F428893

General Info

Members Datasets Scaffolds Average Seq Length
381 209 762 272

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100000531|Ga0070708_1000005314
Length 317
Sequence MNRRLLSGVRVLVGRARHQASVLSAELRKHGAHVIEIPFIEIRKPRSFKRLDDALKSLREYDWLILTSVNGAEAMWERLGKLKGRAGLGEGHDFSRAAKGRKQNTPLAAETPRSKCLRVAAIGPATKRAIERRGIKVEVVPREYVAESVVRSLRQRVKGKRVLLIRAKVARDVIPRELRQAGAHVDVVEAYETVVPRSSRSRLRAALKNSRRPNVITFTSSSTVRNFVALLGGSSLQATLRDQRSRGRGAPHHPWIDSVQFASIGPVTSATLQELGFPVHIEAKQYTIPGLVDAVVKAFGVHSQMTNRDLQTVICKP

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
91 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
92 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
93 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.51
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 23.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100000531 3300005445 Bacteria 28697
2 JGI24752J21851_1007244 3300001976 Unclassified 1447
3 rootL2_10043929 3300003322 Bacteria 1622
4 Ga0065712_10153189 3300005290 Unclassified 1354
5 Ga0070658_10076681 3300005327 Unclassified 2742
6 Ga0070683_100004265 3300005329 Bacteria 11732
7 Ga0070683_100023583 3300005329 Bacteria 5505
8 Ga0070670_100006784 3300005331 Bacteria 9695
9 Ga0070670_100009095 3300005331 Bacteria 8489
10 Ga0068869_100427010 3300005334 Unclassified 1094
11 Ga0070680_100151733 3300005336 Bacteria 1945
12 Ga0070682_100035984 3300005337 Bacteria 3025
13 Ga0068868_100207367 3300005338 Bacteria 1636
14 Ga0070660_100581616 3300005339 Bacteria 935
15 Ga0070689_100002279 3300005340 Bacteria 12479
16 Ga0070689_100333365 3300005340 Unclassified 1269
17 Ga0070661_100001267 3300005344 Bacteria 17752
18 Ga0070661_100093642 3300005344 Bacteria 2226
19 Ga0070692_10018953 3300005345 Bacteria 3316
20 Ga0070674_100006696 3300005356 Bacteria 6740
21 Ga0070673_100001501 3300005364 Bacteria 13696
22 Ga0070688_100034069 3300005365 Bacteria 3081
23 Ga0070688_100234584 3300005365 Unclassified 1299
24 Ga0070659_100268647 3300005366 Unclassified 1416
25 Ga0070709_10068927 3300005434 Bacteria 2276
26 Ga0070709_10120638 3300005434 Bacteria 1777
27 Ga0070709_10332271 3300005434 Bacteria 1118
28 Ga0070714_100008343 3300005435 Bacteria 8082
29 Ga0070714_100065123 3300005435 Bacteria 3138
30 Ga0070714_100115050 3300005435 Bacteria 2387
31 Ga0070714_100522442 3300005435 Unclassified 1134
32 Ga0070714_100786965 3300005435 Bacteria 921
33 Ga0070713_100000297 3300005436 Bacteria 32896
34 Ga0070713_100006212 3300005436 Bacteria 8264
35 Ga0070713_100006371 3300005436 Bacteria 8174
36 Ga0070713_100054926 3300005436 Unclassified 3307
37 Ga0070713_100068595 3300005436 Bacteria 2988
38 Ga0070713_100093577 3300005436 Bacteria 2590
39 Ga0070713_100118903 3300005436 Bacteria 2314
40 Ga0070710_10008966 3300005437 Bacteria 4886
41 Ga0070711_100005643 3300005439 Bacteria 7492
42 Ga0070711_100005742 3300005439 Bacteria 7444
43 Ga0070705_100241075 3300005440 Unclassified 1263
44 Ga0070708_100011611 3300005445 Bacteria 7170
45 Ga0070678_100028788 3300005456 Unclassified 3794
46 Ga0070681_10040513 3300005458 Unclassified 4667
47 Ga0070681_10058005 3300005458 Bacteria 3852
48 Ga0070681_10110356 3300005458 Bacteria 2690
49 Ga0068867_100017298 3300005459 Bacteria 5120
50 Ga0070685_10005181 3300005466 Bacteria 6611
51 Ga0070706_100017794 3300005467 Bacteria 6557
52 Ga0070706_100099946 3300005467 Bacteria 2695
53 Ga0070706_100111636 3300005467 Unclassified 2544
54 Ga0070707_100046621 3300005468 Bacteria 4148
55 Ga0070699_100006620 3300005518 Bacteria 10074
56 Ga0070679_100218629 3300005530 Bacteria 1867
57 Ga0070684_100026021 3300005535 Bacteria 4925
58 Ga0070684_100086644 3300005535 Unclassified 2780
59 Ga0070684_100312724 3300005535 Bacteria 1442
60 Ga0070697_100003849 3300005536 Bacteria 11524
