0000629 | |||
| 690 | Ga0501080_0001220 | |||
| 691 | Ga0501080_0004144 | |||
| 692 | Ga0501080_0574025 | |||
| 693 | Ga0501081_0181008 | |||
| 694 | Ga0501081_0228480 | |||
| 695 | Ga0501083_0043049 | |||
| 696 | Ga0501035_0000054 | |||
| 697 | Ga0501035_0003869 | |||
| 698 | Ga0501035_0168720 | |||
| 699 | Ga0501044_0000013 | |||
| 700 | Ga0501044_0002940 | |||
| 701 | Ga0501044_0013916 | |||
| 702 | Ga0501044_0038410 | |||
| 703 | Ga0501044_0167281 | |||
| 704 | Ga0501044_0206724 | |||
| 705 | Ga0501044_0701780 | |||
| 706 | Ga0501045_0056000 | |||
| 707 | Ga0501045_0165882 | |||
| 708 | nmdc:mga00v17_33338_c1 | |||
| 709 | nmdc:mga0qj67_392181_c1 | |||
| 710 | nmdc:mga06r32_2657_c1 | |||
| 711 | nmdc:mga06r32_360503_c1 | |||
| 712 | nmdc:mga06r32_537619_c1 | |||
| 713 | nmdc:mga08y16_11215_c1 | |||
| 714 | nmdc:mga08y16_75011_c1 | |||
| 715 | nmdc:mga08y16_751378_c1 | |||
| 716 | nmdc:mga0n895_2979_c1 | |||
| 717 | nmdc:mga0n895_304706_c1 | |||
| 718 | nmdc:mga0rr50_113977_c1 | |||
| 719 | nmdc:mga0rr50_281497_c1 | |||
| 720 | nmdc:mga08x19_160_c1 | |||
| 721 | nmdc:mga08x19_523953_c1 | |||
| 722 | nmdc:mga0a205_2843_c1 | |||
| 723 | nmdc:mga0a205_607670_c1 | |||
| 724 | Ga0500643_000017 | |||
| 725 | Ga0500646_0118325 | |||
| 726 | Ga0500592_005594 | |||
| 727 | Ga0500595_023575 | |||
| 728 | Ga0500568_0031810 | |||
| 729 | Ga0500616_0009556 | |||
| 730 | Ga0500611_053402 | |||
| 731 | Ga0500625_044720 | |||
| 732 | Ga0500645_039041 | |||
| 733 | Ga0501084_0001539 | |||
| 734 | Ga0501084_0182835 | |||
| 735 | Ga0501084_1013262 | |||
| 736 | Ga0501082_0175519 | |||
| 737 | Ga0501082_0185568 | |||
| 738 | Ga0501082_0749398 | |||
| 739 | Ga0501082_0940064 | |||
| 740 | Ga0530510_0032160 | |||
| 741 | 2523470751 | |||
| 742 | 2524611195 | |||
| 743 | 2739349072 | |||
| 744 | 2935683354 | |||
| 745 | 2935771052 | |||
| 746 | 2935781220 | |||
| 747 | 2935786247 | |||
| 748 | 2935793956 | |||
| 749 | 2941531676 | |||
| 750 | 8016528027 | |||
| 751 | 8016533151 | |||
| 752 | 8016555736 | |||
| 753 | 8016564089 | |||
| 754 | 8016571471 | |||
| 755 | 8016575726 | |||
| 756 | 8016601795 | |||
| 757 | 8016608454 | |||
| 758 | 8016616412 | |||
| 759 | 8019532948 | |||
| 760 | 8045864485 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5co4-assembly1.cif.gz_A | structural insights into the 2-oh methylation of c/u34 on trna | 0.9371 | 2 | 149 |
| 5co4-assembly1.cif.gz_B | structural insights into the 2-oh methylation of c/u34 on trna | 0.9363 | 2 | 149 |
| 4kdz-assembly1.cif.gz_A | crystal structure of trna/rrna methyltransferase yibk from escherichia coli (target nysgrc-012599) | 0.9273 | 2 | 149 |
| 1j85-assembly1.cif.gz_A | structure of yibk from haemophilus influenzae (hi0766), a truncated sequence homolog of trna (guanosine-2'-o-) methyltransferase (spou) | 0.9233 | 1 | 149 |
| 4kgn-assembly1.cif.gz_A | crystal structure of a trna (cytidine(34)-2'-o)-methyltransferase bound to s-adenosyl homocysteine | 0.9212 | 2 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6TCU8_69_240_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9559 | 2 | 149 | 3.40.1280.10 |
| 5co4A00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9371 | 2 | 149 | 3.40.1280.10 |
| af_C6TCU8_69_240_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9314 | 2 | 149 | 3.40.1280.10 |
| af_O50394_1_154_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9152 | 2 | 149 | 3.40.1280.10 |
| 5l0zB02 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9022 | 2 | 148 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S6STY3-F1-model_v4 | tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) | 0.9716 | 1 | 150 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-A0A1Z8NX47-F1-model_v4 | tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) | 0.9707 | 1 | 150 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-D7A3L6-F1-model_v4 | tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) | 0.9677 | 2 | 150 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-A0A0K6H0Q5-F1-model_v4 | deleted | 0.9676 | 2 | 149 |
|
| AF-A0A2S6U8P9-F1-model_v4 | tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) | 0.9659 | 2 | 149 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |