F428893
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 381 | 209 | 762 | 272 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100000531|Ga0070708_1000005314 |
| Length | 317 |
| Sequence | MNRRLLSGVRVLVGRARHQASVLSAELRKHGAHVIEIPFIEIRKPRSFKRLDDALKSLREYDWLILTSVNGAEAMWERLGKLKGRAGLGEGHDFSRAAKGRKQNTPLAAETPRSKCLRVAAIGPATKRAIERRGIKVEVVPREYVAESVVRSLRQRVKGKRVLLIRAKVARDVIPRELRQAGAHVDVVEAYETVVPRSSRSRLRAALKNSRRPNVITFTSSSTVRNFVALLGGSSLQATLRDQRSRGRGAPHHPWIDSVQFASIGPVTSATLQELGFPVHIEAKQYTIPGLVDAVVKAFGVHSQMTNRDLQTVICKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 90 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 91 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 92 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 93 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 94 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 159 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 171 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 176 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 177 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 178 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 179 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 200 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 201 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 206 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 209 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0.79 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.51 |
| Rhizosphere | 93.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070708_100000531 | 3300005445 | Bacteria | 28697 |
| 2 | JGI24752J21851_1007244 | 3300001976 | Unclassified | 1447 |
| 3 | rootL2_10043929 | 3300003322 | Bacteria | 1622 |
| 4 | Ga0065712_10153189 | 3300005290 | Unclassified | 1354 |
| 5 | Ga0070658_10076681 | 3300005327 | Unclassified | 2742 |
| 6 | Ga0070683_100004265 | 3300005329 | Bacteria | 11732 |
| 7 | Ga0070683_100023583 | 3300005329 | Bacteria | 5505 |
| 8 | Ga0070670_100006784 | 3300005331 | Bacteria | 9695 |
| 9 | Ga0070670_100009095 | 3300005331 | Bacteria | 8489 |
| 10 | Ga0068869_100427010 | 3300005334 | Unclassified | 1094 |
| 11 | Ga0070680_100151733 | 3300005336 | Bacteria | 1945 |
| 12 | Ga0070682_100035984 | 3300005337 | Bacteria | 3025 |
| 13 | Ga0068868_100207367 | 3300005338 | Bacteria | 1636 |
| 14 | Ga0070660_100581616 | 3300005339 | Bacteria | 935 |
| 15 | Ga0070689_100002279 | 3300005340 | Bacteria | 12479 |
| 16 | Ga0070689_100333365 | 3300005340 | Unclassified | 1269 |
| 17 | Ga0070661_100001267 | 3300005344 | Bacteria | 17752 |
| 18 | Ga0070661_100093642 | 3300005344 | Bacteria | 2226 |
| 19 | Ga0070692_10018953 | 3300005345 | Bacteria | 3316 |
| 20 | Ga0070674_100006696 | 3300005356 | Bacteria | 6740 |
| 21 | Ga0070673_100001501 | 3300005364 | Bacteria | 13696 |
| 22 | Ga0070688_100034069 | 3300005365 | Bacteria | 3081 |
| 23 | Ga0070688_100234584 | 3300005365 | Unclassified | 1299 |
| 24 | Ga0070659_100268647 | 3300005366 | Unclassified | 1416 |
| 25 | Ga0070709_10068927 | 3300005434 | Bacteria | 2276 |
| 26 | Ga0070709_10120638 | 3300005434 | Bacteria | 1777 |
| 27 | Ga0070709_10332271 | 3300005434 | Bacteria | 1118 |
| 28 | Ga0070714_100008343 | 3300005435 | Bacteria | 8082 |
| 29 | Ga0070714_100065123 | 3300005435 | Bacteria | 3138 |
| 30 | Ga0070714_100115050 | 3300005435 | Bacteria | 2387 |
| 31 | Ga0070714_100522442 | 3300005435 | Unclassified | 1134 |
| 32 | Ga0070714_100786965 | 3300005435 | Bacteria | 921 |
| 33 | Ga0070713_100000297 | 3300005436 | Bacteria | 32896 |
| 34 | Ga0070713_100006212 | 3300005436 | Bacteria | 8264 |
| 35 | Ga0070713_100006371 | 3300005436 | Bacteria | 8174 |
| 36 | Ga0070713_100054926 | 3300005436 | Unclassified | 3307 |
| 37 | Ga0070713_100068595 | 3300005436 | Bacteria | 2988 |
| 38 | Ga0070713_100093577 | 3300005436 | Bacteria | 2590 |
| 39 | Ga0070713_100118903 | 3300005436 | Bacteria | 2314 |
| 40 | Ga0070710_10008966 | 3300005437 | Bacteria | 4886 |
| 41 | Ga0070711_100005643 | 3300005439 | Bacteria | 7492 |
| 42 | Ga0070711_100005742 | 3300005439 | Bacteria | 7444 |
| 43 | Ga0070705_100241075 | 3300005440 | Unclassified | 1263 |
| 44 | Ga0070708_100011611 | 3300005445 | Bacteria | 7170 |
| 45 | Ga0070678_100028788 | 3300005456 | Unclassified | 3794 |
| 46 | Ga0070681_10040513 | 3300005458 | Unclassified | 4667 |
| 47 | Ga0070681_10058005 | 3300005458 | Bacteria | 3852 |
| 48 | Ga0070681_10110356 | 3300005458 | Bacteria | 2690 |
| 49 | Ga0068867_100017298 | 3300005459 | Bacteria | 5120 |
| 50 | Ga0070685_10005181 | 3300005466 | Bacteria | 6611 |
| 51 | Ga0070706_100017794 | 3300005467 | Bacteria | 6557 |
| 52 | Ga0070706_100099946 | 3300005467 | Bacteria | 2695 |
| 53 | Ga0070706_100111636 | 3300005467 | Unclassified | 2544 |
| 54 | Ga0070707_100046621 | 3300005468 | Bacteria | 4148 |
| 55 | Ga0070699_100006620 | 3300005518 | Bacteria | 10074 |
| 56 | Ga0070679_100218629 | 3300005530 | Bacteria | 1867 |
| 57 | Ga0070684_100026021 | 3300005535 | Bacteria | 4925 |
| 58 | Ga0070684_100086644 | 3300005535 | Unclassified | 2780 |
| 59 | Ga0070684_100312724 | 3300005535 | Bacteria | 1442 |
| 60 | Ga0070697_100003849 | 3300005536 | Bacteria | 11524 |
| 61 | Ga0068853_100237790 | 3300005539 | Bacteria | 1668 |
| 62 | Ga0070672_100051070 | 3300005543 | Bacteria | 3223 |
| 63 | Ga0070696_100086924 | 3300005546 | Bacteria | 2220 |
| 64 | Ga0070693_100040592 | 3300005547 | Bacteria | 2613 |
| 65 | Ga0070693_100233593 | 3300005547 | Unclassified | 1211 |
| 66 | Ga0068855_100011876 | 3300005563 | Bacteria | 10532 |
| 67 | Ga0068855_100014061 | 3300005563 | Bacteria | 9648 |
| 68 | Ga0070664_100000302 | 3300005564 | Bacteria | 35799 |
| 69 | Ga0070664_100136759 | 3300005564 | Unclassified | 2155 |
| 70 | Ga0068857_100000968 | 3300005577 | Bacteria | 21942 |
| 71 | Ga0068857_100007012 | 3300005577 | Bacteria | 9697 |
| 72 | Ga0068854_100105673 | 3300005578 | Bacteria | 2117 |
| 73 | Ga0068856_100007876 | 3300005614 | Bacteria | 10402 |
| 74 | Ga0068856_100013094 | 3300005614 | Bacteria | 8032 |
| 75 | Ga0068856_100043981 | 3300005614 | Bacteria | 4393 |
| 76 | Ga0068856_100273890 | 3300005614 | Bacteria | 1704 |
| 77 | Ga0070702_100089965 | 3300005615 | Bacteria | 1859 |
| 78 | Ga0068852_100035390 | 3300005616 | Bacteria | 4165 |
| 79 | Ga0068859_100000193 | 3300005617 | Bacteria | 59184 |
| 80 | Ga0068859_100034595 | 3300005617 | Bacteria | 5070 |
| 81 | Ga0068864_100000449 | 3300005618 | Bacteria | 35592 |
| 82 | Ga0068866_10003295 | 3300005718 | Bacteria | 6633 |
| 83 | Ga0068870_10008154 | 3300005840 | Unclassified | 4697 |
| 84 | Ga0068870_10094149 | 3300005840 | Bacteria | 1681 |
| 85 | Ga0068863_100010687 | 3300005841 | Bacteria | 8915 |
| 86 | Ga0068858_100025207 | 3300005842 | Bacteria | 5534 |
| 87 | Ga0068860_100018866 | 3300005843 | Bacteria | 6702 |
| 88 | Ga0068862_100019872 | 3300005844 | Bacteria | 5608 |
| 89 | Ga0070717_10012414 | 3300006028 | Bacteria | 6496 |
| 90 | Ga0070717_10014907 | 3300006028 | Bacteria | 5986 |
| 91 | Ga0070717_10018158 | 3300006028 | Bacteria | 5489 |
| 92 | Ga0070717_10070696 | 3300006028 | Bacteria | 2909 |
| 93 | Ga0070717_10078581 | 3300006028 | Unclassified | 2765 |
| 94 | Ga0070717_10388695 | 3300006028 | Unclassified | 1252 |
| 95 | Ga0070717_10429731 | 3300006028 | Bacteria | 1188 |
| 96 | Ga0070717_10524533 | 3300006028 | Unclassified | 1071 |
| 97 | Ga0070715_10089718 | 3300006163 | Bacteria | 1412 |
| 98 | Ga0070716_100209358 | 3300006173 | Bacteria | 1302 |
| 99 | Ga0070712_100024684 | 3300006175 | Unclassified | 3987 |
| 100 | Ga0070712_100048707 | 3300006175 | Unclassified | 2939 |
| 101 | Ga0070712_100064773 | 3300006175 | Bacteria | 2592 |
| 102 | Ga0070712_100326127 | 3300006175 | Unclassified | 1250 |
| 103 | Ga0097621_100018575 | 3300006237 | Bacteria | 5315 |
| 104 | Ga0068871_100015710 | 3300006358 | Bacteria | 5679 |
| 105 | Ga0068871_100343610 | 3300006358 | Bacteria | 1318 |
| 106 | Ga0068865_100077427 | 3300006881 | Bacteria | 2376 |
| 107 | Ga0097620_100000193 | 3300006931 | Bacteria | 59184 |
| 108 | Ga0097620_100034594 | 3300006931 | Bacteria | 5070 |
| 109 | Ga0105250_10010561 | 3300009092 | Bacteria | 3846 |
| 110 | Ga0105240_10027440 | 3300009093 | Bacteria | 7452 |
| 111 | Ga0105240_10256465 | 3300009093 | Bacteria | 2020 |
| 112 | Ga0105240_10546346 | 3300009093 | Unclassified | 1282 |
| 113 | Ga0111539_10556429 | 3300009094 | Bacteria | 1336 |
| 114 | Ga0105245_10001545 | 3300009098 | Bacteria | 20877 |
| 115 | Ga0105245_10112497 | 3300009098 | Bacteria | 2534 |
| 116 | Ga0105245_10195250 | 3300009098 | Unclassified | 1941 |
| 117 | Ga0105245_10218027 | 3300009098 | Unclassified | 1840 |
| 118 | Ga0105247_10003382 | 3300009101 | Bacteria | 10429 |
| 119 | Ga0105247_10332015 | 3300009101 | Bacteria | 1064 |
| 120 | Ga0105241_10090640 | 3300009174 | Bacteria | 2411 |
| 121 | Ga0105241_10137714 | 3300009174 | Bacteria | 1984 |
| 122 | Ga0105248_10531947 | 3300009177 | Bacteria | 1326 |
| 123 | Ga0105248_10595406 | 3300009177 | Bacteria | 1247 |
| 124 | Ga0105237_10145303 | 3300009545 | Unclassified | 2366 |
| 125 | Ga0105237_10370855 | 3300009545 | Bacteria | 1436 |
| 126 | Ga0105238_10120640 | 3300009551 | Bacteria | 2601 |
| 127 | Ga0105238_10151503 | 3300009551 | Unclassified | 2294 |
| 128 | Ga0105249_10097981 | 3300009553 | Unclassified | 2753 |
| 129 | Ga0105249_10124337 | 3300009553 | Unclassified | 2455 |
| 130 | Ga0105239_10106091 | 3300010375 | Bacteria | 3112 |
| 131 | Ga0105239_10174874 | 3300010375 | Unclassified | 2401 |
| 132 | Ga0105246_10001225 | 3300011119 | Bacteria | 15024 |
| 133 | Ga0157373_10000869 | 3300013100 | Bacteria | 23380 |
| 134 | Ga0157373_10059229 | 3300013100 | Unclassified | 2713 |
| 135 | Ga0157373_10108774 | 3300013100 | Bacteria | 1949 |
