F428888

General Info

Members Datasets Scaffolds Average Seq Length
381 200 381 132

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100956746|Ga0070713_1009567461
Length 158
Sequence VTVPWDSHWNRSGEDSRIYPGPVRLFLVRHAEAEPGEPDELRALTARGRQQARELGARLAAEGANGAAVVTSPLLRARETAAEIGRALGTTPAPDDRLAPGATADGVRDALSEHTGAADRVVAIGHQPDCGRIAATLTDGPEPDFPTAGVVVIDLPGL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
67 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
68 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
69 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.91
Rhizosphere 85.3
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10002978 3300005327 Bacteria 14025
2 Ga0070658_10014266 3300005327 Bacteria 6376
3 Ga0070683_100166147 3300005329 Bacteria 2094
4 Ga0070683_100837735 3300005329 Bacteria 882
5 Ga0068869_100255448 3300005334 Unclassified 1401
6 Ga0070680_100851582 3300005336 Bacteria 786
7 Ga0068868_100032049 3300005338 Bacteria 4041
8 Ga0068868_101076576 3300005338 Unclassified 739
9 Ga0070660_100002646 3300005339 Bacteria 12312
10 Ga0070660_100024254 3300005339 Bacteria 4500
11 Ga0070660_101188058 3300005339 Bacteria 647
12 Ga0070691_10029374 3300005341 Bacteria 2571
13 Ga0070661_100249157 3300005344 Unclassified 1370
14 Ga0070661_100744347 3300005344 Bacteria 801
15 Ga0070692_11392882 3300005345 Bacteria 506
16 Ga0070668_100004587 3300005347 Bacteria 10238
17 Ga0070669_101023212 3300005353 Bacteria 709
18 Ga0070675_100323806 3300005354 Bacteria 1362
19 Ga0070688_100862112 3300005365 Unclassified 712
20 Ga0070659_101338148 3300005366 Bacteria 636
21 Ga0070709_10440739 3300005434 Bacteria 980
22 Ga0070709_10552887 3300005434 Bacteria 881
23 Ga0070714_100014775 3300005435 Bacteria 6274
24 Ga0070714_100372219 3300005435 Bacteria 1345
25 Ga0070714_100518793 3300005435 Bacteria 1138
26 Ga0070714_101831745 3300005435 Bacteria 592
27 Ga0070714_102282282 3300005435 Bacteria 526
28 Ga0070713_100956746 3300005436 Bacteria 825
29 Ga0070713_101639003 3300005436 Bacteria 624
30 Ga0070713_101639004 3300005436 Bacteria 624
31 Ga0070711_100065263 3300005439 Bacteria 2545
32 Ga0070711_100694671 3300005439 Bacteria 856
33 Ga0070705_100308484 3300005440 Unclassified 1137
34 Ga0070705_100695205 3300005440 Unclassified 798
35 Ga0070700_101498169 3300005441 Bacteria 573
36 Ga0070694_100326031 3300005444 Bacteria 1183
37 Ga0070708_100344253 3300005445 Bacteria 1405
38 Ga0070708_100768947 3300005445 Bacteria 906
39 Ga0070708_101645158 3300005445 Unclassified 597
40 Ga0070663_100953319 3300005455 Bacteria 744
41 Ga0070662_100300641 3300005457 Bacteria 1304
42 Ga0070662_100446691 3300005457 Bacteria 1073
43 Ga0070681_10050724 3300005458 Bacteria 4140
44 Ga0070681_10057662 3300005458 Bacteria 3864
45 Ga0070681_11365549 3300005458 Bacteria 632
46 Ga0068867_100608994 3300005459 Bacteria 953
47 Ga0070706_100214090 3300005467 Bacteria 1799
48 Ga0070706_101107641 3300005467 Bacteria 729
49 Ga0070707_100012248 3300005468 Bacteria 8009
50 Ga0070698_100043593 3300005471 Bacteria 4599
51 Ga0070698_101001998 3300005471 Bacteria 783
52 Ga0070699_100021499 3300005518 Bacteria 5564
53 Ga0070699_100481217 3300005518 Bacteria 1127
54 Ga0070699_100769273 3300005518 Bacteria 881
55 Ga0070699_100793164 3300005518 Bacteria 867
56 Ga0070679_100038293 3300005530 Bacteria 4766
57 Ga0070679_100180735 3300005530 Bacteria 2082
58 Ga0070684_100481202 3300005535 Bacteria 1149
59 Ga0070684_100496574 3300005535 Bacteria 1130
60 Ga0068853_100397272 3300005539 Bacteria 1290
61 Ga0070696_100025706 3300005546 Bacteria 4005
62 Ga0070696_100513831 3300005546 Bacteria 955
63 Ga0070696_100517281 3300005546 Bacteria 952
64 Ga0070704_100472973 3300005549 Unclassified 1083
65 Ga0070704_100627815 3300005549 Bacteria 947
66 Ga0068855_100030414 3300005563 Bacteria 6460
67 Ga0068855_100109642 3300005563 Bacteria 3169
68 Ga0068855_100123305 3300005563 Bacteria 2965
69 Ga0068855_100227406 3300005563 Bacteria 2090
70 Ga0068854_100553303 3300005578 Unclassified 976
71 Ga0068856_100010876 3300005614 Bacteria 8836
72 Ga0068866_10985097 3300005718 Bacteria 598
73 Ga0068861_100010835 3300005719 Bacteria 6337
74 Ga0068851_10090487 3300005834 Bacteria 1610
75 Ga0068870_10051515 3300005840 Bacteria 2179
76 Ga0081455_10036615 3300005937 Bacteria 4366
77 Ga0081455_10042824 3300005937 Bacteria 3967
78 Ga0081538_10046569 3300005981 Bacteria 2673
79 Ga0070717_10232485 3300006028 Bacteria 1623
80 Ga0075432_10022297 3300006058 Bacteria 2166
81 Ga0075428_100020392 3300006844 Bacteria 7339
82 Ga0075431_100377896 3300006847 Bacteria 1421
83 Ga0075431_100973042 3300006847 Bacteria 816
84 Ga0075433_10001902 3300006852 Bacteria 15706
85 Ga0075434_100010976 3300006871 Bacteria 8521
86 Ga0075434_100033548 3300006871 Bacteria 5067
87 Ga0075434_100814167 3300006871 Bacteria 950
88 Ga0068865_100849058 3300006881 Bacteria 791
89 Ga0075436_101276783 3300006914 Bacteria 555
90 Ga0075435_100022114 3300007076 Bacteria 4903
91 Ga0075435_100033158 3300007076 Bacteria 4081
92 Ga0075435_100064283 3300007076 Bacteria 2981
93 Ga0075435_100789889 3300007076 Bacteria 826
94 Ga0099794_10659372 3300007265 Bacteria 556
95 Ga0105240_10065518 3300009093 Bacteria 4509
96 Ga0111539_10347564 3300009094 Unclassified 1726
97 Ga0105245_10023879 3300009098 Bacteria 5366
98 Ga0105245_10927562 3300009098 Unclassified 913
99 Ga0105245_11326626 3300009098 Bacteria 769
100 Ga0114129_10024775 3300009147 Bacteria 8505
101 Ga0114129_10092604 3300009147 Bacteria 4187
102 Ga0114129_10105197 3300009147 Bacteria 3900
103 Ga0114129_10140167 3300009147 Bacteria 3315
104 Ga0114129_13052207 3300009147 Bacteria 549
105 Ga0105243_10338147 3300009148 Bacteria 1378
106 Ga0105243_11505115 3300009148 Bacteria 697
107 Ga0105241_10728702 3300009174 Bacteria 907
108 Ga0105242_10259469 3300009176 Bacteria 1569
109 Ga0105242_11104294 3300009176 Bacteria 807
110 Ga0105238_10184118 3300009551 Bacteria 2065
111 Ga0105249_10028829 3300009553 Bacteria 5011
112 Ga0105239_10012162 3300010375 Bacteria 9595
113 Ga0105239_10061963 3300010375 Bacteria 4106
114 Ga0105239_10404993 3300010375 Bacteria 1544
115 Ga0105239_10565549 3300010375 Bacteria 1295
116 Ga0105246_11207693 3300011119 Bacteria 696
117 Ga0157340_1016111 3300012473 Archaea 588
118 Ga0157341_1025502 3300012494 Bacteria 610
119 Ga0157342_1000948 3300012507 Bacteria 1990
120 Ga0157326_1003939 3300012513 Bacteria 1560
121 Ga0157373_10122668 3300013100 Bacteria 1826
122 Ga0157371_10619873 3300013102 Bacteria 806
123 Ga0157370_10005267 3300013104 Bacteria 14538
124 Ga0157369_10024309 3300013105 Bacteria 6743
125 Ga0157374_10230781 3300013296 Bacteria 1818
126 Ga0163162_10177656 3300013306 Bacteria 2255
127 Ga0163162_10638675 3300013306 Bacteria 1189
128 Ga0157372_10003201 3300013307 Bacteria 17676
129 Ga0157372_10910772 3300013307 Bacteria 1020
130 Ga0163163_10814130 3300014325 Unclassified 997
131 Ga0182008_10204210 3300014497 Bacteria 1006
132 Ga0182008_10237184 3300014497 Bacteria 937
133 Ga0157377_10252501 3300014745 Bacteria 1144
134 Ga0157377_10801541 3300014745 Unclassified 694
135 Ga0163161_10090377 3300017792 Bacteria 2266
136 Ga0207642_10606623 3300025899 Bacteria 682
137 Ga0207688_10159246 3300025901 Bacteria 1337
138 Ga0207699_10111177 3300025906 Bacteria 1756
139 Ga0207705_10157351 3300025909 Bacteria 1705
140 Ga0207684_10182653 3300025910 Bacteria 1809
141 Ga0207707_10008812 3300025912 Bacteria 8758
142 Ga0207707_10050116 3300025912 Bacteria 3638
143 Ga0207707_10203996 3300025912 Bacteria 1723
144 Ga0207707_11106771 3300025912 Bacteria 645
145 Ga0207695_10049853 3300025913 Bacteria 4408
146 Ga0207695_10945766 3300025913 Bacteria 741
147 Ga0207660_10041400 3300025917 Bacteria 3228
148 Ga0207660_10062237 3300025917 Bacteria 2688
149 Ga0207657_10004543 3300025919 Bacteria 14660
150 Ga0207657_10004993 3300025919 Bacteria 13945
151 Ga0207649_10172976 3300025920 Unclassified 1506
152 Ga0207649_10797199 3300025920 Bacteria 737
153 Ga0207652_10068304 3300025921 Bacteria 3083
154 Ga0207652_10110518 3300025921 Bacteria 2437
155 Ga0207646_10052442 3300025922 Bacteria 3650
156 Ga0207646_10218403 3300025922 Bacteria 1722
157 Ga0207646_10647180 3300025922 Bacteria 947
158 Ga0207659_10267665 3300025926 Bacteria 1393
159 Ga0207659_10676159 3300025926 Unclassified 883
160 Ga0207687_10088150 3300025927 Bacteria 2257
161 Ga0207664_10045955 3300025929 Bacteria 3426
162 Ga0207664_10113860 3300025929 Bacteria 2253
163 Ga0207690_10313780 3300025932 Bacteria 1230
164 Ga0207690_10772863 3300025932 Bacteria 793
165 Ga0207706_10039818 3300025933 Bacteria 4167
166 Ga0207706_10635743 3300025933 Bacteria 915
167 Ga0207686_10271842 3300025934 Bacteria 1247
168 Ga0207709_10010699 3300025935 Bacteria 5053
169 Ga0207704_10156504 3300025938 Bacteria 1616
170 Ga0207704_10752326 3300025938 Bacteria 811
171 Ga0207689_10126329 3300025942 Unclassified 2104
172 Ga0207661_10002631 3300025944 Bacteria 12355
173 Ga0207661_10085944 3300025944 Bacteria 2609
174 Ga0207661_10531059 3300025944 Bacteria 1077
175 Ga0207661_10817985 3300025944 Bacteria 858
176 Ga0207679_10017050 3300025945 Bacteria 4834
177 Ga0207667_10082700 3300025949 Bacteria 3325
178 Ga0207712_10009692 3300025961 Bacteria 6105
179 Ga0207668_10057826 3300025972 Bacteria 2707
180 Ga0207677_10072021 3300026023 Bacteria 2442
181 Ga0207677_10160575 3300026023 Bacteria 1746
182 Ga0207677_10542085 3300026023 Bacteria 1012
183 Ga0207708_11433160 3300026075 Bacteria 606
184 Ga0207702_10006607 3300026078 Bacteria 9973
185 Ga0207702_10560990 3300026078 Bacteria 1118
186 Ga0207648_10206424 3300026089 Bacteria 1744
187 Ga0207648_10408533 3300026089 Bacteria 1231
188 Ga0207676_10493315 3300026095 Bacteria 1162
189 Ga0207676_11251012 3300026095 Unclassified 736
190 Ga0207675_100002514 3300026118 Bacteria 18148
191 Ga0207683_10002893 3300026121 Bacteria 14970
192 Ga0207698_10576215 3300026142 Bacteria 1107
193 Ga0207428_10255659 3300027907 Bacteria 1305
194 Ga0307405_11150061 3300031731 Bacteria 669
195 Ga0307409_100182519 3300031995 Bacteria 1859
196 Ga0307416_100039675 3300032002 Bacteria 3649
197 Ga0373948_0111833 3300034817 Unclassified 653
198 Ga0373943_0091962 3300035170 Bacteria 1573
199 Ga0373961_0131545 3300035241 Bacteria 838
200 Ga0373947_0161123 3300035725 Bacteria 1451
201 Ga0395899_0002345 3300037312 Bacteria 15412
202 Ga0395899_0003491 3300037312 Bacteria 12458
203 Ga0395899_0010989 3300037312 Bacteria 6934
204 Ga0395899_0826465 3300037312 Unclassified 570
205 Ga0395900_0009571 3300037418 Bacteria 9933
206 Ga0395900_0021032 3300037418 Bacteria 6667
207 Ga0395900_0029574 3300037418 Bacteria 5620
208 Ga0395900_0100869 3300037418 Bacteria 2965
209 Ga0395900_0127100 3300037418 Bacteria 2614
210 Ga0395900_0127420 3300037418 Bacteria 2610
211 Ga0395900_0339979 3300037418 Bacteria 1477
212 Ga0395900_0360643 3300037418 Bacteria 1425
213 Ga0395898_0008414 3300037466 Bacteria 10908
214 Ga0395898_0010080 3300037466 Bacteria 9890
215 Ga0395898_0013069 3300037466 Bacteria 8557
216 Ga0395898_0028833 3300037466 Bacteria 5564
217 Ga0395898_0054177 3300037466 Bacteria 3915
218 Ga0395898_0134625 3300037466 Bacteria 2366
219 Ga0395898_1494556 3300037466 Unclassified 602
220 Ga0395898_1705100 3300037466 Bacteria 553
221 Ga0395905_0002978 3300037471 Bacteria 18388
222 Ga0395905_0003417 3300037471 Bacteria 16981
223 Ga0395905_0022285 3300037471 Bacteria 5993
224 Ga0395905_0527937 3300037471 Bacteria 1081
225 Ga0395905_1559594 3300037471 Unclassified 565
226 Ga0395901_0000717 3300038443 Bacteria 37735
227 Ga0395901_0004515 3300038443 Bacteria 14036
228 Ga0395901_0022624 3300038443 Bacteria 6443
229 Ga0395901_0026873 3300038443 Bacteria 5909
230 Ga0395901_0033107 3300038443 Bacteria 5333
231 Ga0395901_0039679 3300038443 Bacteria 4873
232 Ga0395901_0247302 3300038443 Bacteria 1859
233 Ga0395901_0353912 3300038443 Bacteria 1515
234 Ga0395901_0395956 3300038443 Bacteria 1419
235 Ga0395901_0936969 3300038443 Bacteria 846
236 Ga0395901_1085197 3300038443 Bacteria 772
237 Ga0395901_1107332 3300038443 Unclassified 762
238 Ga0395901_1156646 3300038443 Bacteria 742
239 Ga0451839_1557787 3300041496 Bacteria 917
240 Ga0451853_0068445 3300041512 Bacteria 2082
241 Ga0451853_2252194 3300041512 Bacteria 519
242 Ga0439448_0293907 3300042005 Bacteria 576
243 Ga0466963_0118858 3300044694 Bacteria 1818
244 Ga0466964_0004692 3300044706 Bacteria 5051
245 Ga0466964_0159614 3300044706 Bacteria 1053
246 Ga0466957_0069139 3300044842 Bacteria 2181
247 Ga0466960_0216776 3300044901 Bacteria 1052
248 Ga0466960_0977787 3300044901 Bacteria 519
249 Ga0451576_0094219 3300045051 Bacteria 3114
250 Ga0451576_1395042 3300045051 Bacteria 729
251 Ga0451576_1501854 3300045051 Bacteria 700
252 Ga0466967_0261812 3300045976 Bacteria 1655
253 Ga0466967_0376264 3300045976 Bacteria 1378
254 Ga0466967_0572572 3300045976 Bacteria 1113
255 Ga0466967_2370510 3300045976 Bacteria 526
256 Ga0495592_0167162 3300046454 Bacteria 1509
257 Ga0495641_0196843 3300046461 Bacteria 903
258 Ga0495651_0097705 3300046462 Bacteria 2192
259 Ga0495653_0203554 3300046463 Bacteria 1342
260 Ga0495664_0562395 3300046477 Bacteria 679
261 Ga0495584_0132438 3300046491 Bacteria 1265
262 Ga0495596_0133427 3300046500 Unclassified 964
263 Ga0495596_0166179 3300046500 Bacteria 858
264 Ga0495607_0306755 3300046501 Bacteria 745
265 Ga0495583_0437133 3300046506 Unclassified 513
266 Ga0495608_0082471 3300046511 Bacteria 2088
267 Ga0495618_0074131 3300046514 Bacteria 2167
268 Ga0495618_0357863 3300046514 Bacteria 899
269 Ga0495628_0069045 3300046516 Bacteria 2756
270 Ga0495628_0188925 3300046516 Bacteria 1556
271 Ga0495630_1044062 3300046517 Unclassified 620
272 Ga0495644_0460670 3300046523 Bacteria 507
273 Ga0495663_0053757 3300046525 Bacteria 1253
274 Ga0495663_0120741 3300046525 Bacteria 877
275 Ga0495652_0072646 3300046529 Bacteria 2866
276 Ga0495652_0548991 3300046529 Unclassified 795
277 Ga0495609_0137692 3300046538 Bacteria 1043
278 Ga0495609_0158948 3300046538 Bacteria 959
279 Ga0495621_0406897 3300046539 Bacteria 578
280 Ga0495597_0324588 3300046542 Bacteria 594
281 Ga0495645_0056371 3300046543 Bacteria 2853
282 Ga0495647_0185332 3300046681 Bacteria 907
283 Ga0495658_1026002 3300046683 Bacteria 526
284 Ga0495613_0236593 3300046689 Bacteria 1278
285 Ga0495660_0217081 3300046810 Bacteria 904
286 Ga0495674_0137952 3300047319 Bacteria 2051
287 Ga0495674_0218038 3300047319 Bacteria 1578
288 Ga0495676_0162825 3300047321 Bacteria 1577
289 Ga0495676_0419941 3300047321 Bacteria 885
290 Ga0495676_1106103 3300047321 Bacteria 504
291 Ga0495680_0215307 3300047322 Bacteria 1373
292 Ga0495680_0706131 3300047322 Bacteria 666
293 Ga0495684_0024605 3300047471 Bacteria 4633
294 Ga0496100_0000833 3300048903 Bacteria 14813
295 Ga0496100_0015564 3300048903 Bacteria 4444
296 Ga0496100_0033346 3300048903 Bacteria 3222
297 Ga0496100_0163203 3300048903 Bacteria 1599
298 Ga0496100_1243307 3300048903 Bacteria 588
299 Ga0496101_0046845 3300048904 Bacteria 3102
300 Ga0496101_0058168 3300048904 Bacteria 2798
301 Ga0496101_1119811 3300048904 Bacteria 618
302 Ga0496101_1300606 3300048904 Bacteria 568
303 Ga0496102_0002009 3300048905 Bacteria 17567
304 Ga0496102_0341033 3300048905 Bacteria 1411
305 Ga0496102_0384611 3300048905 Bacteria 1320
306 Ga0496102_1241285 3300048905 Bacteria 665
307 Ga0496103_1024481 3300048906 Unclassified 513
308 Ga0496104_0010179 3300048907 Bacteria 8394
309 Ga0496104_0018652 3300048907 Bacteria 6333
310 Ga0496104_0119211 3300048907 Bacteria 2534
311 Ga0496104_1666089 3300048907 Bacteria 540
312 Ga0496105_0000105 3300048908 Bacteria 56991
313 Ga0496105_0010539 3300048908 Bacteria 7271
314 Ga0496105_0246715 3300048908 Bacteria 1448
315 Ga0496105_0800341 3300048908 Bacteria 717
316 Ga0496106_0050041 3300048909 Bacteria 3149
317 Ga0496106_0550013 3300048909 Unclassified 926
318 Ga0496107_0117812 3300048910 Unclassified 1955
319 Ga0496107_0136522 3300048910 Bacteria 1812
320 Ga0496107_0299100 3300048910 Bacteria 1198
321 Ga0496107_0600281 3300048910 Bacteria 814
322 Ga0496107_1015244 3300048910 Unclassified 601
323 Ga0496108_0004529 3300048911 Bacteria 11192
324 Ga0496108_0288114 3300048911 Unclassified 1430
325 Ga0496108_0617131 3300048911 Bacteria 944
326 Ga0496109_0000298 3300048912 Bacteria 46751
327 Ga0496109_0314321 3300048912 Bacteria 1478
328 Ga0496109_0391758 3300048912 Bacteria 1313
329 Ga0496109_0557440 3300048912 Bacteria 1081
330 Ga0496110_0000644 3300048913 Bacteria 23907
331 Ga0496110_0022514 3300048913 Bacteria 5352
332 Ga0496110_0032997 3300048913 Bacteria 4476
333 Ga0496111_0003006 3300048914 Bacteria 10326
334 Ga0496111_0076253 3300048914 Bacteria 2444
335 Ga0496111_0110630 3300048914 Unclassified 2023
336 Ga0496111_0350100 3300048914 Bacteria 1093
337 Ga0496112_0003803 3300048915 Bacteria 12617
338 Ga0496112_0069661 3300048915 Bacteria 3475
339 Ga0496112_0653638 3300048915 Bacteria 981
340 Ga0496113_0118145 3300048916 Bacteria 2071
341 Ga0496113_1016151 3300048916 Bacteria 653
342 Ga0496114_0000566 3300048917 Bacteria 27443
343 Ga0496114_0000952 3300048917 Bacteria 21669
344 Ga0496114_0047378 3300048917 Bacteria 3576
345 Ga0496115_0193525 3300048918 Unclassified 1680
346 Ga0496115_0225748 3300048918 Bacteria 1545
347 Ga0501040_0150614 3300049576 Bacteria 1641
348 Ga0501046_0101933 3300049580 Bacteria 2201
349 Ga0501067_0003969 3300049583 Bacteria 8163
350 Ga0501068_0100691 3300049584 Bacteria 1791
351 Ga0501069_0001253 3300049585 Bacteria 12430
352 Ga0501076_0376748 3300049592 Bacteria 1166
353 Ga0501079_1604213 3300049741 Bacteria 512
354 Ga0501080_1018286 3300049742 Bacteria 718
355 Ga0501081_0247536 3300049743 Bacteria 1301
356 nmdc:mga05p37_1013964_c1 3300050507 Bacteria 880
357 nmdc:mga05p37_125974_c1 3300050507 Bacteria 1319
358 nmdc:mga05p37_169723_c1 3300050507 Bacteria 2661
359 nmdc:mga05p37_1996107_c1 3300050507 Bacteria 549
360 nmdc:mga05p37_82271_c1 3300050507 Bacteria 3967
361 nmdc:mga06r32_299784_c1 3300050510 Bacteria 1593
362 nmdc:mga06r32_942361_c1 3300050510 Bacteria 818
363 nmdc:mga08y16_148874_c1 3300050511 Bacteria 2433
364 nmdc:mga08y16_238431_c1 3300050511 Bacteria 1880
365 nmdc:mga08y16_547880_c1 3300050511 Bacteria 1171
366 nmdc:mga0n895_5512_c1 3300050512 Bacteria 10594
367 nmdc:mga0rr50_148189_c1 3300050513 Bacteria 1894
368 nmdc:mga0rr50_17926_c1 3300050513 Bacteria 4742
369 nmdc:mga0rr50_758199_c1 3300050513 Bacteria 828
370 nmdc:mga08x19_404208_c1 3300050514 Unclassified 958
371 nmdc:mga0a205_147663_c1 3300050515 Bacteria 2251
372 nmdc:mga0a205_221681_c1 3300050515 Bacteria 1776
373 nmdc:mga0a205_48_c1 3300050515 Bacteria 44125
374 Ga0495612_0084094 3300053078 Bacteria 1340
375 Ga0495595_0082022 3300053084 Bacteria 1537
376 Ga0495595_0238346 3300053084 Bacteria 910
377 Ga0495595_0383787 3300053084 Bacteria 711
378 Ga0495619_0030644 3300053085 Bacteria 3482
379 Ga0495619_0074519 3300053085 Bacteria 2276
380 Ga0495619_0110784 3300053085 Bacteria 1876
381 Ga0501082_0157508 3300060353 Bacteria 1973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041496 Ga0451839_1557787 Ga0451839_1557787_569_901 107
2 3300025929 Ga0207664_10045955 Ga0207664_100459553 110
3 3300031731 Ga0307405_11150061 Ga0307405_111500612 113
4 3300032002 Ga0307416_100039675 Ga0307416_1000396756 113
5 3300025922 Ga0207646_10218403 Ga0207646_102184033 114
6 3300005327 Ga0070658_10014266 Ga0070658_100142662 125
7 3300005336 Ga0070680_100851582 Ga0070680_1008515822 125
8 3300005339 Ga0070660_100002646 Ga0070660_1000026469 125
9 3300005344 Ga0070661_100744347 Ga0070661_1007443472 125
10 3300005365 Ga0070688_100862112 Ga0070688_1008621122 125
11 3300005458 Ga0070681_10050724 Ga0070681_100507244 125
12 3300005530 Ga0070679_100180735 Ga0070679_1001807353 125
13 3300005535 Ga0070684_100496574 Ga0070684_1004965742 125
14 3300005563 Ga0068855_100227406 Ga0068855_1002274062 125
15 3300005834 Ga0068851_10090487 Ga0068851_100904872 125
16 3300025909 Ga0207705_10157351 Ga0207705_101573512 125
17 3300025912 Ga0207707_10050116 Ga0207707_100501162 125
18 3300025913 Ga0207695_10049853 Ga0207695_100498533 125
19 3300025917 Ga0207660_10062237 Ga0207660_100622372 125
20 3300025919 Ga0207657_10004993 Ga0207657_100049938 125
21 3300025920 Ga0207649_10797199 Ga0207649_107971991 125
22 3300025949 Ga0207667_10082700 Ga0207667_100827003 125
23 3300026142 Ga0207698_10576215 Ga0207698_105762152 125
24 3300038443 Ga0395901_1156646 Ga0395901_1156646_128_514 125
25 3300049576 Ga0501040_0150614 Ga0501040_0150614_529_915 125
26 3300049580 Ga0501046_0101933 Ga0501046_0101933_1775_2161 125
27 3300049584 Ga0501068_0100691 Ga0501068_0100691_124_510 125
28 3300049592 Ga0501076_0376748 Ga0501076_0376748_31_417 125
29 3300049743 Ga0501081_0247536 Ga0501081_0247536_335_721 125
30 3300005434 Ga0070709_10440739 Ga0070709_104407392 126
31 3300005435 Ga0070714_101831745 Ga0070714_1018317452 126
32 3300005435 Ga0070714_102282282 Ga0070714_1022822821 126
33 3300005436 Ga0070713_101639003 Ga0070713_1016390032 126
34 3300005436 Ga0070713_101639004 Ga0070713_1016390042 126
35 3300005439 Ga0070711_100065263 Ga0070711_1000652632 126
36 3300005518 Ga0070699_100769273 Ga0070699_1007692731 126
37 3300006028 Ga0070717_10232485 Ga0070717_102324852 126
38 3300006914 Ga0075436_101276783 Ga0075436_1012767832 126
39 3300010375 Ga0105239_10565549 Ga0105239_105655492 126
40 3300025906 Ga0207699_10111177 Ga0207699_101111772 126
41 3300025929 Ga0207664_10113860 Ga0207664_101138604 126
42 3300038443 Ga0395901_1107332 Ga0395901_1107332_154_543 126
43 3300044706 Ga0466964_0159614 Ga0466964_0159614_22_402 126
44 3300045976 Ga0466967_0376264 Ga0466967_0376264_287_667 126
45 3300046523 Ga0495644_0460670 Ga0495644_0460670_82_471 126
46 3300048904 Ga0496101_1119811 Ga0496101_1119811_197_586 126
47 3300005329 Ga0070683_100837735 Ga0070683_1008377351 127
48 3300005334 Ga0068869_100255448 Ga0068869_1002554482 127
49 3300005341 Ga0070691_10029374 Ga0070691_100293742 127
50 3300005344 Ga0070661_100249157 Ga0070661_1002491572 127
51 3300005440 Ga0070705_100308484 Ga0070705_1003084842 127
52 3300005441 Ga0070700_101498169 Ga0070700_1014981691 127
53 3300005445 Ga0070708_100768947 Ga0070708_1007689472 127
54 3300005471 Ga0070698_101001998 Ga0070698_1010019982 127
55 3300005578 Ga0068854_100553303 Ga0068854_1005533032 127
56 3300005614 Ga0068856_100010876 Ga0068856_1000108767 127
57 3300005718 Ga0068866_10985097 Ga0068866_109850972 127
58 3300005840 Ga0068870_10051515 Ga0068870_100515153 127
59 3300005937 Ga0081455_10036615 Ga0081455_100366155 127
60 3300005937 Ga0081455_10042824 Ga0081455_100428242 127
61 3300005981 Ga0081538_10046569 Ga0081538_100465693 127
62 3300006058 Ga0075432_10022297 Ga0075432_100222973 127
63 3300007076 Ga0075435_100789889 Ga0075435_1007898892 127
64 3300009098 Ga0105245_11326626 Ga0105245_113266262 127
65 3300009147 Ga0114129_10092604 Ga0114129_100926045 127
66 3300009148 Ga0105243_10338147 Ga0105243_103381473 127
67 3300009176 Ga0105242_11104294 Ga0105242_111042942 127
68 3300010375 Ga0105239_10404993 Ga0105239_104049932 127
69 3300011119 Ga0105246_11207693 Ga0105246_112076931 127
70 3300013296 Ga0157374_10230781 Ga0157374_102307811 127
71 3300013306 Ga0163162_10638675 Ga0163162_106386752 127
72 3300014325 Ga0163163_10814130 Ga0163163_108141302 127
73 3300014745 Ga0157377_10252501 Ga0157377_102525012 127
74 3300014745 Ga0157377_10801541 Ga0157377_108015411 127
75 3300025899 Ga0207642_10606623 Ga0207642_106066232 127
76 3300025912 Ga0207707_10008812 Ga0207707_100088123 127
77 3300025917 Ga0207660_10041400 Ga0207660_100414002 127
78 3300025920 Ga0207649_10172976 Ga0207649_101729762 127
79 3300025921 Ga0207652_10110518 Ga0207652_101105182 127
80 3300025926 Ga0207659_10676159 Ga0207659_106761592 127
81 3300025934 Ga0207686_10271842 Ga0207686_102718423 127
82 3300025935 Ga0207709_10010699 Ga0207709_100106995 127
83 3300025938 Ga0207704_10156504 Ga0207704_101565042 127
84 3300025942 Ga0207689_10126329 Ga0207689_101263292 127
85 3300025944 Ga0207661_10002631 Ga0207661_100026318 127
86 3300025944 Ga0207661_10531059 Ga0207661_105310592 127
87 3300025944 Ga0207661_10817985 Ga0207661_108179852 127
88 3300025945 Ga0207679_10017050 Ga0207679_100170502 127
89 3300026023 Ga0207677_10072021 Ga0207677_100720212 127
90 3300026023 Ga0207677_10542085 Ga0207677_105420852 127
91 3300026075 Ga0207708_11433160 Ga0207708_114331602 127
92 3300026078 Ga0207702_10006607 Ga0207702_100066075 127
93 3300026089 Ga0207648_10408533 Ga0207648_104085331 127
94 3300026095 Ga0207676_10493315 Ga0207676_104933153 127
95 3300026095 Ga0207676_11251012 Ga0207676_112510122 127
96 3300026121 Ga0207683_10002893 Ga0207683_100028937 127
97 3300027907 Ga0207428_10255659 Ga0207428_102556593 127
98 3300035170 Ga0373943_0091962 Ga0373943_0091962_80_472 127
99 3300035725 Ga0373947_0161123 Ga0373947_0161123_708_1100 127
100 3300037312 Ga0395899_0826465 Ga0395899_0826465_64_456 127
101 3300037418 Ga0395900_0100869 Ga0395900_0100869_1350_1742 127
102 3300037466 Ga0395898_0134625 Ga0395898_0134625_1199_1591 127
103 3300037466 Ga0395898_1705100 Ga0395898_1705100_41_433 127
104 3300038443 Ga0395901_0026873 Ga0395901_0026873_4234_4626 127
105 3300038443 Ga0395901_0936969 Ga0395901_0936969_122_505 127
106 3300038443 Ga0395901_1085197 Ga0395901_1085197_222_614 127
107 3300042005 Ga0439448_0293907 Ga0439448_0293907_114_509 127
108 3300044706 Ga0466964_0004692 Ga0466964_0004692_3065_3457 127
109 3300044842 Ga0466957_0069139 Ga0466957_0069139_1305_1688 127
110 3300045051 Ga0451576_1501854 Ga0451576_1501854_243_635 127
111 3300045976 Ga0466967_0261812 Ga0466967_0261812_304_696 127
112 3300046461 Ga0495641_0196843 Ga0495641_0196843_422_814 127
113 3300046501 Ga0495607_0306755 Ga0495607_0306755_330_722 127
114 3300046517 Ga0495630_1044062 Ga0495630_1044062_131_523 127
115 3300046683 Ga0495658_1026002 Ga0495658_1026002_100_492 127
116 3300046689 Ga0495613_0236593 Ga0495613_0236593_382_774 127
117 3300047321 Ga0495676_0162825 Ga0495676_0162825_542_934 127
118 3300048903 Ga0496100_0000833 Ga0496100_0000833_7132_7524 127
119 3300048903 Ga0496100_0033346 Ga0496100_0033346_376_768 127
120 3300048903 Ga0496100_0163203 Ga0496100_0163203_1013_1453 127
121 3300048903 Ga0496100_1243307 Ga0496100_1243307_131_523 127
122 3300048904 Ga0496101_0046845 Ga0496101_0046845_198_590 127
123 3300048904 Ga0496101_0058168 Ga0496101_0058168_676_1068 127
124 3300048904 Ga0496101_1300606 Ga0496101_1300606_32_424 127
125 3300048905 Ga0496102_0002009 Ga0496102_0002009_2063_2455 127
126 3300048905 Ga0496102_0341033 Ga0496102_0341033_342_734 127
127 3300048905 Ga0496102_0384611 Ga0496102_0384611_821_1261 127
128 3300048906 Ga0496103_1024481 Ga0496103_1024481_10_402 127
129 3300048907 Ga0496104_0010179 Ga0496104_0010179_221_613 127
130 3300048907 Ga0496104_0018652 Ga0496104_0018652_1487_1879 127
131 3300048907 Ga0496104_0119211 Ga0496104_0119211_1587_2027 127
132 3300048908 Ga0496105_0000105 Ga0496105_0000105_48975_49367 127
133 3300048908 Ga0496105_0010539 Ga0496105_0010539_3854_4246 127
134 3300048908 Ga0496105_0246715 Ga0496105_0246715_515_955 127
135 3300048908 Ga0496105_0800341 Ga0496105_0800341_74_466 127
136 3300048909 Ga0496106_0050041 Ga0496106_0050041_1835_2275 127
137 3300048909 Ga0496106_0550013 Ga0496106_0550013_216_608 127
138 3300048910 Ga0496107_0117812 Ga0496107_0117812_1217_1609 127
139 3300048910 Ga0496107_0136522 Ga0496107_0136522_948_1388 127
140 3300048910 Ga0496107_0299100 Ga0496107_0299100_719_1111 127
141 3300048910 Ga0496107_0600281 Ga0496107_0600281_252_644 127
142 3300048910 Ga0496107_1015244 Ga0496107_1015244_54_446 127
143 3300048911 Ga0496108_0004529 Ga0496108_0004529_7359_7751 127
144 3300048911 Ga0496108_0288114 Ga0496108_0288114_803_1195 127
145 3300048911 Ga0496108_0617131 Ga0496108_0617131_54_446 127
146 3300048912 Ga0496109_0000298 Ga0496109_0000298_38848_39240 127
147 3300048912 Ga0496109_0391758 Ga0496109_0391758_390_782 127
148 3300048912 Ga0496109_0557440 Ga0496109_0557440_18_410 127
149 3300048913 Ga0496110_0000644 Ga0496110_0000644_16078_16470 127
150 3300048913 Ga0496110_0022514 Ga0496110_0022514_3054_3494 127
151 3300048913 Ga0496110_0032997 Ga0496110_0032997_700_1092 127
152 3300048914 Ga0496111_0003006 Ga0496111_0003006_7459_7851 127
153 3300048914 Ga0496111_0110630 Ga0496111_0110630_599_991 127
154 3300048914 Ga0496111_0350100 Ga0496111_0350100_154_546 127
155 3300048915 Ga0496112_0069661 Ga0496112_0069661_2832_3272 127
156 3300048916 Ga0496113_0118145 Ga0496113_0118145_1478_1918 127
157 3300048917 Ga0496114_0000566 Ga0496114_0000566_20009_20401 127
158 3300048917 Ga0496114_0000952 Ga0496114_0000952_3270_3662 127
159 3300048917 Ga0496114_0047378 Ga0496114_0047378_1304_1744 127
160 3300048918 Ga0496115_0193525 Ga0496115_0193525_540_932 127
161 3300048918 Ga0496115_0225748 Ga0496115_0225748_796_1188 127
162 3300049741 Ga0501079_1604213 Ga0501079_1604213_103_495 127
163 3300050507 nmdc:mga05p37_169723_c1 nmdc:mga05p37_169723_c1_1376_1771 127
164 3300050511 nmdc:mga08y16_148874_c1 nmdc:mga08y16_148874_c1_381_776 127
165 3300050514 nmdc:mga08x19_404208_c1 nmdc:mga08x19_404208_c1_376_768 127
166 3300053084 Ga0495595_0238346 Ga0495595_0238346_204_596 127
167 3300053085 Ga0495619_0110784 Ga0495619_0110784_1153_1545 127
168 3300060353 Ga0501082_0157508 Ga0501082_0157508_1128_1520 127
169 3300005338 Ga0068868_100032049 Ga0068868_1000320493 128
170 3300005345 Ga0070692_11392882 Ga0070692_113928821 128
171 3300005353 Ga0070669_101023212 Ga0070669_1010232121 128
172 3300005354 Ga0070675_100323806 Ga0070675_1003238062 128
173 3300005366 Ga0070659_101338148 Ga0070659_1013381481 128
174 3300005434 Ga0070709_10552887 Ga0070709_105528872 128
175 3300005435 Ga0070714_100014775 Ga0070714_1000147754 128
176 3300005435 Ga0070714_100372219 Ga0070714_1003722192 128
177 3300005439 Ga0070711_100694671 Ga0070711_1006946712 128
178 3300005457 Ga0070662_100446691 Ga0070662_1004466912 128
179 3300005458 Ga0070681_11365549 Ga0070681_113655491 128
180 3300005467 Ga0070706_101107641 Ga0070706_1011076412 128
181 3300005518 Ga0070699_100481217 Ga0070699_1004812172 128
182 3300005546 Ga0070696_100025706 Ga0070696_1000257063 128
183 3300005549 Ga0070704_100472973 Ga0070704_1004729732 128
184 3300005563 Ga0068855_100030414 Ga0068855_1000304146 128
185 3300006844 Ga0075428_100020392 Ga0075428_1000203924 128
186 3300006847 Ga0075431_100377896 Ga0075431_1003778962 128
187 3300006847 Ga0075431_100973042 Ga0075431_1009730422 128
188 3300006852 Ga0075433_10001902 Ga0075433_100019022 128
189 3300006871 Ga0075434_100010976 Ga0075434_1000109762 128
190 3300006881 Ga0068865_100849058 Ga0068865_1008490582 128
191 3300007076 Ga0075435_100033158 Ga0075435_1000331584 128
192 3300007076 Ga0075435_100064283 Ga0075435_1000642833 128
193 3300007265 Ga0099794_10659372 Ga0099794_106593722 128
194 3300009093 Ga0105240_10065518 Ga0105240_100655183 128
195 3300009098 Ga0105245_10023879 Ga0105245_100238797 128
196 3300009147 Ga0114129_10024775 Ga0114129_1002477510 128
197 3300009147 Ga0114129_13052207 Ga0114129_130522071 128
198 3300009551 Ga0105238_10184118 Ga0105238_101841182 128
199 3300010375 Ga0105239_10012162 Ga0105239_100121628 128
200 3300012473 Ga0157340_1016111 Ga0157340_10161111 128
201 3300013100 Ga0157373_10122668 Ga0157373_101226683 128
202 3300013104 Ga0157370_10005267 Ga0157370_1000526710 128
203 3300013105 Ga0157369_10024309 Ga0157369_100243098 128
204 3300013307 Ga0157372_10003201 Ga0157372_1000320112 128
205 3300013307 Ga0157372_10910772 Ga0157372_109107722 128
206 3300014497 Ga0182008_10204210 Ga0182008_102042101 128
207 3300014497 Ga0182008_10237184 Ga0182008_102371842 128
208 3300025901 Ga0207688_10159246 Ga0207688_101592462 128
209 3300025912 Ga0207707_11106771 Ga0207707_111067712 128
210 3300025913 Ga0207695_10945766 Ga0207695_109457661 128
211 3300025922 Ga0207646_10647180 Ga0207646_106471802 128
212 3300025926 Ga0207659_10267665 Ga0207659_102676652 128
213 3300025927 Ga0207687_10088150 Ga0207687_100881502 128
214 3300025932 Ga0207690_10772863 Ga0207690_107728632 128
215 3300025933 Ga0207706_10635743 Ga0207706_106357432 128
216 3300025938 Ga0207704_10752326 Ga0207704_107523262 128
217 3300026023 Ga0207677_10160575 Ga0207677_101605752 128
218 3300026078 Ga0207702_10560990 Ga0207702_105609902 128
219 3300031995 Ga0307409_100182519 Ga0307409_1001825193 128
220 3300034817 Ga0373948_0111833 Ga0373948_0111833_25_420 128
221 3300035241 Ga0373961_0131545 Ga0373961_0131545_214_609 128
222 3300037312 Ga0395899_0003491 Ga0395899_0003491_10073_10480 128
223 3300037312 Ga0395899_0010989 Ga0395899_0010989_1520_1915 128
224 3300037418 Ga0395900_0021032 Ga0395900_0021032_2444_2851 128
225 3300037418 Ga0395900_0127100 Ga0395900_0127100_350_745 128
226 3300037418 Ga0395900_0127420 Ga0395900_0127420_1644_2039 128
227 3300037418 Ga0395900_0339979 Ga0395900_0339979_974_1393 128
228 3300037418 Ga0395900_0360643 Ga0395900_0360643_187_582 128
229 3300037466 Ga0395898_0008414 Ga0395898_0008414_5634_6029 128
230 3300037466 Ga0395898_0010080 Ga0395898_0010080_1385_1792 128