61 Ga0068853_100237790 3300005539 Bacteria 1668
62 Ga0070672_100051070 3300005543 Bacteria 3223
63 Ga0070696_100086924 3300005546 Bacteria 2220
64 Ga0070693_100040592 3300005547 Bacteria 2613
65 Ga0070693_100233593 3300005547 Unclassified 1211
66 Ga0068855_100011876 3300005563 Bacteria 10532
67 Ga0068855_100014061 3300005563 Bacteria 9648
68 Ga0070664_100000302 3300005564 Bacteria 35799
69 Ga0070664_100136759 3300005564 Unclassified 2155
70 Ga0068857_100000968 3300005577 Bacteria 21942
71 Ga0068857_100007012 3300005577 Bacteria 9697
72 Ga0068854_100105673 3300005578 Bacteria 2117
73 Ga0068856_100007876 3300005614 Bacteria 10402
74 Ga0068856_100013094 3300005614 Bacteria 8032
75 Ga0068856_100043981 3300005614 Bacteria 4393
76 Ga0068856_100273890 3300005614 Bacteria 1704
77 Ga0070702_100089965 3300005615 Bacteria 1859
78 Ga0068852_100035390 3300005616 Bacteria 4165
79 Ga0068859_100000193 3300005617 Bacteria 59184
80 Ga0068859_100034595 3300005617 Bacteria 5070
81 Ga0068864_100000449 3300005618 Bacteria 35592
82 Ga0068866_10003295 3300005718 Bacteria 6633
83 Ga0068870_10008154 3300005840 Unclassified 4697
84 Ga0068870_10094149 3300005840 Bacteria 1681
85 Ga0068863_100010687 3300005841 Bacteria 8915
86 Ga0068858_100025207 3300005842 Bacteria 5534
87 Ga0068860_100018866 3300005843 Bacteria 6702
88 Ga0068862_100019872 3300005844 Bacteria 5608
89 Ga0070717_10012414 3300006028 Bacteria 6496
90 Ga0070717_10014907 3300006028 Bacteria 5986
91 Ga0070717_10018158 3300006028 Bacteria 5489
92 Ga0070717_10070696 3300006028 Bacteria 2909
93 Ga0070717_10078581 3300006028 Unclassified 2765
94 Ga0070717_10388695 3300006028 Unclassified 1252
95 Ga0070717_10429731 3300006028 Bacteria 1188
96 Ga0070717_10524533 3300006028 Unclassified 1071
97 Ga0070715_10089718 3300006163 Bacteria 1412
98 Ga0070716_100209358 3300006173 Bacteria 1302
99 Ga0070712_100024684 3300006175 Unclassified 3987
100 Ga0070712_100048707 3300006175 Unclassified 2939
101 Ga0070712_100064773 3300006175 Bacteria 2592
102 Ga0070712_100326127 3300006175 Unclassified 1250
103 Ga0097621_100018575 3300006237 Bacteria 5315
104 Ga0068871_100015710 3300006358 Bacteria 5679
105 Ga0068871_100343610 3300006358 Bacteria 1318
106 Ga0068865_100077427 3300006881 Bacteria 2376
107 Ga0097620_100000193 3300006931 Bacteria 59184
108 Ga0097620_100034594 3300006931 Bacteria 5070
109 Ga0105250_10010561 3300009092 Bacteria 3846
110 Ga0105240_10027440 3300009093 Bacteria 7452
111 Ga0105240_10256465 3300009093 Bacteria 2020
112 Ga0105240_10546346 3300009093 Unclassified 1282
113 Ga0111539_10556429 3300009094 Bacteria 1336
114 Ga0105245_10001545 3300009098 Bacteria 20877
115 Ga0105245_10112497 3300009098 Bacteria 2534
116 Ga0105245_10195250 3300009098 Unclassified 1941
117 Ga0105245_10218027 3300009098 Unclassified 1840
118 Ga0105247_10003382 3300009101 Bacteria 10429
119 Ga0105247_10332015 3300009101 Bacteria 1064
120 Ga0105241_10090640 3300009174 Bacteria 2411
121 Ga0105241_10137714 3300009174 Bacteria 1984
122 Ga0105248_10531947 3300009177 Bacteria 1326
123 Ga0105248_10595406 3300009177 Bacteria 1247
124 Ga0105237_10145303 3300009545 Unclassified 2366
125 Ga0105237_10370855 3300009545 Bacteria 1436
126 Ga0105238_10120640 3300009551 Bacteria 2601
127 Ga0105238_10151503 3300009551 Unclassified 2294
128 Ga0105249_10097981 3300009553 Unclassified 2753
129 Ga0105249_10124337 3300009553 Unclassified 2455
130 Ga0105239_10106091 3300010375 Bacteria 3112
131 Ga0105239_10174874 3300010375 Unclassified 2401
132 Ga0105246_10001225 3300011119 Bacteria 15024
133 Ga0157373_10000869 3300013100 Bacteria 23380
134 Ga0157373_10059229 3300013100 Unclassified 2713
135 Ga0157373_10108774 3300013100 Bacteria 1949
136 Ga0157371_10353427 3300013102 Unclassified 1070
137 Ga0157369_10023082 3300013105 Bacteria 6932
