F428913

General Info

Members Datasets Scaffolds Average Seq Length
381 180 762 119

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100437871|Ga0070665_1004378712
Length 137
Sequence VFLQNKSSSGRAGATRTGVTTKQRGDAGEDAALAHLLEAGLAFVARNYRTPGRGGGEIDLIMREPRDGTLVFVEVRRRASGTHGGAGGSITGLKQHRVILAARHYLMKLRTLPPCRFDVVLVEAGRIEWIQGAFDAR

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
33 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
34 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
64 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
65 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
66 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
84 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
160 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
175 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
176 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
177 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
178 2643221645 Massilia sp. Root351 Isolate Unclassified
179 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
180 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.2
Nodule 0.26
Rhizoplane 1.31
Rhizosphere 92.65
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100437871 3300005548 Bacteria 1316
2 Ga0070658_10308976 3300005327 Bacteria 1349
3 Ga0070658_10309388 3300005327 Bacteria 1348
4 Ga0070658_11237944 3300005327 Bacteria 649
5 Ga0070670_100138830 3300005331 Bacteria 2101
6 Ga0070660_100336233 3300005339 Bacteria 1242
7 Ga0070668_100114610 3300005347 Bacteria 2148
8 Ga0070669_100760281 3300005353 Bacteria 821
9 Ga0070675_100024663 3300005354 Bacteria 4817
10 Ga0070659_100071873 3300005366 Bacteria 2752
11 Ga0070659_100418536 3300005366 Bacteria 1133
12 Ga0070667_100525051 3300005367 Bacteria 1087
13 Ga0070714_100301513 3300005435 Bacteria 1494
14 Ga0070713_101026788 3300005436 Bacteria 796
15 Ga0070678_100347226 3300005456 Bacteria 1275
16 Ga0070678_100382524 3300005456 Bacteria 1218
17 Ga0068867_100000004 3300005459 Bacteria 180739
18 Ga0068867_100683388 3300005459 Bacteria 904
19 Ga0068867_100799672 3300005459 Bacteria 841
20 Ga0070685_10799787 3300005466 Bacteria 695
21 Ga0070672_101050261 3300005543 Bacteria 723
22 Ga0070665_100027896 3300005548 Bacteria 5685
23 Ga0075363_100032217 3300006048 Bacteria 2721
24 Ga0075362_10054585 3300006177 Bacteria 1796
25 Ga0075367_10107376 3300006178 Bacteria 1711
26 Ga0075366_10004534 3300006195 Bacteria 7457
27 Ga0075370_10031926 3300006353 Bacteria 2941
28 Ga0075370_10621985 3300006353 Bacteria 655
29 Ga0068871_100346948 3300006358 Bacteria 1312
30 Ga0105245_10387013 3300009098 Bacteria 1394
31 Ga0105243_10003190 3300009148 Bacteria 13432
32 Ga0105243_10902572 3300009148 Bacteria 879
33 Ga0105242_10001596 3300009176 Bacteria 17835
34 Ga0105248_10760920 3300009177 Bacteria 1093
35 Ga0105249_12563808 3300009553 Bacteria 582
36 Ga0157375_10522667 3300013308 Bacteria 1350
37 Ga0157380_10246706 3300014326 Bacteria 1614
38 Ga0157380_12800355 3300014326 Bacteria 554
39 Ga0182008_10074046 3300014497 Bacteria 1675
40 Ga0157377_10000010 3300014745 Bacteria 380929