231 3300037466 Ga0395898_0054177 Ga0395898_0054177_841_1236 128
232 3300037466 Ga0395898_1494556 Ga0395898_1494556_55_450 128
233 3300037471 Ga0395905_0003417 Ga0395905_0003417_4783_5190 128
234 3300037471 Ga0395905_0527937 Ga0395905_0527937_517_912 128
235 3300037471 Ga0395905_1559594 Ga0395905_1559594_121_528 128
236 3300038443 Ga0395901_0004515 Ga0395901_0004515_4138_4533 128
237 3300038443 Ga0395901_0033107 Ga0395901_0033107_4805_5200 128
238 3300038443 Ga0395901_0039679 Ga0395901_0039679_1596_2003 128
239 3300038443 Ga0395901_0247302 Ga0395901_0247302_1002_1397 128
240 3300038443 Ga0395901_0395956 Ga0395901_0395956_995_1390 128
241 3300041512 Ga0451853_0068445 Ga0451853_0068445_1160_1555 128
242 3300041512 Ga0451853_2252194 Ga0451853_2252194_26_427 128
243 3300044901 Ga0466960_0216776 Ga0466960_0216776_29_448 128
244 3300044901 Ga0466960_0977787 Ga0466960_0977787_14_409 128
245 3300045051 Ga0451576_1395042 Ga0451576_1395042_83_478 128
246 3300046454 Ga0495592_0167162 Ga0495592_0167162_436_831 128
247 3300046463 Ga0495653_0203554 Ga0495653_0203554_700_1095 128
248 3300046500 Ga0495596_0133427 Ga0495596_0133427_459_854 128
249 3300046500 Ga0495596_0166179 Ga0495596_0166179_430_825 128
250 3300046506 Ga0495583_0437133 Ga0495583_0437133_69_464 128
251 3300046514 Ga0495618_0357863 Ga0495618_0357863_384_779 128
252 3300046516 Ga0495628_0188925 Ga0495628_0188925_874_1269 128
253 3300046525 Ga0495663_0120741 Ga0495663_0120741_49_468 128
254 3300046529 Ga0495652_0548991 Ga0495652_0548991_69_464 128
255 3300046538 Ga0495609_0137692 Ga0495609_0137692_464_883 128
256 3300046538 Ga0495609_0158948 Ga0495609_0158948_236_631 128
257 3300046539 Ga0495621_0406897 Ga0495621_0406897_147_542 128
258 3300046542 Ga0495597_0324588 Ga0495597_0324588_47_442 128
259 3300046681 Ga0495647_0185332 Ga0495647_0185332_82_477 128
260 3300046810 Ga0495660_0217081 Ga0495660_0217081_86_481 128
261 3300047321 Ga0495676_0419941 Ga0495676_0419941_437_832 128
262 3300047321 Ga0495676_1106103 Ga0495676_1106103_63_458 128
263 3300048905 Ga0496102_1241285 Ga0496102_1241285_22_417 128
264 3300048907 Ga0496104_1666089 Ga0496104_1666089_67_453 128
265 3300048912 Ga0496109_0314321 Ga0496109_0314321_394_813 128
266 3300048914 Ga0496111_0076253 Ga0496111_0076253_1886_2305 128
267 3300048915 Ga0496112_0653638 Ga0496112_0653638_516_902 128
268 3300049583 Ga0501067_0003969 Ga0501067_0003969_2986_3381 128
269 3300049585 Ga0501069_0001253 Ga0501069_0001253_5783_6178 128
270 3300050507 nmdc:mga05p37_1996107_c1 nmdc:mga05p37_1996107_c1_121_516 128
271 3300050507 nmdc:mga05p37_82271_c1 nmdc:mga05p37_82271_c1_1578_1973 128
272 3300050510 nmdc:mga06r32_299784_c1 nmdc:mga06r32_299784_c1_460_855 128
273 3300050510 nmdc:mga06r32_942361_c1 nmdc:mga06r32_942361_c1_219_614 128
274 3300050511 nmdc:mga08y16_547880_c1 nmdc:mga08y16_547880_c1_163_558 128
275 3300050512 nmdc:mga0n895_5512_c1 nmdc:mga0n895_5512_c1_1126_1521 128
276 3300050513 nmdc:mga0rr50_148189_c1 nmdc:mga0rr50_148189_c1_743_1138 128
277 3300050515 nmdc:mga0a205_221681_c1 nmdc:mga0a205_221681_c1_790_1185 128
278 3300050515 nmdc:mga0a205_48_c1 nmdc:mga0a205_48_c1_690_1085 128
279 3300005338 Ga0068868_101076576 Ga0068868_1010765762 129
280 3300005339 Ga0070660_101188058 Ga0070660_1011880582 129
281 3300005347 Ga0070668_100004587 Ga0070668_10000458711 129
282 3300005440 Ga0070705_100695205 Ga0070705_1006952052 129
283 3300005444 Ga0070694_100326031 Ga0070694_1003260312 129
284 3300005457 Ga0070662_100300641 Ga0070662_1003006412 129
285 3300005459 Ga0068867_100608994 Ga0068867_1006089942 129
286 3300005518 Ga0070699_100793164 Ga0070699_1007931642 129
287 3300005546 Ga0070696_100513831 Ga0070696_1005138312 129
288 3300005549 Ga0070704_100627815 Ga0070704_1006278151 129
289 3300005563 Ga0068855_100123305 Ga0068855_1001233052 129
290 3300005719 Ga0068861_100010835 Ga0068861_1000108353 129
291 3300006871 Ga0075434_100814167 Ga0075434_1008141672 129
292 3300009094 Ga0111539_10347564 Ga0111539_103475642 129
293 3300009098 Ga0105245_10927562 Ga0105245_109275621 129
294 3300009147 Ga0114129_10140167 Ga0114129_101401672 129
295 3300009148 Ga0105243_11505115 Ga0105243_115051152 129
296 3300009176 Ga0105242_10259469 Ga0105242_102594693 129
297 3300009553 Ga0105249_10028829 Ga0105249_100288297 129
298 3300010375 Ga0105239_10061963 Ga0105239_100619635 129
299 3300012494 Ga0157341_1025502 Ga0157341_10255021 129
300 3300012507 Ga0157342_1000948 Ga0157342_10009482 129
301 3300012513 Ga0157326_1003939 Ga0157326_10039392 129
302 3300013306 Ga0163162_10177656 Ga0163162_101776562 129
303 3300017792 Ga0163161_10090377 Ga0163161_100903772 129
304 3300025933 Ga0207706_10039818 Ga0207706_100398183 129
305 3300025961 Ga0207712_10009692 Ga0207712_100096926 129
306 3300025972 Ga0207668_10057826 Ga0207668_100578263 129
307 3300026089 Ga0207648_10206424 Ga0207648_102064243 129
308 3300026118 Ga0207675_100002514 Ga0207675_1000025143 129
309 3300037312 Ga0395899_0002345 Ga0395899_0002345_14910_15308 129
310 3300037418 Ga0395900_0009571 Ga0395900_0009571_2921_3319 129
311 3300037418 Ga0395900_0029574 Ga0395900_0029574_3550_3960 129
312 3300037466 Ga0395898_0013069 Ga0395898_0013069_462_860 129
313 3300037466 Ga0395898_0028833 Ga0395898_0028833_1518_1928 129
314 3300037471 Ga0395905_0002978 Ga0395905_0002978_10252_10650 129
315 3300037471 Ga0395905_0022285 Ga0395905_0022285_2282_2692 129
316 3300038443 Ga0395901_0000717 Ga0395901_0000717_8504_8902 129
317 3300038443 Ga0395901_0022624 Ga0395901_0022624_1927_2337 129