138 Ga0157369_10064344 3300013105 Unclassified 3950
139 Ga0157369_10123753 3300013105 Unclassified 2743
140 Ga0157369_10196508 3300013105 Bacteria 2118
141 Ga0157369_10375778 3300013105 Bacteria 1475
142 Ga0157369_10448982 3300013105 Bacteria 1335
143 Ga0157374_10001614 3300013296 Bacteria 18911
144 Ga0157378_10000070 3300013297 Bacteria 91609
145 Ga0157378_10049499 3300013297 Bacteria 3739
146 Ga0163162_10489606 3300013306 Unclassified 1361
147 Ga0163162_10964472 3300013306 Bacteria 963
148 Ga0157372_10000696 3300013307 Bacteria 36907
149 Ga0157372_10023120 3300013307 Bacteria 6736
150 Ga0157372_10031560 3300013307 Bacteria 5801
151 Ga0157372_10457893 3300013307 Bacteria 1487
152 Ga0163163_10000595 3300014325 Bacteria 31716
153 Ga0182008_10012498 3300014497 Bacteria 4481
154 Ga0157377_10001328 3300014745 Bacteria 10595
155 Ga0157379_10165939 3300014968 Bacteria 1993
156 Ga0182006_1087815 3300015261 Unclassified 1123
157 Ga0182007_10045172 3300015262 Unclassified 1461
158 Ga0163161_10002771 3300017792 Bacteria 12447
159 Ga0213873_10002197 3300021358 Bacteria 3352
160 Ga0224570_100020 3300022730 Bacteria 7321
161 Ga0224569_100348 3300022732 Bacteria 3886
162 Ga0224571_100652 3300022734 Bacteria 1990
163 Ga0224571_100699 3300022734 Unclassified 1941
164 Ga0228598_1018843 3300024227 Unclassified 1362
165 Ga0207697_10054481 3300025315 Unclassified 1657
166 Ga0207682_10010174 3300025893 Unclassified 3691
167 Ga0207692_10012205 3300025898 Bacteria 3683
168 Ga0207692_10114082 3300025898 Bacteria 1503
169 Ga0207642_10007711 3300025899 Bacteria 3646
170 Ga0207642_10117428 3300025899 Bacteria 1366
171 Ga0207710_10019694 3300025900 Unclassified 2880
172 Ga0207688_10006690 3300025901 Bacteria 6273
173 Ga0207647_10004204 3300025904 Bacteria 10677
174 Ga0207699_10018730 3300025906 Unclassified 3676
175 Ga0207699_10222011 3300025906 Bacteria 1290
176 Ga0207699_10441177 3300025906 Unclassified 932
177 Ga0207645_10000273 3300025907 Bacteria 42696
178 Ga0207643_10006633 3300025908 Bacteria 6207
179 Ga0207643_10137451 3300025908 Unclassified 1458
180 Ga0207705_10088616 3300025909 Unclassified 2264
181 Ga0207684_10001808 3300025910 Bacteria 22386
182 Ga0207684_10257699 3300025910 Bacteria 1505
183 Ga0207684_10329632 3300025910 Unclassified 1315
184 Ga0207654_10031235 3300025911 Bacteria 2932
185 Ga0207654_10047782 3300025911 Unclassified 2446
186 Ga0207707_10024646 3300025912 Bacteria 5265
187 Ga0207707_10073028 3300025912 Unclassified 2991
188 Ga0207707_10128657 3300025912 Bacteria 2214
189 Ga0207695_10014120 3300025913 Bacteria 9480
190 Ga0207695_10105622 3300025913 Bacteria 2803
191 Ga0207671_10044318 3300025914 Bacteria 3290
192 Ga0207671_10108374 3300025914 Bacteria 2111
193 Ga0207693_10001787 3300025915 Bacteria 18842
194 Ga0207693_10019072 3300025915 Bacteria 5458
195 Ga0207693_10106352 3300025915 Bacteria 2201
196 Ga0207693_10107505 3300025915 Bacteria 2188
197 Ga0207693_10144169 3300025915 Bacteria 1873
198 Ga0207663_10006222 3300025916 Bacteria 6089
199 Ga0207660_10148129 3300025917 Bacteria 1801
200 Ga0207662_10011782 3300025918 Bacteria 4858
201 Ga0207657_10010598 3300025919 Bacteria 9186
202 Ga0207649_10003850 3300025920 Bacteria 8180
203 Ga0207681_10091568 3300025923 Unclassified 2172
204 Ga0207694_10066982 3300025924 Bacteria 2802
205 Ga0207694_10134072 3300025924 Bacteria 1987
206 Ga0207650_10000036 3300025925 Bacteria 214579
207 Ga0207650_10013308 3300025925 Bacteria 5694
208 Ga0207687_10003874 3300025927 Bacteria 10050
209 Ga0207687_10046351 3300025927 Unclassified 3009
210 Ga0207687_10556994 3300025927 Unclassified 962
211 Ga0207700_10000271 3300025928 Bacteria 30901
212 Ga0207700_10009665 3300025928 Bacteria 6038
213 Ga0207700_10060933 3300025928 Unclassified 2860
214 Ga0207700_10221995 3300025928 Bacteria 1602