41 Ga0182006_1043112 3300015261 Bacteria 1764
42 Ga0213872_10000403 3300021361 Bacteria 35721
43 Ga0209437_100234 3300025233 Bacteria 92856
44 Ga0207682_10107674 3300025893 Bacteria 1224
45 Ga0207705_10244543 3300025909 Bacteria 1367
46 Ga0207649_10000762 3300025920 Bacteria 20967
47 Ga0207681_10011710 3300025923 Bacteria 5392
48 Ga0207681_11483721 3300025923 Bacteria 569
49 Ga0207659_10043127 3300025926 Bacteria 3167
50 Ga0207690_10055691 3300025932 Bacteria 2664
51 Ga0207690_10339610 3300025932 Bacteria 1185
52 Ga0207709_10000990 3300025935 Bacteria 21162
53 Ga0207691_11049523 3300025940 Bacteria 679
54 Ga0207658_10491869 3300025986 Bacteria 1091
55 Ga0207648_10000002 3300026089 Bacteria 307909
56 Ga0207648_12063083 3300026089 Bacteria 531
57 Ga0207683_10192615 3300026121 Bacteria 1851
58 Ga0207683_10797377 3300026121 Bacteria 877
59 Ga0207698_10091446 3300026142 Bacteria 2491
60 Ga0209998_10163321 3300027717 Bacteria 575
61 Ga0268266_10118456 3300028379 Bacteria 2354
62 Ga0268266_10382655 3300028379 Bacteria 1327
63 Ga0265332_10103969 3300031238 Bacteria 1197
64 Ga0265340_10104266 3300031247 Bacteria 1316
65 Ga0265316_10568837 3300031344 Bacteria 805
66 Ga0307513_10002530 3300031456 Bacteria 25277
67 Ga0307516_10145805 3300031730 Bacteria 2133
68 Ga0307405_10373367 3300031731 Bacteria 1108
69 Ga0307405_10898068 3300031731 Bacteria 749
70 Ga0307405_11695595 3300031731 Bacteria 560
71 Ga0307406_10317321 3300031901 Bacteria 1204
72 Ga0307412_10420661 3300031911 Bacteria 1093
73 Ga0307412_10919403 3300031911 Bacteria 768
74 Ga0307416_100835800 3300032002 Bacteria 1018
75 Ga0373959_0010956 3300034820 Bacteria 1593
76 Ga0395899_0003035 3300037312 Bacteria 13403
77 Ga0395899_0014722 3300037312 Bacteria 5970
78 Ga0395899_0184706 3300037312 Bacteria 1462
79 Ga0395899_0254804 3300037312 Unclassified 1203
80 Ga0395900_0002450 3300037418 Bacteria 20443
81 Ga0395900_0013499 3300037418 Bacteria 8348
82 Ga0395900_0101968 3300037418 Bacteria 2948
83 Ga0395900_0697770 3300037418 Bacteria 949
84 Ga0395900_0988153 3300037418 Unclassified 762
85 Ga0395898_0008670 3300037466 Bacteria 10728
86 Ga0395898_0010304 3300037466 Bacteria 9781
87 Ga0395898_0324256 3300037466 Bacteria 1469
88 Ga0395905_0000430 3300037471 Bacteria 58720
89 Ga0395905_0003822 3300037471 Bacteria 15909
90 Ga0395905_0022056 3300037471 Bacteria 6024
91 Ga0395905_0040942 3300037471 Bacteria 4346
92 Ga0395905_0062275 3300037471 Bacteria 3489
93 Ga0395905_0083864 3300037471 Bacteria 2985
94 Ga0395905_0112250 3300037471 Bacteria 2560
95 Ga0395905_0264525 3300037471 Bacteria 1605
96 Ga0395905_0319369 3300037471 Bacteria 1442
97 Ga0395905_0709465 3300037471 Bacteria 908
98 Ga0395905_1483046 3300037471 Bacteria 583
99 Ga0395901_0019931 3300038443 Bacteria 6861
100 Ga0395901_0031995 3300038443 Bacteria 5427
101 Ga0395901_0120350 3300038443 Bacteria 2759
102 Ga0395901_0206990 3300038443 Bacteria 2055
103 Ga0395901_0306038 3300038443 Bacteria 1647
104 Ga0395901_0314414 3300038443 Bacteria 1621
105 Ga0395901_1365099 3300038443 Bacteria 668
106 Ga0395901_1526216 3300038443 Bacteria 623
107 Ga0436361_0851270 3300039447 Bacteria 59752