| 136 | Ga0157371_10353427 | 3300013102 | Unclassified | 1070 |
| 137 | Ga0157369_10023082 | 3300013105 | Bacteria | 6932 |
| 138 | Ga0157369_10064344 | 3300013105 | Unclassified | 3950 |
| 139 | Ga0157369_10123753 | 3300013105 | Unclassified | 2743 |
| 140 | Ga0157369_10196508 | 3300013105 | Bacteria | 2118 |
| 141 | Ga0157369_10375778 | 3300013105 | Bacteria | 1475 |
| 142 | Ga0157369_10448982 | 3300013105 | Bacteria | 1335 |
| 143 | Ga0157374_10001614 | 3300013296 | Bacteria | 18911 |
| 144 | Ga0157378_10000070 | 3300013297 | Bacteria | 91609 |
| 145 | Ga0157378_10049499 | 3300013297 | Bacteria | 3739 |
| 146 | Ga0163162_10489606 | 3300013306 | Unclassified | 1361 |
| 147 | Ga0163162_10964472 | 3300013306 | Bacteria | 963 |
| 148 | Ga0157372_10000696 | 3300013307 | Bacteria | 36907 |
| 149 | Ga0157372_10023120 | 3300013307 | Bacteria | 6736 |
| 150 | Ga0157372_10031560 | 3300013307 | Bacteria | 5801 |
| 151 | Ga0157372_10457893 | 3300013307 | Bacteria | 1487 |
| 152 | Ga0163163_10000595 | 3300014325 | Bacteria | 31716 |
| 153 | Ga0182008_10012498 | 3300014497 | Bacteria | 4481 |
| 154 | Ga0157377_10001328 | 3300014745 | Bacteria | 10595 |
| 155 | Ga0157379_10165939 | 3300014968 | Bacteria | 1993 |
| 156 | Ga0182006_1087815 | 3300015261 | Unclassified | 1123 |
| 157 | Ga0182007_10045172 | 3300015262 | Unclassified | 1461 |
| 158 | Ga0163161_10002771 | 3300017792 | Bacteria | 12447 |
| 159 | Ga0213873_10002197 | 3300021358 | Bacteria | 3352 |
| 160 | Ga0224570_100020 | 3300022730 | Bacteria | 7321 |
| 161 | Ga0224569_100348 | 3300022732 | Bacteria | 3886 |
| 162 | Ga0224571_100652 | 3300022734 | Bacteria | 1990 |
| 163 | Ga0224571_100699 | 3300022734 | Unclassified | 1941 |
| 164 | Ga0228598_1018843 | 3300024227 | Unclassified | 1362 |
| 165 | Ga0207697_10054481 | 3300025315 | Unclassified | 1657 |
| 166 | Ga0207682_10010174 | 3300025893 | Unclassified | 3691 |
| 167 | Ga0207692_10012205 | 3300025898 | Bacteria | 3683 |
| 168 | Ga0207692_10114082 | 3300025898 | Bacteria | 1503 |
| 169 | Ga0207642_10007711 | 3300025899 | Bacteria | 3646 |
| 170 | Ga0207642_10117428 | 3300025899 | Bacteria | 1366 |
| 171 | Ga0207710_10019694 | 3300025900 | Unclassified | 2880 |
| 172 | Ga0207688_10006690 | 3300025901 | Bacteria | 6273 |
| 173 | Ga0207647_10004204 | 3300025904 | Bacteria | 10677 |
| 174 | Ga0207699_10018730 | 3300025906 | Unclassified | 3676 |
| 175 | Ga0207699_10222011 | 3300025906 | Bacteria | 1290 |
| 176 | Ga0207699_10441177 | 3300025906 | Unclassified | 932 |
| 177 | Ga0207645_10000273 | 3300025907 | Bacteria | 42696 |
| 178 | Ga0207643_10006633 | 3300025908 | Bacteria | 6207 |
| 179 | Ga0207643_10137451 | 3300025908 | Unclassified | 1458 |
| 180 | Ga0207705_10088616 | 3300025909 | Unclassified | 2264 |
| 181 | Ga0207684_10001808 | 3300025910 | Bacteria | 22386 |
| 182 | Ga0207684_10257699 | 3300025910 | Bacteria | 1505 |
| 183 | Ga0207684_10329632 | 3300025910 | Unclassified | 1315 |
| 184 | Ga0207654_10031235 | 3300025911 | Bacteria | 2932 |
| 185 | Ga0207654_10047782 | 3300025911 | Unclassified | 2446 |
| 186 | Ga0207707_10024646 | 3300025912 | Bacteria | 5265 |
| 187 | Ga0207707_10073028 | 3300025912 | Unclassified | 2991 |
| 188 | Ga0207707_10128657 | 3300025912 | Bacteria | 2214 |
| 189 | Ga0207695_10014120 | 3300025913 | Bacteria | 9480 |
| 190 | Ga0207695_10105622 | 3300025913 | Bacteria | 2803 |
| 191 | Ga0207671_10044318 | 3300025914 | Bacteria | 3290 |
| 192 | Ga0207671_10108374 | 3300025914 | Bacteria | 2111 |
| 193 | Ga0207693_10001787 | 3300025915 | Bacteria | 18842 |
| 194 | Ga0207693_10019072 | 3300025915 | Bacteria | 5458 |
| 195 | Ga0207693_10106352 | 3300025915 | Bacteria | 2201 |
| 196 | Ga0207693_10107505 | 3300025915 | Bacteria | 2188 |
| 197 | Ga0207693_10144169 | 3300025915 | Bacteria | 1873 |
| 198 | Ga0207663_10006222 | 3300025916 | Bacteria | 6089 |
| 199 | Ga0207660_10148129 | 3300025917 | Bacteria | 1801 |
| 200 | Ga0207662_10011782 | 3300025918 | Bacteria | 4858 |
| 201 | Ga0207657_10010598 | 3300025919 | Bacteria | 9186 |
| 202 | Ga0207649_10003850 | 3300025920 | Bacteria | 8180 |
| 203 | Ga0207681_10091568 | 3300025923 | Unclassified | 2172 |
| 204 | Ga0207694_10066982 | 3300025924 | Bacteria | 2802 |
| 205 | Ga0207694_10134072 | 3300025924 | Bacteria | 1987 |
| 206 | Ga0207650_10000036 | 3300025925 | Bacteria | 214579 |
| 207 | Ga0207650_10013308 | 3300025925 | Bacteria | 5694 |
| 208 | Ga0207687_10003874 | 3300025927 | Bacteria | 10050 |
| 209 | Ga0207687_10046351 | 3300025927 | Unclassified | 3009 |
| 210 | Ga0207687_10556994 | 3300025927 | Unclassified | 962 |
| 211 | Ga0207700_10000271 | 3300025928 | Bacteria | 30901 |
| 212 | Ga0207700_10009665 | 3300025928 | Bacteria | 6038 |
| 213 | Ga0207700_10060933 | 3300025928 | Unclassified | 2860 |
| 214 | Ga0207700_10221995 | 3300025928 | Bacteria | 1602 |
| 215 | Ga0207664_10019928 | 3300025929 | Bacteria | 4965 |
| 216 | Ga0207664_10028517 | 3300025929 | Unclassified | 4243 |