215 Ga0207664_10019928 3300025929 Bacteria 4965
216 Ga0207664_10028517 3300025929 Unclassified 4243
217 Ga0207690_10624606 3300025932 Unclassified 881
218 Ga0207706_10245785 3300025933 Unclassified 1564
219 Ga0207704_10168688 3300025938 Unclassified 1567
220 Ga0207665_10012629 3300025939 Bacteria 5551
221 Ga0207665_10022312 3300025939 Bacteria 4164
222 Ga0207711_10527896 3300025941 Bacteria 1101
223 Ga0207689_10001841 3300025942 Bacteria 20076
224 Ga0207661_10000527 3300025944 Bacteria 24587
225 Ga0207661_10019008 3300025944 Bacteria 5114
226 Ga0207667_10012831 3300025949 Bacteria 9628
227 Ga0207667_10051574 3300025949 Bacteria 4336
228 Ga0207667_10189927 3300025949 Bacteria 2108
229 Ga0207667_10679905 3300025949 Bacteria 1033
230 Ga0207651_10061948 3300025960 Unclassified 2604
231 Ga0207668_10076798 3300025972 Bacteria 2406
232 Ga0207640_10003068 3300025981 Bacteria 8997
233 Ga0207677_10056893 3300026023 Bacteria 2682
234 Ga0207677_10108288 3300026023 Bacteria 2063
235 Ga0207677_10111580 3300026023 Unclassified 2038
236 Ga0207703_10045618 3300026035 Unclassified 3526
237 Ga0207703_10669884 3300026035 Bacteria 985
238 Ga0207639_10049871 3300026041 Unclassified 3176
239 Ga0207678_10006194 3300026067 Bacteria 10629
240 Ga0207702_10001252 3300026078 Bacteria 25632
241 Ga0207702_10003843 3300026078 Bacteria 13546
242 Ga0207702_10041026 3300026078 Unclassified 3880
243 Ga0207702_10163481 3300026078 Bacteria 2034
244 Ga0207702_10573895 3300026078 Bacteria 1105
245 Ga0207641_10000009 3300026088 Bacteria 407901
246 Ga0207641_10057191 3300026088 Bacteria 3317
247 Ga0207648_10000326 3300026089 Bacteria 52122
248 Ga0207648_10070924 3300026089 Bacteria 3037
249 Ga0207676_10000092 3300026095 Bacteria 80704
250 Ga0207676_10003940 3300026095 Bacteria 10481
251 Ga0207676_10241487 3300026095 Unclassified 1621
252 Ga0207674_10000016 3300026116 Bacteria 182470
253 Ga0207674_10002336 3300026116 Bacteria 23992
254 Ga0207674_10131755 3300026116 Unclassified 2463
255 Ga0207675_100023148 3300026118 Bacteria 5777
256 Ga0207683_10000359 3300026121 Bacteria 41891
257 Ga0265356_1000205 3300028017 Bacteria 11207
258 Ga0265356_1003929 3300028017 Bacteria 1840
259 Ga0268266_10137002 3300028379 Unclassified 2193
260 Ga0268265_10019741 3300028380 Unclassified 4691
261 Ga0268264_10018752 3300028381 Bacteria 5657
262 Ga0268264_10247719 3300028381 Unclassified 1654
263 Ga0265338_10002372 3300028800 Bacteria 28403
264 Ga0265338_10032870 3300028800 Bacteria 5049
265 Ga0265338_10034070 3300028800 Unclassified 4930
266 Ga0265338_10137859 3300028800 Bacteria 1915
267 Ga0265762_1008180 3300030760 Bacteria 1861
268 Ga0265760_10000115 3300031090 Bacteria 20404
269 Ga0265760_10009775 3300031090 Unclassified 2739
270 Ga0265325_10007792 3300031241 Bacteria 6378
271 Ga0265325_10009096 3300031241 Bacteria 5821
272 Ga0265340_10008156 3300031247 Bacteria 5667
273 Ga0265340_10015758 3300031247 Bacteria 3922
274 Ga0265339_10012996 3300031249 Bacteria 5062
275 Ga0265316_10016687 3300031344 Bacteria 6365
276 Ga0265313_10005956 3300031595 Bacteria 8810
277 Ga0265314_10177986 3300031711 Bacteria 1277
278 Ga0265342_10079964 3300031712 Bacteria 1890
279 Ga0373926_0007726 3300035083 Bacteria 3583
280 Ga0373926_0070990 3300035083 Unclassified 1279
281 Ga0373944_0008409 3300035089 Unclassified 2788
282 Ga0373944_0063534 3300035089 Unclassified 1189
283 Ga0373923_0001213 3300035111 Bacteria 7226
284 Ga0373923_0003997 3300035111 Bacteria 4826
285 Ga0373936_0005330 3300035113 Bacteria 4842
286 Ga0373936_0009342 3300035113 Bacteria 3695
287 Ga0373936_0026370 3300035113 Bacteria 2275
288 Ga0373936_0089230 3300035113 Unclassified 1291
289 Ga0373945_0005015 3300035116 Bacteria 4217
290 Ga0373945_0040917 3300035116 Bacteria 1674