318 3300038443 Ga0395901_0353912 Ga0395901_0353912_890_1288 129
319 3300044694 Ga0466963_0118858 Ga0466963_0118858_373_762 129
320 3300045051 Ga0451576_0094219 Ga0451576_0094219_343_753 129
321 3300045976 Ga0466967_2370510 Ga0466967_2370510_31_420 129
322 3300046491 Ga0495584_0132438 Ga0495584_0132438_489_899 129
323 3300046525 Ga0495663_0053757 Ga0495663_0053757_546_944 129
324 3300049742 Ga0501080_1018286 Ga0501080_1018286_283_681 129
325 3300050507 nmdc:mga05p37_125974_c1 nmdc:mga05p37_125974_c1_194_604 129
326 3300050511 nmdc:mga08y16_238431_c1 nmdc:mga08y16_238431_c1_1210_1620 129
327 3300050513 nmdc:mga0rr50_758199_c1 nmdc:mga0rr50_758199_c1_314_724 129
328 3300050515 nmdc:mga0a205_147663_c1 nmdc:mga0a205_147663_c1_780_1190 129
329 3300005327 Ga0070658_10002978 Ga0070658_100029787 130
330 3300005329 Ga0070683_100166147 Ga0070683_1001661472 130
331 3300005339 Ga0070660_100024254 Ga0070660_1000242542 130
332 3300005435 Ga0070714_100518793 Ga0070714_1005187932 130
333 3300005436 Ga0070713_100956746 Ga0070713_1009567461 130
334 3300005445 Ga0070708_100344253 Ga0070708_1003442532 130
335 3300005445 Ga0070708_101645158 Ga0070708_1016451581 130
336 3300005455 Ga0070663_100953319 Ga0070663_1009533191 130
337 3300005458 Ga0070681_10057662 Ga0070681_100576625 130
338 3300005467 Ga0070706_100214090 Ga0070706_1002140902 130
339 3300005468 Ga0070707_100012248 Ga0070707_1000122484 130
340 3300005471 Ga0070698_100043593 Ga0070698_1000435935 130
341 3300005518 Ga0070699_100021499 Ga0070699_1000214996 130
342 3300005530 Ga0070679_100038293 Ga0070679_1000382933 130
343 3300005535 Ga0070684_100481202 Ga0070684_1004812022 130
344 3300005539 Ga0068853_100397272 Ga0068853_1003972722 130
345 3300005546 Ga0070696_100517281 Ga0070696_1005172811 130
346 3300005563 Ga0068855_100109642 Ga0068855_1001096425 130
347 3300006871 Ga0075434_100033548 Ga0075434_1000335482 130
348 3300007076 Ga0075435_100022114 Ga0075435_1000221143 130
349 3300009147 Ga0114129_10105197 Ga0114129_101051975 130
350 3300009174 Ga0105241_10728702 Ga0105241_107287022 130
351 3300013102 Ga0157371_10619873 Ga0157371_106198731 130
352 3300025910 Ga0207684_10182653 Ga0207684_101826532 130
353 3300025912 Ga0207707_10203996 Ga0207707_102039962 130
354 3300025919 Ga0207657_10004543 Ga0207657_1000454314 130
355 3300025921 Ga0207652_10068304 Ga0207652_100683044 130
356 3300025922 Ga0207646_10052442 Ga0207646_100524422 130
357 3300025932 Ga0207690_10313780 Ga0207690_103137802 130
358 3300025944 Ga0207661_10085944 Ga0207661_100859442 130
359 3300045976 Ga0466967_0572572 Ga0466967_0572572_337_759 130
360 3300046462 Ga0495651_0097705 Ga0495651_0097705_957_1358 130
361 3300046477 Ga0495664_0562395 Ga0495664_0562395_249_650 130
362 3300046511 Ga0495608_0082471 Ga0495608_0082471_885_1286 130
363 3300046514 Ga0495618_0074131 Ga0495618_0074131_617_1018 130
364 3300046516 Ga0495628_0069045 Ga0495628_0069045_66_467 130
365 3300046529 Ga0495652_0072646 Ga0495652_0072646_619_1020 130
366 3300046543 Ga0495645_0056371 Ga0495645_0056371_297_698 130
367 3300047319 Ga0495674_0137952 Ga0495674_0137952_1031_1432 130
368 3300047319 Ga0495674_0218038 Ga0495674_0218038_51_452 130
369 3300047322 Ga0495680_0215307 Ga0495680_0215307_948_1349 130
370 3300047322 Ga0495680_0706131 Ga0495680_0706131_69_470 130
371 3300047471 Ga0495684_0024605 Ga0495684_0024605_1115_1516 130
372 3300048903 Ga0496100_0015564 Ga0496100_0015564_2539_2943 130
373 3300048915 Ga0496112_0003803 Ga0496112_0003803_5348_5740 130
374 3300048916 Ga0496113_1016151 Ga0496113_1016151_79_471 130
375 3300050507 nmdc:mga05p37_1013964_c1 nmdc:mga05p37_1013964_c1_331_741 130
376 3300050513 nmdc:mga0rr50_17926_c1 nmdc:mga0rr50_17926_c1_2289_2699 130
377 3300053078 Ga0495612_0084094 Ga0495612_0084094_188_589 130
378 3300053084 Ga0495595_0082022 Ga0495595_0082022_1104_1505 130
379 3300053084 Ga0495595_0383787 Ga0495595_0383787_71_472 130
380 3300053085 Ga0495619_0030644 Ga0495619_0030644_2311_2712 130
381 3300053085 Ga0495619_0074519 Ga0495619_0074519_824_1225 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

25

101

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.9036 1 127
2rfl-assembly5.cif.gz_E crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.885 2 124
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8775 1 127
2rfl-assembly3.cif.gz_C crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8771 2 124
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8698 2 124
ID Description Score Start End Superfamily
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9102 7 109 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9091 1 127 3.40.50.1240
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8956 2 124 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8828 1 127 3.40.50.1240
af_Q9LW33_109_250_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8803 8 73 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A538L8E2-F1-model_v4 Phosphohistidine phosphatase 0.9954 1 127
AF-A0A538L8E2-F1-model_v4 Phosphohistidine phosphatase 0.9875 1 127
AF-A0A538G9M5-F1-model_v4 Phosphohistidine phosphatase SixA 0.9805 1 130 GO:0005737
GO:0036211
GO:0101006
AF-A0A538G9M5-F1-model_v4 Phosphohistidine phosphatase SixA 0.9732 1 130 GO:0005737
GO:0036211
GO:0101006
AF-A0A3M1QMG0-F1-model_v4 Histidine phosphatase family protein 0.9448 1 124 GO:0005737
GO:0016791

Feature Viewer

pLDDT pTM Quality
97.19 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map