| 217 | Ga0207690_10624606 | 3300025932 | Unclassified | 881 |
| 218 | Ga0207706_10245785 | 3300025933 | Unclassified | 1564 |
| 219 | Ga0207704_10168688 | 3300025938 | Unclassified | 1567 |
| 220 | Ga0207665_10012629 | 3300025939 | Bacteria | 5551 |
| 221 | Ga0207665_10022312 | 3300025939 | Bacteria | 4164 |
| 222 | Ga0207711_10527896 | 3300025941 | Bacteria | 1101 |
| 223 | Ga0207689_10001841 | 3300025942 | Bacteria | 20076 |
| 224 | Ga0207661_10000527 | 3300025944 | Bacteria | 24587 |
| 225 | Ga0207661_10019008 | 3300025944 | Bacteria | 5114 |
| 226 | Ga0207667_10012831 | 3300025949 | Bacteria | 9628 |
| 227 | Ga0207667_10051574 | 3300025949 | Bacteria | 4336 |
| 228 | Ga0207667_10189927 | 3300025949 | Bacteria | 2108 |
| 229 | Ga0207667_10679905 | 3300025949 | Bacteria | 1033 |
| 230 | Ga0207651_10061948 | 3300025960 | Unclassified | 2604 |
| 231 | Ga0207668_10076798 | 3300025972 | Bacteria | 2406 |
| 232 | Ga0207640_10003068 | 3300025981 | Bacteria | 8997 |
| 233 | Ga0207677_10056893 | 3300026023 | Bacteria | 2682 |
| 234 | Ga0207677_10108288 | 3300026023 | Bacteria | 2063 |
| 235 | Ga0207677_10111580 | 3300026023 | Unclassified | 2038 |
| 236 | Ga0207703_10045618 | 3300026035 | Unclassified | 3526 |
| 237 | Ga0207703_10669884 | 3300026035 | Bacteria | 985 |
| 238 | Ga0207639_10049871 | 3300026041 | Unclassified | 3176 |
| 239 | Ga0207678_10006194 | 3300026067 | Bacteria | 10629 |
| 240 | Ga0207702_10001252 | 3300026078 | Bacteria | 25632 |
| 241 | Ga0207702_10003843 | 3300026078 | Bacteria | 13546 |
| 242 | Ga0207702_10041026 | 3300026078 | Unclassified | 3880 |
| 243 | Ga0207702_10163481 | 3300026078 | Bacteria | 2034 |
| 244 | Ga0207702_10573895 | 3300026078 | Bacteria | 1105 |
| 245 | Ga0207641_10000009 | 3300026088 | Bacteria | 407901 |
| 246 | Ga0207641_10057191 | 3300026088 | Bacteria | 3317 |
| 247 | Ga0207648_10000326 | 3300026089 | Bacteria | 52122 |
| 248 | Ga0207648_10070924 | 3300026089 | Bacteria | 3037 |
| 249 | Ga0207676_10000092 | 3300026095 | Bacteria | 80704 |
| 250 | Ga0207676_10003940 | 3300026095 | Bacteria | 10481 |
| 251 | Ga0207676_10241487 | 3300026095 | Unclassified | 1621 |
| 252 | Ga0207674_10000016 | 3300026116 | Bacteria | 182470 |
| 253 | Ga0207674_10002336 | 3300026116 | Bacteria | 23992 |
| 254 | Ga0207674_10131755 | 3300026116 | Unclassified | 2463 |
| 255 | Ga0207675_100023148 | 3300026118 | Bacteria | 5777 |
| 256 | Ga0207683_10000359 | 3300026121 | Bacteria | 41891 |
| 257 | Ga0265356_1000205 | 3300028017 | Bacteria | 11207 |
| 258 | Ga0265356_1003929 | 3300028017 | Bacteria | 1840 |
| 259 | Ga0268266_10137002 | 3300028379 | Unclassified | 2193 |
| 260 | Ga0268265_10019741 | 3300028380 | Unclassified | 4691 |
| 261 | Ga0268264_10018752 | 3300028381 | Bacteria | 5657 |
| 262 | Ga0268264_10247719 | 3300028381 | Unclassified | 1654 |
| 263 | Ga0265338_10002372 | 3300028800 | Bacteria | 28403 |
| 264 | Ga0265338_10032870 | 3300028800 | Bacteria | 5049 |
| 265 | Ga0265338_10034070 | 3300028800 | Unclassified | 4930 |
| 266 | Ga0265338_10137859 | 3300028800 | Bacteria | 1915 |
| 267 | Ga0265762_1008180 | 3300030760 | Bacteria | 1861 |
| 268 | Ga0265760_10000115 | 3300031090 | Bacteria | 20404 |
| 269 | Ga0265760_10009775 | 3300031090 | Unclassified | 2739 |
| 270 | Ga0265325_10007792 | 3300031241 | Bacteria | 6378 |
| 271 | Ga0265325_10009096 | 3300031241 | Bacteria | 5821 |
| 272 | Ga0265340_10008156 | 3300031247 | Bacteria | 5667 |
| 273 | Ga0265340_10015758 | 3300031247 | Bacteria | 3922 |
| 274 | Ga0265339_10012996 | 3300031249 | Bacteria | 5062 |
| 275 | Ga0265316_10016687 | 3300031344 | Bacteria | 6365 |
| 276 | Ga0265313_10005956 | 3300031595 | Bacteria | 8810 |
| 277 | Ga0265314_10177986 | 3300031711 | Bacteria | 1277 |
| 278 | Ga0265342_10079964 | 3300031712 | Bacteria | 1890 |
| 279 | Ga0373926_0007726 | 3300035083 | Bacteria | 3583 |
| 280 | Ga0373926_0070990 | 3300035083 | Unclassified | 1279 |
| 281 | Ga0373944_0008409 | 3300035089 | Unclassified | 2788 |
| 282 | Ga0373944_0063534 | 3300035089 | Unclassified | 1189 |
| 283 | Ga0373923_0001213 | 3300035111 | Bacteria | 7226 |
| 284 | Ga0373923_0003997 | 3300035111 | Bacteria | 4826 |
| 285 | Ga0373936_0005330 | 3300035113 | Bacteria | 4842 |
| 286 | Ga0373936_0009342 | 3300035113 | Bacteria | 3695 |
| 287 | Ga0373936_0026370 | 3300035113 | Bacteria | 2275 |
| 288 | Ga0373936_0089230 | 3300035113 | Unclassified | 1291 |
| 289 | Ga0373945_0005015 | 3300035116 | Bacteria | 4217 |
| 290 | Ga0373945_0040917 | 3300035116 | Bacteria | 1674 |
| 291 | Ga0373956_0119340 | 3300035119 | Bacteria | 1231 |
| 292 | Ga0373956_0174698 | 3300035119 | Unclassified | 1014 |
| 293 | Ga0373943_0000395 | 3300035170 | Bacteria | 18292 |
| 294 | Ga0373943_0228897 | 3300035170 | Bacteria | 1038 |
| 295 | Ga0373946_0017605 | 3300035171 | Bacteria | 2735 |
| 296 | Ga0373946_0030001 | 3300035171 | Bacteria | 2168 |