291 Ga0373956_0119340 3300035119 Bacteria 1231
292 Ga0373956_0174698 3300035119 Unclassified 1014
293 Ga0373943_0000395 3300035170 Bacteria 18292
294 Ga0373943_0228897 3300035170 Bacteria 1038
295 Ga0373946_0017605 3300035171 Bacteria 2735
296 Ga0373946_0030001 3300035171 Bacteria 2168
297 Ga0373946_0138050 3300035171 Bacteria 1127
298 Ga0373955_0011380 3300035172 Bacteria 4237
299 Ga0373955_0145255 3300035172 Bacteria 1393
300 Ga0373955_0361402 3300035172 Bacteria 880
301 Ga0373924_0000096 3300035410 Bacteria 24458
302 Ga0373924_0008989 3300035410 Bacteria 3652
303 Ga0373924_0105582 3300035410 Unclassified 1214
304 Ga0373924_0120283 3300035410 Bacteria 1139
305 Ga0373931_0086654 3300035691 Bacteria 1738
306 Ga0373935_0012557 3300035692 Bacteria 5097
307 Ga0373935_0026061 3300035692 Bacteria 3605
308 Ga0373935_0311150 3300035692 Bacteria 1115
309 Ga0373927_0000099 3300035695 Bacteria 65306
310 Ga0373927_0020640 3300035695 Bacteria 4319
311 Ga0373927_0056771 3300035695 Bacteria 2532
312 Ga0373927_0209595 3300035695 Unclassified 1280
313 Ga0373933_0175424 3300035724 Unclassified 1365
314 Ga0373933_0251614 3300035724 Bacteria 1138
315 Ga0373933_0389473 3300035724 Bacteria 908
316 Ga0373947_0001644 3300035725 Bacteria 13692
317 Ga0373947_0011216 3300035725 Bacteria 5145
318 Ga0373947_0106404 3300035725 Bacteria 1768
319 Ga0373947_0132664 3300035725 Bacteria 1591
320 Ga0373937_0000219 3300036401 Bacteria 55186
321 Ga0373937_0039349 3300036401 Bacteria 4309
322 Ga0373937_0083175 3300036401 Bacteria 2961
323 Ga0373937_0083477 3300036401 Bacteria 2955
324 Ga0373937_0562263 3300036401 Bacteria 1083
325 Ga0373925_0000227 3300037068 Bacteria 60089
326 Ga0373925_0006892 3300037068 Bacteria 8318
327 Ga0373925_0016786 3300037068 Bacteria 5301
328 Ga0373925_0151150 3300037068 Bacteria 1823
329 Ga0373925_0204453 3300037068 Bacteria 1571
330 Ga0436361_1199371 3300039447 Bacteria 1059
331 Ga0436363_0342414 3300039450 Bacteria 4523
332 Ga0436362_0147413 3300039453 Bacteria 5519
333 Ga0466964_0109428 3300044706 Unclassified 1230
334 Ga0495603_0255740 3300046455 Bacteria 1008
335 Ga0495629_0070853 3300046459 Bacteria 2433
336 Ga0495580_0000408 3300046472 Bacteria 35435
337 Ga0495580_0026174 3300046472 Bacteria 4256
338 Ga0495580_0080122 3300046472 Bacteria 2277
339 Ga0495580_0152961 3300046472 Bacteria 1598
340 Ga0495582_0048612 3300046473 Bacteria 2336
341 Ga0495664_0009767 3300046477 Bacteria 5378
342 Ga0495594_0013563 3300046499 Bacteria 4256
343 Ga0495608_0133146 3300046511 Unclassified 1590
344 Ga0495630_0050541 3300046517 Bacteria 3111
345 Ga0495630_0063639 3300046517 Bacteria 2771
346 Ga0495630_0077256 3300046517 Bacteria 2510
347 Ga0495665_0064517 3300046531 Unclassified 1933
348 Ga0495665_0124927 3300046531 Bacteria 1347
349 Ga0495635_0045620 3300046663 Unclassified 3024
350 Ga0495657_0182562 3300046675 Bacteria 1287
351 Ga0495599_0079788 3300046678 Bacteria 2044
352 Ga0495623_0009320 3300046679 Bacteria 6374
353 Ga0495613_0326600 3300046689 Unclassified 1058
354 Ga0495624_0043794 3300046690 Unclassified 2854
355 Ga0495581_0062235 3300047315 Bacteria 2156
356 Ga0495674_0024014 3300047319 Bacteria 5609
357 Ga0495674_0044457 3300047319 Unclassified 3949
358 Ga0495593_0234987 3300047673 Bacteria 919
359 Ga0495602_0198587 3300048088 Unclassified 1532
360 Ga0496100_0545198 3300048903 Unclassified 897
361 Ga0496102_0100298 3300048905 Bacteria 2689
362 Ga0496104_0058275 3300048907 Bacteria 3656
363 Ga0496105_0002068 3300048908 Bacteria 14517
364 Ga0496108_0017665 3300048911 Bacteria 5837
365 Ga0496109_0000524 3300048912 Bacteria 32521
366 Ga0496110_0001679 3300048913 Bacteria 16247
367 Ga0496110_0139952 3300048913 Bacteria 2188
368 Ga0496110_0521349 3300048913 Unclassified 1081
369 Ga0496111_0031959 3300048914 Bacteria 3751