| 297 | Ga0373946_0138050 | 3300035171 | Bacteria | 1127 |
| 298 | Ga0373955_0011380 | 3300035172 | Bacteria | 4237 |
| 299 | Ga0373955_0145255 | 3300035172 | Bacteria | 1393 |
| 300 | Ga0373955_0361402 | 3300035172 | Bacteria | 880 |
| 301 | Ga0373924_0000096 | 3300035410 | Bacteria | 24458 |
| 302 | Ga0373924_0008989 | 3300035410 | Bacteria | 3652 |
| 303 | Ga0373924_0105582 | 3300035410 | Unclassified | 1214 |
| 304 | Ga0373924_0120283 | 3300035410 | Bacteria | 1139 |
| 305 | Ga0373931_0086654 | 3300035691 | Bacteria | 1738 |
| 306 | Ga0373935_0012557 | 3300035692 | Bacteria | 5097 |
| 307 | Ga0373935_0026061 | 3300035692 | Bacteria | 3605 |
| 308 | Ga0373935_0311150 | 3300035692 | Bacteria | 1115 |
| 309 | Ga0373927_0000099 | 3300035695 | Bacteria | 65306 |
| 310 | Ga0373927_0020640 | 3300035695 | Bacteria | 4319 |
| 311 | Ga0373927_0056771 | 3300035695 | Bacteria | 2532 |
| 312 | Ga0373927_0209595 | 3300035695 | Unclassified | 1280 |
| 313 | Ga0373933_0175424 | 3300035724 | Unclassified | 1365 |
| 314 | Ga0373933_0251614 | 3300035724 | Bacteria | 1138 |
| 315 | Ga0373933_0389473 | 3300035724 | Bacteria | 908 |
| 316 | Ga0373947_0001644 | 3300035725 | Bacteria | 13692 |
| 317 | Ga0373947_0011216 | 3300035725 | Bacteria | 5145 |
| 318 | Ga0373947_0106404 | 3300035725 | Bacteria | 1768 |
| 319 | Ga0373947_0132664 | 3300035725 | Bacteria | 1591 |
| 320 | Ga0373937_0000219 | 3300036401 | Bacteria | 55186 |
| 321 | Ga0373937_0039349 | 3300036401 | Bacteria | 4309 |
| 322 | Ga0373937_0083175 | 3300036401 | Bacteria | 2961 |
| 323 | Ga0373937_0083477 | 3300036401 | Bacteria | 2955 |
| 324 | Ga0373937_0562263 | 3300036401 | Bacteria | 1083 |
| 325 | Ga0373925_0000227 | 3300037068 | Bacteria | 60089 |
| 326 | Ga0373925_0006892 | 3300037068 | Bacteria | 8318 |
| 327 | Ga0373925_0016786 | 3300037068 | Bacteria | 5301 |
| 328 | Ga0373925_0151150 | 3300037068 | Bacteria | 1823 |
| 329 | Ga0373925_0204453 | 3300037068 | Bacteria | 1571 |
| 330 | Ga0436361_1199371 | 3300039447 | Bacteria | 1059 |
| 331 | Ga0436363_0342414 | 3300039450 | Bacteria | 4523 |
| 332 | Ga0436362_0147413 | 3300039453 | Bacteria | 5519 |
| 333 | Ga0466964_0109428 | 3300044706 | Unclassified | 1230 |
| 334 | Ga0495603_0255740 | 3300046455 | Bacteria | 1008 |
| 335 | Ga0495629_0070853 | 3300046459 | Bacteria | 2433 |
| 336 | Ga0495580_0000408 | 3300046472 | Bacteria | 35435 |
| 337 | Ga0495580_0026174 | 3300046472 | Bacteria | 4256 |
| 338 | Ga0495580_0080122 | 3300046472 | Bacteria | 2277 |
| 339 | Ga0495580_0152961 | 3300046472 | Bacteria | 1598 |
| 340 | Ga0495582_0048612 | 3300046473 | Bacteria | 2336 |
| 341 | Ga0495664_0009767 | 3300046477 | Bacteria | 5378 |
| 342 | Ga0495594_0013563 | 3300046499 | Bacteria | 4256 |
| 343 | Ga0495608_0133146 | 3300046511 | Unclassified | 1590 |
| 344 | Ga0495630_0050541 | 3300046517 | Bacteria | 3111 |
| 345 | Ga0495630_0063639 | 3300046517 | Bacteria | 2771 |
| 346 | Ga0495630_0077256 | 3300046517 | Bacteria | 2510 |
| 347 | Ga0495665_0064517 | 3300046531 | Unclassified | 1933 |
| 348 | Ga0495665_0124927 | 3300046531 | Bacteria | 1347 |
| 349 | Ga0495635_0045620 | 3300046663 | Unclassified | 3024 |
| 350 | Ga0495657_0182562 | 3300046675 | Bacteria | 1287 |
| 351 | Ga0495599_0079788 | 3300046678 | Bacteria | 2044 |
| 352 | Ga0495623_0009320 | 3300046679 | Bacteria | 6374 |
| 353 | Ga0495613_0326600 | 3300046689 | Unclassified | 1058 |
| 354 | Ga0495624_0043794 | 3300046690 | Unclassified | 2854 |
| 355 | Ga0495581_0062235 | 3300047315 | Bacteria | 2156 |
| 356 | Ga0495674_0024014 | 3300047319 | Bacteria | 5609 |
| 357 | Ga0495674_0044457 | 3300047319 | Unclassified | 3949 |
| 358 | Ga0495593_0234987 | 3300047673 | Bacteria | 919 |
| 359 | Ga0495602_0198587 | 3300048088 | Unclassified | 1532 |
| 360 | Ga0496100_0545198 | 3300048903 | Unclassified | 897 |
| 361 | Ga0496102_0100298 | 3300048905 | Bacteria | 2689 |
| 362 | Ga0496104_0058275 | 3300048907 | Bacteria | 3656 |
| 363 | Ga0496105_0002068 | 3300048908 | Bacteria | 14517 |
| 364 | Ga0496108_0017665 | 3300048911 | Bacteria | 5837 |
| 365 | Ga0496109_0000524 | 3300048912 | Bacteria | 32521 |
| 366 | Ga0496110_0001679 | 3300048913 | Bacteria | 16247 |
| 367 | Ga0496110_0139952 | 3300048913 | Bacteria | 2188 |
| 368 | Ga0496110_0521349 | 3300048913 | Unclassified | 1081 |
| 369 | Ga0496111_0031959 | 3300048914 | Bacteria | 3751 |
| 370 | Ga0496111_0134122 | 3300048914 | Unclassified | 1833 |
| 371 | Ga0496112_0000645 | 3300048915 | Bacteria | 24241 |
| 372 | Ga0496112_0000667 | 3300048915 | Bacteria | 23908 |
| 373 | Ga0496112_0027444 | 3300048915 | Bacteria | 5489 |
| 374 | Ga0496112_0074507 | 3300048915 | Bacteria | 3356 |
| 375 | Ga0496112_0209342 | 3300048915 | Archaea | 1908 |
| 376 | Ga0496112_0653753 | 3300048915 | Unclassified | 981 |
| 377 | Ga0496113_0001283 | 3300048916 | Bacteria | 13863 |
| 378 | Ga0496113_0002000 | 3300048916 | Bacteria | 11681 |
| 379 | Ga0496115_0006010 | 3300048918 | Bacteria | 8860 |
| 380 | Ga0496115_0212283 | 3300048918 | Unclassified | 1598 |
| 381 | Ga0495601_0069970 | 3300053077 | Bacteria | 2239 |
| 382 | Ga0070708_100000531 | |||
| 383 | JGI24752J21851_1007244 | |||
| 384 | rootL2_10043929 | |||
| 385 | Ga0065712_10153189 | |||
| 386 | Ga0070658_10076681 | |||
| 387 | Ga0070683_100004265 | |||
| 388 | Ga0070683_100023583 | |||
| 389 | Ga0070670_100006784 | |||
| 390 | Ga0070670_100009095 | |||
| 391 | Ga0068869_100427010 | |||
| 392 | Ga0070680_100151733 | |||
| 393 | Ga0070682_100035984 | |||
| 394 | Ga0068868_100207367 | |||
| 395 | Ga0070660_100581616 | |||
| 396 | Ga0070689_100002279 | |||
| 397 | Ga0070689_100333365 | |||
| 398 | Ga0070661_100001267 | |||
| 399 | Ga0070661_100093642 | |||
| 400 | Ga0070692_10018953 | |||
| 401 | Ga0070674_100006696 | |||
| 402 | Ga0070673_100001501 | |||
| 403 | Ga0070688_100034069 | |||
| 404 | Ga0070688_100234584 | |||
| 405 | Ga0070659_100268647 | |||
| 406 | Ga0070709_10068927 | |||
| 407 | Ga0070709_10120638 | |||
| 408 | Ga0070709_10332271 | |||
| 409 | Ga0070714_100008343 | |||
| 410 | Ga0070714_100065123 | |||
| 411 | Ga0070714_100115050 | |||
| 412 | Ga0070714_100522442 | |||
| 413 | Ga0070714_100786965 | |||
| 414 | Ga0070713_100000297 | |||
| 415 | Ga0070713_100006212 | |||
| 416 | Ga0070713_100006371 | |||
| 417 | Ga0070713_100054926 | |||
| 418 | Ga0070713_100068595 | |||
| 419 | Ga0070713_100093577 | |||
| 420 | Ga0070713_100118903 | |||
| 421 | Ga0070710_10008966 | |||
| 422 | Ga0070711_100005643 | |||
| 423 | Ga0070711_100005742 | |||
| 424 | Ga0070705_100241075 | |||
| 425 | Ga0070708_100011611 | |||
| 426 | Ga0070678_100028788 | |||
| 427 | Ga0070681_10040513 | |||
| 428 | Ga0070681_10058005 | |||
| 429 | Ga0070681_10110356 | |||
| 430 | Ga0068867_100017298 | |||
| 431 | Ga0070685_10005181 | |||
| 432 | Ga0070706_100017794 | |||
| 433 | Ga0070706_100099946 | |||
| 434 | Ga0070706_100111636 | |||
| 435 | Ga0070707_100046621 | |||
| 436 | Ga0070699_100006620 | |||
| 437 | Ga0070679_100218629 | |||
| 438 | Ga0070684_100026021 | |||
| 439 | Ga0070684_100086644 | |||
| 440 | Ga0070684_100312724 | |||
| 441 | Ga0070697_100003849 | |||
| 442 | Ga0068853_100237790 | |||
| 443 | Ga0070672_100051070 | |||
| 444 | Ga0070696_100086924 | |||
| 445 | Ga0070693_100040592 | |||
| 446 | Ga0070693_100233593 | |||
| 447 | Ga0068855_100011876 | |||
| 448 | Ga0068855_100014061 | |||
| 449 | Ga0070664_100000302 | |||
| 450 | Ga0070664_100136759 | |||
| 451 | Ga0068857_100000968 | |||
| 452 | Ga0068857_100007012 | |||
| 453 | Ga0068854_100105673 | |||
| 454 | Ga0068856_100007876 | |||
| 455 | Ga0068856_100013094 | |||
| 456 | Ga0068856_100043981 | |||
| 457 | Ga0068856_100273890 | |||
| 458 | Ga0070702_100089965 | |||
| 459 | Ga0068852_100035390 | |||
| 460 | Ga0068859_100000193 | |||
| 461 | Ga0068859_100034595 | |||
| 462 | Ga0068864_100000449 | |||
| 463 | Ga0068866_10003295 | |||
| 464 | Ga0068870_10008154 | |||
| 465 | Ga0068870_10094149 | |||
| 466 | Ga0068863_100010687 | |||
| 467 | Ga0068858_100025207 | |||
| 468 | Ga0068860_100018866 | |||
| 469 | Ga0068862_100019872 | |||
| 470 | Ga0070717_10012414 | |||
| 471 | Ga0070717_10014907 | |||
| 472 | Ga0070717_10018158 | |||
| 473 | Ga0070717_10070696 | |||
| 474 | Ga0070717_10078581 | |||
| 475 | Ga0070717_10388695 | |||
| 476 | Ga0070717_10429731 | |||
| 477 | Ga0070717_10524533 | |||
| 478 | Ga0070715_10089718 | |||
| 479 | Ga0070716_100209358 | |||
| 480 | Ga0070712_100024684 | |||
| 481 | Ga0070712_100048707 | |||
| 482 | Ga0070712_100064773 | |||
| 483 | Ga0070712_100326127 | |||
| 484 | Ga0097621_100018575 | |||
| 485 | Ga0068871_100015710 | |||
| 486 | Ga0068871_100343610 | |||
| 487 | Ga0068865_100077427 | |||
| 488 | Ga0097620_100000193 | |||
| 489 | Ga0097620_100034594 | |||
| 490 | Ga0105250_10010561 | |||
| 491 | Ga0105240_10027440 | |||
| 492 | Ga0105240_10256465 | |||
| 493 | Ga0105240_10546346 | |||
| 494 | Ga0111539_10556429 | |||
| 495 | Ga0105245_10001545 | |||
| 496 | Ga0105245_10112497 | |||
| 497 | Ga0105245_10195250 | |||
| 498 | Ga0105245_10218027 | |||
| 499 | Ga0105247_10003382 | |||
| 500 | Ga0105247_10332015 | |||
| 501 | Ga0105241_10090640 | |||
| 502 | Ga0105241_10137714 | |||
| 503 | Ga0105248_10531947 | |||
| 504 | Ga0105248_10595406 | |||
| 505 | Ga0105237_10145303 | |||
| 506 | Ga0105237_10370855 | |||
| 507 | Ga0105238_10120640 | |||
| 508 | Ga0105238_10151503 | |||
| 509 | Ga0105249_10097981 | |||
| 510 | Ga0105249_10124337 | |||
| 511 | Ga0105239_10106091 | |||
| 512 | Ga0105239_10174874 | |||
| 513 | Ga0105246_10001225 | |||
| 514 | Ga0157373_10000869 | |||
| 515 | Ga0157373_10059229 | |||
| 516 | Ga0157373_10108774 | |||
| 517 | Ga0157371_10353427 | |||
| 518 | Ga0157369_10023082 | |||
| 519 | Ga0157369_10064344 | |||
| 520 | Ga0157369_10123753 | |||
| 521 | Ga0157369_10196508 | |||
| 522 | Ga0157369_10375778 | |||