370 Ga0496111_0134122 3300048914 Unclassified 1833
371 Ga0496112_0000645 3300048915 Bacteria 24241
372 Ga0496112_0000667 3300048915 Bacteria 23908
373 Ga0496112_0027444 3300048915 Bacteria 5489
374 Ga0496112_0074507 3300048915 Bacteria 3356
375 Ga0496112_0209342 3300048915 Archaea 1908
376 Ga0496112_0653753 3300048915 Unclassified 981
377 Ga0496113_0001283 3300048916 Bacteria 13863
378 Ga0496113_0002000 3300048916 Bacteria 11681
379 Ga0496115_0006010 3300048918 Bacteria 8860
380 Ga0496115_0212283 3300048918 Unclassified 1598
381 Ga0495601_0069970 3300053077 Bacteria 2239
382 Ga0070708_100000531
383 JGI24752J21851_1007244
384 rootL2_10043929
385 Ga0065712_10153189
386 Ga0070658_10076681
387 Ga0070683_100004265
388 Ga0070683_100023583
389 Ga0070670_100006784
390 Ga0070670_100009095
391 Ga0068869_100427010
392 Ga0070680_100151733
393 Ga0070682_100035984
394 Ga0068868_100207367
395 Ga0070660_100581616
396 Ga0070689_100002279
397 Ga0070689_100333365
398 Ga0070661_100001267
399 Ga0070661_100093642
400 Ga0070692_10018953
401 Ga0070674_100006696
402 Ga0070673_100001501
403 Ga0070688_100034069
404 Ga0070688_100234584
405 Ga0070659_100268647
406 Ga0070709_10068927
407 Ga0070709_10120638
408 Ga0070709_10332271
409 Ga0070714_100008343
410 Ga0070714_100065123
411 Ga0070714_100115050
412 Ga0070714_100522442
413 Ga0070714_100786965
414 Ga0070713_100000297
415 Ga0070713_100006212
416 Ga0070713_100006371
417 Ga0070713_100054926
418 Ga0070713_100068595
419 Ga0070713_100093577
420 Ga0070713_100118903
421 Ga0070710_10008966
422 Ga0070711_100005643
423 Ga0070711_100005742
424 Ga0070705_100241075
425 Ga0070708_100011611
426 Ga0070678_100028788
427 Ga0070681_10040513
428 Ga0070681_10058005
429 Ga0070681_10110356
430 Ga0068867_100017298
431 Ga0070685_10005181
432 Ga0070706_100017794
433 Ga0070706_100099946
434 Ga0070706_100111636
435 Ga0070707_100046621
436 Ga0070699_100006620
437 Ga0070679_100218629
438 Ga0070684_100026021
439 Ga0070684_100086644
440 Ga0070684_100312724
441 Ga0070697_100003849
442 Ga0068853_100237790
443 Ga0070672_100051070
444 Ga0070696_100086924
445 Ga0070693_100040592
446 Ga0070693_100233593
447 Ga0068855_100011876
448 Ga0068855_100014061
449 Ga0070664_100000302
450 Ga0070664_100136759
451 Ga0068857_100000968
452 Ga0068857_100007012
453 Ga0068854_100105673
454 Ga0068856_100007876
455 Ga0068856_100013094
456 Ga0068856_100043981
457 Ga0068856_100273890
458 Ga0070702_100089965
459 Ga0068852_100035390
460 Ga0068859_100000193
461 Ga0068859_100034595
462 Ga0068864_100000449
463 Ga0068866_10003295
464 Ga0068870_10008154
465 Ga0068870_10094149
466 Ga0068863_100010687
467 Ga0068858_100025207
468 Ga0068860_100018866
469 Ga0068862_100019872
470 Ga0070717_10012414
471 Ga0070717_10014907
472 Ga0070717_10018158
473 Ga0070717_10070696
474 Ga0070717_10078581
475 Ga0070717_10388695
476 Ga0070717_10429731
477 Ga0070717_10524533
478 Ga0070715_10089718
479 Ga0070716_100209358
480 Ga0070712_100024684
481 Ga0070712_100048707
482 Ga0070712_100064773
483 Ga0070712_100326127
484 Ga0097621_100018575
485 Ga0068871_100015710
486 Ga0068871_100343610
487 Ga0068865_100077427
488 Ga0097620_100000193
489 Ga0097620_100034594
490 Ga0105250_10010561
491 Ga0105240_10027440
492 Ga0105240_10256465
493 Ga0105240_10546346
494 Ga0111539_10556429
495 Ga0105245_10001545
496 Ga0105245_10112497
497 Ga0105245_10195250
498 Ga0105245_10218027
499 Ga0105247_10003382
500 Ga0105247_10332015
501 Ga0105241_10090640
502 Ga0105241_10137714
503 Ga0105248_10531947
504 Ga0105248_10595406
505 Ga0105237_10145303
506 Ga0105237_10370855
507 Ga0105238_10120640
508 Ga0105238_10151503
509 Ga0105249_10097981
510 Ga0105249_10124337
511 Ga0105239_10106091
512 Ga0105239_10174874
513 Ga0105246_10001225
514 Ga0157373_10000869
515 Ga0157373_10059229
516 Ga0157373_10108774
517 Ga0157371_10353427