| 523 | Ga0157369_10448982 | |||
| 524 | Ga0157374_10001614 | |||
| 525 | Ga0157378_10000070 | |||
| 526 | Ga0157378_10049499 | |||
| 527 | Ga0163162_10489606 | |||
| 528 | Ga0163162_10964472 | |||
| 529 | Ga0157372_10000696 | |||
| 530 | Ga0157372_10023120 | |||
| 531 | Ga0157372_10031560 | |||
| 532 | Ga0157372_10457893 | |||
| 533 | Ga0163163_10000595 | |||
| 534 | Ga0182008_10012498 | |||
| 535 | Ga0157377_10001328 | |||
| 536 | Ga0157379_10165939 | |||
| 537 | Ga0182006_1087815 | |||
| 538 | Ga0182007_10045172 | |||
| 539 | Ga0163161_10002771 | |||
| 540 | Ga0213873_10002197 | |||
| 541 | Ga0224570_100020 | |||
| 542 | Ga0224569_100348 | |||
| 543 | Ga0224571_100652 | |||
| 544 | Ga0224571_100699 | |||
| 545 | Ga0228598_1018843 | |||
| 546 | Ga0207697_10054481 | |||
| 547 | Ga0207682_10010174 | |||
| 548 | Ga0207692_10012205 | |||
| 549 | Ga0207692_10114082 | |||
| 550 | Ga0207642_10007711 | |||
| 551 | Ga0207642_10117428 | |||
| 552 | Ga0207710_10019694 | |||
| 553 | Ga0207688_10006690 | |||
| 554 | Ga0207647_10004204 | |||
| 555 | Ga0207699_10018730 | |||
| 556 | Ga0207699_10222011 | |||
| 557 | Ga0207699_10441177 | |||
| 558 | Ga0207645_10000273 | |||
| 559 | Ga0207643_10006633 | |||
| 560 | Ga0207643_10137451 | |||
| 561 | Ga0207705_10088616 | |||
| 562 | Ga0207684_10001808 | |||
| 563 | Ga0207684_10257699 | |||
| 564 | Ga0207684_10329632 | |||
| 565 | Ga0207654_10031235 | |||
| 566 | Ga0207654_10047782 | |||
| 567 | Ga0207707_10024646 | |||
| 568 | Ga0207707_10073028 | |||
| 569 | Ga0207707_10128657 | |||
| 570 | Ga0207695_10014120 | |||
| 571 | Ga0207695_10105622 | |||
| 572 | Ga0207671_10044318 | |||
| 573 | Ga0207671_10108374 | |||
| 574 | Ga0207693_10001787 | |||
| 575 | Ga0207693_10019072 | |||
| 576 | Ga0207693_10106352 | |||
| 577 | Ga0207693_10107505 | |||
| 578 | Ga0207693_10144169 | |||
| 579 | Ga0207663_10006222 | |||
| 580 | Ga0207660_10148129 | |||
| 581 | Ga0207662_10011782 | |||
| 582 | Ga0207657_10010598 | |||
| 583 | Ga0207649_10003850 | |||
| 584 | Ga0207681_10091568 | |||
| 585 | Ga0207694_10066982 | |||
| 586 | Ga0207694_10134072 | |||
| 587 | Ga0207650_10000036 | |||
| 588 | Ga0207650_10013308 | |||
| 589 | Ga0207687_10003874 | |||
| 590 | Ga0207687_10046351 | |||
| 591 | Ga0207687_10556994 | |||
| 592 | Ga0207700_10000271 | |||
| 593 | Ga0207700_10009665 | |||
| 594 | Ga0207700_10060933 | |||
| 595 | Ga0207700_10221995 | |||
| 596 | Ga0207664_10019928 | |||
| 597 | Ga0207664_10028517 | |||
| 598 | Ga0207690_10624606 | |||
| 599 | Ga0207706_10245785 | |||
| 600 | Ga0207704_10168688 | |||
| 601 | Ga0207665_10012629 | |||
| 602 | Ga0207665_10022312 | |||
| 603 | Ga0207711_10527896 | |||
| 604 | Ga0207689_10001841 | |||
| 605 | Ga0207661_10000527 | |||
| 606 | Ga0207661_10019008 | |||
| 607 | Ga0207667_10012831 | |||
| 608 | Ga0207667_10051574 | |||
| 609 | Ga0207667_10189927 | |||
| 610 | Ga0207667_10679905 | |||
| 611 | Ga0207651_10061948 | |||
| 612 | Ga0207668_10076798 | |||
| 613 | Ga0207640_10003068 | |||
| 614 | Ga0207677_10056893 | |||
| 615 | Ga0207677_10108288 | |||
| 616 | Ga0207677_10111580 | |||
| 617 | Ga0207703_10045618 | |||
| 618 | Ga0207703_10669884 | |||
| 619 | Ga0207639_10049871 | |||
| 620 | Ga0207678_10006194 | |||
| 621 | Ga0207702_10001252 | |||
| 622 | Ga0207702_10003843 | |||
| 623 | Ga0207702_10041026 | |||
| 624 | Ga0207702_10163481 | |||
| 625 | Ga0207702_10573895 | |||
| 626 | Ga0207641_10000009 | |||
| 627 | Ga0207641_10057191 | |||
| 628 | Ga0207648_10000326 | |||
| 629 | Ga0207648_10070924 | |||
| 630 | Ga0207676_10000092 | |||
| 631 | Ga0207676_10003940 | |||
| 632 | Ga0207676_10241487 | |||
| 633 | Ga0207674_10000016 | |||
| 634 | Ga0207674_10002336 | |||
| 635 | Ga0207674_10131755 | |||
| 636 | Ga0207675_100023148 | |||
| 637 | Ga0207683_10000359 | |||
| 638 | Ga0265356_1000205 | |||
| 639 | Ga0265356_1003929 | |||
| 640 | Ga0268266_10137002 | |||
| 641 | Ga0268265_10019741 | |||
| 642 | Ga0268264_10018752 | |||
| 643 | Ga0268264_10247719 | |||
| 644 | Ga0265338_10002372 | |||
| 645 | Ga0265338_10032870 | |||
| 646 | Ga0265338_10034070 | |||
| 647 | Ga0265338_10137859 | |||
| 648 | Ga0265762_1008180 | |||
| 649 | Ga0265760_10000115 | |||
| 650 | Ga0265760_10009775 | |||
| 651 | Ga0265325_10007792 | |||
| 652 | Ga0265325_10009096 | |||
| 653 | Ga0265340_10008156 | |||
| 654 | Ga0265340_10015758 | |||
| 655 | Ga0265339_10012996 | |||
| 656 | Ga0265316_10016687 | |||
| 657 | Ga0265313_10005956 | |||
| 658 | Ga0265314_10177986 | |||
| 659 | Ga0265342_10079964 | |||
| 660 | Ga0373926_0007726 | |||
| 661 | Ga0373926_0070990 | |||
| 662 | Ga0373944_0008409 | |||
| 663 | Ga0373944_0063534 | |||
| 664 | Ga0373923_0001213 | |||
| 665 | Ga0373923_0003997 | |||
| 666 | Ga0373936_0005330 | |||
| 667 | Ga0373936_0009342 | |||
| 668 | Ga0373936_0026370 | |||
| 669 | Ga0373936_0089230 | |||
| 670 | Ga0373945_0005015 | |||
| 671 | Ga0373945_0040917 | |||
| 672 | Ga0373956_0119340 | |||
| 673 | Ga0373956_0174698 | |||
| 674 | Ga0373943_0000395 | |||
| 675 | Ga0373943_0228897 | |||
| 676 | Ga0373946_0017605 | |||
| 677 | Ga0373946_0030001 | |||
| 678 | Ga0373946_0138050 | |||
| 679 | Ga0373955_0011380 | |||
| 680 | Ga0373955_0145255 | |||
| 681 | Ga0373955_0361402 | |||
| 682 | Ga0373924_0000096 | |||
| 683 | Ga0373924_0008989 | |||
| 684 | Ga0373924_0105582 | |||
| 685 | Ga0373924_0120283 | |||
| 686 | Ga0373931_0086654 | |||
| 687 | Ga0373935_0012557 | |||
| 688 | Ga0373935_0026061 | |||
| 689 | Ga0373935_0311150 | |||
| 690 | Ga0373927_0000099 | |||
| 691 | Ga0373927_0020640 | |||
| 692 | Ga0373927_0056771 | |||
| 693 | Ga0373927_0209595 | |||
| 694 | Ga0373933_0175424 | |||
| 695 | Ga0373933_0251614 | |||
| 696 | Ga0373933_0389473 | |||
| 697 | Ga0373947_0001644 | |||
| 698 | Ga0373947_0011216 | |||
| 699 | Ga0373947_0106404 | |||
| 700 | Ga0373947_0132664 | |||
| 701 | Ga0373937_0000219 | |||
| 702 | Ga0373937_0039349 | |||
| 703 | Ga0373937_0083175 | |||
| 704 | Ga0373937_0083477 | |||
| 705 | Ga0373937_0562263 | |||
| 706 | Ga0373925_0000227 | |||
| 707 | Ga0373925_0006892 | |||
| 708 | Ga0373925_0016786 | |||
| 709 | Ga0373925_0151150 | |||
| 710 | Ga0373925_0204453 | |||
| 711 | Ga0436361_1199371 | |||
| 712 | Ga0436363_0342414 | |||
| 713 | Ga0436362_0147413 | |||
| 714 | Ga0466964_0109428 | |||
| 715 | Ga0495603_0255740 | |||
| 716 | Ga0495629_0070853 | |||
| 717 | Ga0495580_0000408 | |||
| 718 | Ga0495580_0026174 | |||
| 719 | Ga0495580_0080122 | |||
| 720 | Ga0495580_0152961 | |||
| 721 | Ga0495582_0048612 | |||
| 722 | Ga0495664_0009767 | |||
| 723 | Ga0495594_0013563 | |||
| 724 | Ga0495608_0133146 | |||
| 725 | Ga0495630_0050541 | |||
| 726 | Ga0495630_0063639 | |||
| 727 | Ga0495630_0077256 | |||
| 728 | Ga0495665_0064517 | |||
| 729 | Ga0495665_0124927 | |||
| 730 | Ga0495635_0045620 | |||
| 731 | Ga0495657_0182562 | |||
| 732 | Ga0495599_0079788 | |||
| 733 | Ga0495623_0009320 | |||
| 734 | Ga0495613_0326600 | |||
| 735 | Ga0495624_0043794 | |||
| 736 | Ga0495581_0062235 | |||
| 737 | Ga0495674_0024014 | |||
| 738 | Ga0495674_0044457 | |||
| 739 | Ga0495593_0234987 | |||
| 740 | Ga0495602_0198587 | |||
| 741 | Ga0496100_0545198 | |||
| 742 | Ga0496102_0100298 | |||
| 743 | Ga0496104_0058275 | |||
| 744 | Ga0496105_0002068 | |||
| 745 | Ga0496108_0017665 | |||
| 746 | Ga0496109_0000524 | |||
| 747 | Ga0496110_0001679 | |||
| 748 | Ga0496110_0139952 | |||
| 749 | Ga0496110_0521349 | |||
| 750 | Ga0496111_0031959 | |||
| 751 | Ga0496111_0134122 | |||
| 752 | Ga0496112_0000645 | |||
| 753 | Ga0496112_0000667 | |||
| 754 | Ga0496112_0027444 | |||
| 755 | Ga0496112_0074507 | |||
| 756 | Ga0496112_0209342 | |||
| 757 | Ga0496112_0653753 | |||
| 758 | Ga0496113_0001283 | |||
| 759 | Ga0496113_0002000 | |||
| 760 | Ga0496115_0006010 | |||
| 761 | Ga0496115_0212283 | |||
| 762 | Ga0495601_0069970 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3re1-assembly2.cif.gz_B | crystal structure of uroporphyrinogen iii synthase from pseudomonas syringae pv. tomato dc3000 | 0.8454 | 12 | 255 |
| 4es6-assembly1.cif.gz_A | crystal structure of hemd (pa5259) from pseudomonas aeruginosa (pao1) at 2.22 a resolution | 0.8292 | 13 | 257 |
| 4es6-assembly1.cif.gz_A | crystal structure of hemd (pa5259) from pseudomonas aeruginosa (pao1) at 2.22 a resolution | 0.8142 | 13 | 257 |
| 3re1-assembly1.cif.gz_A | crystal structure of uroporphyrinogen iii synthase from pseudomonas syringae pv. tomato dc3000 | 0.8117 | 14 | 255 |
| 3re1-assembly2.cif.gz_B | crystal structure of uroporphyrinogen iii synthase from pseudomonas syringae pv. tomato dc3000 | 0.8031 | 12 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6MX34_297_420_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8463 | 17 | 128 | 3.40.50.10090 |
| af_B6U9W1_169_294_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.841 | 178 | 257 | 3.40.50.10090 |
| af_Q9W3B3_40_172_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8405 | 50 | 169 | 3.40.50.10090 |
| af_A4HRV6_2_153_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8378 | 14 | 132 | 3.40.50.10090 |
| af_Q2FXR2_34_131_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8194 | 64 | 162 | 3.40.50.10090 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9S979-F1-model_v4 | Uroporphyrinogen-III synthase (EC 4.2.1.75) | 0.9594 | 9 | 173 |
GO:0004852
GO:0006780 GO:0006782 |
| AF-A0A2V6T364-F1-model_v4 | HemD protein | 0.9467 | 9 | 263 |
GO:0004852
GO:0006780 GO:0008168 GO:0032259 |
| AF-A0A7W1SWN9-F1-model_v4 | Uroporphyrinogen-III synthase | 0.9403 | 1 | 259 |
GO:0004852
GO:0006780 |
| AF-A0A7C2DRF4-F1-model_v4 | Uroporphyrinogen-III synthase (EC 4.2.1.75) | 0.9371 | 7 | 263 |
GO:0004852
GO:0006780 GO:0006782 |
| AF-A0A4R1S495-F1-model_v4 | uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) | 0.9353 | 6 | 261 |
GO:0004851
GO:0004852 GO:0019354 GO:0032259 |