518 Ga0157369_10023082
519 Ga0157369_10064344
520 Ga0157369_10123753
521 Ga0157369_10196508
522 Ga0157369_10375778
523 Ga0157369_10448982
524 Ga0157374_10001614
525 Ga0157378_10000070
526 Ga0157378_10049499
527 Ga0163162_10489606
528 Ga0163162_10964472
529 Ga0157372_10000696
530 Ga0157372_10023120
531 Ga0157372_10031560
532 Ga0157372_10457893
533 Ga0163163_10000595
534 Ga0182008_10012498
535 Ga0157377_10001328
536 Ga0157379_10165939
537 Ga0182006_1087815
538 Ga0182007_10045172
539 Ga0163161_10002771
540 Ga0213873_10002197
541 Ga0224570_100020
542 Ga0224569_100348
543 Ga0224571_100652
544 Ga0224571_100699
545 Ga0228598_1018843
546 Ga0207697_10054481
547 Ga0207682_10010174
548 Ga0207692_10012205
549 Ga0207692_10114082
550 Ga0207642_10007711
551 Ga0207642_10117428
552 Ga0207710_10019694
553 Ga0207688_10006690
554 Ga0207647_10004204
555 Ga0207699_10018730
556 Ga0207699_10222011
557 Ga0207699_10441177
558 Ga0207645_10000273
559 Ga0207643_10006633
560 Ga0207643_10137451
561 Ga0207705_10088616
562 Ga0207684_10001808
563 Ga0207684_10257699
564 Ga0207684_10329632
565 Ga0207654_10031235
566 Ga0207654_10047782
567 Ga0207707_10024646
568 Ga0207707_10073028
569 Ga0207707_10128657
570 Ga0207695_10014120
571 Ga0207695_10105622
572 Ga0207671_10044318
573 Ga0207671_10108374
574 Ga0207693_10001787
575 Ga0207693_10019072
576 Ga0207693_10106352
577 Ga0207693_10107505
578 Ga0207693_10144169
579 Ga0207663_10006222
580 Ga0207660_10148129
581 Ga0207662_10011782
582 Ga0207657_10010598
583 Ga0207649_10003850
584 Ga0207681_10091568
585 Ga0207694_10066982
586 Ga0207694_10134072
587 Ga0207650_10000036
588 Ga0207650_10013308
589 Ga0207687_10003874
590 Ga0207687_10046351
591 Ga0207687_10556994
592 Ga0207700_10000271
593 Ga0207700_10009665
594 Ga0207700_10060933
595 Ga0207700_10221995
596 Ga0207664_10019928
597 Ga0207664_10028517
598 Ga0207690_10624606
599 Ga0207706_10245785
600 Ga0207704_10168688
601 Ga0207665_10012629
602 Ga0207665_10022312
603 Ga0207711_10527896
604 Ga0207689_10001841
605 Ga0207661_10000527
606 Ga0207661_10019008
607 Ga0207667_10012831
608 Ga0207667_10051574
609 Ga0207667_10189927
610 Ga0207667_10679905
611 Ga0207651_10061948
612 Ga0207668_10076798
613 Ga0207640_10003068
614 Ga0207677_10056893
615 Ga0207677_10108288
616 Ga0207677_10111580
617 Ga0207703_10045618
618 Ga0207703_10669884
619 Ga0207639_10049871
620 Ga0207678_10006194
621 Ga0207702_10001252
622 Ga0207702_10003843
623 Ga0207702_10041026
624 Ga0207702_10163481
625 Ga0207702_10573895
626 Ga0207641_10000009
627 Ga0207641_10057191
628 Ga0207648_10000326
629 Ga0207648_10070924
630 Ga0207676_10000092
631 Ga0207676_10003940
632 Ga0207676_10241487
633 Ga0207674_10000016
634 Ga0207674_10002336
635 Ga0207674_10131755
636 Ga0207675_100023148
637 Ga0207683_10000359
638 Ga0265356_1000205
639 Ga0265356_1003929
640 Ga0268266_10137002
641 Ga0268265_10019741
642 Ga0268264_10018752
643 Ga0268264_10247719
644 Ga0265338_10002372
645 Ga0265338_10032870
646 Ga0265338_10034070
647 Ga0265338_10137859
648 Ga0265762_1008180
649 Ga0265760_10000115
650 Ga0265760_10009775
651 Ga0265325_10007792
652 Ga0265325_10009096
653 Ga0265340_10008156
654 Ga0265340_10015758
655 Ga0265339_10012996
656 Ga0265316_10016687
657 Ga0265313_10005956
658 Ga0265314_10177986
659 Ga0265342_10079964
660 Ga0373926_0007726
661 Ga0373926_0070990
662 Ga0373944_0008409
663 Ga0373944_0063534
664 Ga0373923_0001213
665 Ga0373923_0003997
666 Ga0373936_0005330
667 Ga0373936_0009342
668 Ga0373936_0026370
669 Ga0373936_0089230
670 Ga0373945_0005015
671 Ga0373945_0040917
672 Ga0373956_0119340
673 Ga0373956_0174698
674 Ga0373943_0000395
675 Ga0373943_0228897
676 Ga0373946_0017605
677 Ga0373946_0030001
678 Ga0373946_0138050
679 Ga0373955_0011380
680 Ga0373955_0145255
681 Ga0373955_0361402
682 Ga0373924_0000096
683 Ga0373924_0008989
684 Ga0373924_0105582
685 Ga0373924_0120283
686 Ga0373931_0086654
687 Ga0373935_0012557
688 Ga0373935_0026061
689 Ga0373935_0311150
690 Ga0373927_0000099
691 Ga0373927_0020640
692 Ga0373927_0056771
693 Ga0373927_0209595
694 Ga0373933_0175424
695 Ga0373933_0251614
696 Ga0373933_0389473
697 Ga0373947_0001644
698 Ga0373947_0011216
699 Ga0373947_0106404
700 Ga0373947_0132664
701 Ga0373937_0000219
702 Ga0373937_0039349
703 Ga0373937_0083175
704 Ga0373937_0083477
705 Ga0373937_0562263
706 Ga0373925_0000227
707 Ga0373925_0006892
708 Ga0373925_0016786
709 Ga0373925_0151150
710 Ga0373925_0204453
711 Ga0436361_1199371
712 Ga0436363_0342414
713 Ga0436362_0147413
714 Ga0466964_0109428
715 Ga0495603_0255740
716 Ga0495629_0070853
717 Ga0495580_0000408
718 Ga0495580_0026174
719 Ga0495580_0080122
720 Ga0495580_0152961
721 Ga0495582_0048612
722 Ga0495664_0009767
723 Ga0495594_0013563
724 Ga0495608_0133146
725 Ga0495630_0050541
726 Ga0495630_0063639
727 Ga0495630_0077256
728 Ga0495665_0064517
729 Ga0495665_0124927
730 Ga0495635_0045620
731 Ga0495657_0182562
732 Ga0495599_0079788
733 Ga0495623_0009320
734 Ga0495613_0326600
735 Ga0495624_0043794
736 Ga0495581_0062235
737 Ga0495674_0024014
738 Ga0495674_0044457
739 Ga0495593_0234987
740 Ga0495602_0198587
741 Ga0496100_0545198
742 Ga0496102_0100298
743 Ga0496104_0058275
744 Ga0496105_0002068
745 Ga0496108_0017665
746 Ga0496109_0000524
747 Ga0496110_0001679
748 Ga0496110_0139952
749 Ga0496110_0521349
750 Ga0496111_0031959
751 Ga0496111_0134122
752 Ga0496112_0000645
753 Ga0496112_0000667
754 Ga0496112_0027444
755 Ga0496112_0074507
756 Ga0496112_0209342
757 Ga0496112_0653753
758 Ga0496113_0001283
759 Ga0496113_0002000
760 Ga0496115_0006010
761 Ga0496115_0212283
762 Ga0495601_0069970

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02602

HEM4

Uroporphyrinogen-III synthase HemD

21

293

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3re1-assembly2.cif.gz_B crystal structure of uroporphyrinogen iii synthase from pseudomonas syringae pv. tomato dc3000 0.8454 12 255
4es6-assembly1.cif.gz_A crystal structure of hemd (pa5259) from pseudomonas aeruginosa (pao1) at 2.22 a resolution 0.8292 13 257
4es6-assembly1.cif.gz_A crystal structure of hemd (pa5259) from pseudomonas aeruginosa (pao1) at 2.22 a resolution 0.8142 13 257
3re1-assembly1.cif.gz_A crystal structure of uroporphyrinogen iii synthase from pseudomonas syringae pv. tomato dc3000 0.8117 14 255
3re1-assembly2.cif.gz_B crystal structure of uroporphyrinogen iii synthase from pseudomonas syringae pv. tomato dc3000 0.8031 12 255
ID Description Score Start End Superfamily
af_Q6MX34_297_420_3.40.50.10090 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8463 17 128 3.40.50.10090
af_B6U9W1_169_294_3.40.50.10090 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.841 178 257 3.40.50.10090
af_Q9W3B3_40_172_3.40.50.10090 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8405 50 169 3.40.50.10090
af_A4HRV6_2_153_3.40.50.10090 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8378 14 132 3.40.50.10090
af_Q2FXR2_34_131_3.40.50.10090 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8194 64 162 3.40.50.10090
ID Description Score Start End GO Terms
AF-A0A2V9S979-F1-model_v4 Uroporphyrinogen-III synthase (EC 4.2.1.75) 0.9594 9 173 GO:0004852
GO:0006780
GO:0006782
AF-A0A2V6T364-F1-model_v4 HemD protein 0.9467 9 263 GO:0004852
GO:0006780
GO:0008168
GO:0032259
AF-A0A7W1SWN9-F1-model_v4 Uroporphyrinogen-III synthase 0.9403 1 259 GO:0004852
GO:0006780
AF-A0A7C2DRF4-F1-model_v4 Uroporphyrinogen-III synthase (EC 4.2.1.75) 0.9371 7 263 GO:0004852
GO:0006780
GO:0006782
AF-A0A4R1S495-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9353 6 261 GO:0004851
GO:0004852
GO:0019354
GO:0032259

Map