108 Ga0451791_1732551 3300041451 Bacteria 754
109 Ga0439434_0015902 3300042435 Bacteria 2245
110 Ga0450918_008196 3300042531 Bacteria 1838
111 Ga0451577_0304689 3300042876 Bacteria 1443
112 Ga0451577_0679022 3300042876 Bacteria 933
113 Ga0466969_0031868 3300044656 Bacteria 2682
114 Ga0466969_0054789 3300044656 Bacteria 1952
115 Ga0453683_0849720 3300044673 Bacteria 602
116 Ga0466965_0005191 3300044683 Bacteria 5850
117 Ga0466965_0231797 3300044683 Bacteria 986
118 Ga0466966_0003982 3300044684 Bacteria 9754
119 Ga0466966_0030442 3300044684 Bacteria 3505
120 Ga0466966_0094961 3300044684 Bacteria 1848
121 Ga0466966_0123272 3300044684 Bacteria 1591
122 Ga0466961_0013200 3300044693 Bacteria 5285
123 Ga0466964_0568494 3300044706 Bacteria 618
124 Ga0466964_0897098 3300044706 Bacteria 507
125 Ga0453684_2418622 3300044712 Unclassified 520
126 Ga0466971_0394535 3300044719 Bacteria 674
127 Ga0466968_0022220 3300044735 Bacteria 2577
128 Ga0466968_0278043 3300044735 Bacteria 800
129 Ga0466968_0460281 3300044735 Bacteria 630
130 Ga0466970_0018388 3300044765 Bacteria 3617
131 Ga0466970_0203530 3300044765 Bacteria 1102
132 Ga0466957_0018795 3300044842 Bacteria 4062
133 Ga0466960_0114378 3300044901 Bacteria 1406
134 Ga0466960_0568041 3300044901 Bacteria 670
135 Ga0466959_0093072 3300045049 Bacteria 2163
136 Ga0466959_0643111 3300045049 Bacteria 712
137 Ga0466959_0879805 3300045049 Bacteria 598
138 Ga0451576_2108290 3300045051 Bacteria 580
139 Ga0466958_0455229 3300045836 Bacteria 829
140 Ga0495617_010507 3300046452 Bacteria 3171
141 Ga0495617_016497 3300046452 Bacteria 2497
142 Ga0495617_110221 3300046452 Bacteria 890
143 Ga0495590_0001091 3300046457 Bacteria 11939
144 Ga0495590_0019076 3300046457 Bacteria 2448
145 Ga0495590_0049418 3300046457 Bacteria 1467
146 Ga0495629_0031682 3300046459 Bacteria 3743
147 Ga0495629_0081775 3300046459 Bacteria 2254
148 Ga0495638_0013759 3300046460 Bacteria 5494
149 Ga0495638_0508640 3300046460 Bacteria 605
150 Ga0495653_0176143 3300046463 Bacteria 1472
151 Ga0495650_0000077 3300046471 Bacteria 245511
152 Ga0495580_0866772 3300046472 Bacteria 582
153 Ga0495582_0110846 3300046473 Bacteria 1541
154 Ga0495582_0583301 3300046473 Bacteria 647
155 Ga0495605_0001276 3300046474 Bacteria 16691
156 Ga0495605_0101547 3300046474 Bacteria 1321
157 Ga0495639_0095014 3300046475 Bacteria 1402
158 Ga0495584_0000226 3300046491 Bacteria 40772
159 Ga0495584_0002210 3300046491 Bacteria 11097
160 Ga0495584_0029833 3300046491 Bacteria 2763
161 Ga0495584_0046610 3300046491 Bacteria 2186
162 Ga0495584_0122001 3300046491 Bacteria 1320
163 Ga0495584_0203751 3300046491 Bacteria 1005
164 Ga0495584_0226866 3300046491 Bacteria 949
165 Ga0495584_0331039 3300046491 Bacteria 773
166 Ga0495585_0000050 3300046492 Bacteria 119283
167 Ga0495585_0000171 3300046492 Bacteria 70110
168 Ga0495585_0000242 3300046492 Bacteria 56627
169 Ga0495585_0005562 3300046492 Bacteria 7921
170 Ga0495585_0013631 3300046492 Bacteria 4753
171 Ga0495585_0021600 3300046492 Bacteria 3695
172 Ga0495585_0054825 3300046492 Bacteria 2203
173 Ga0495585_0057214 3300046492 Bacteria 2152
174 Ga0495585_0079345 3300046492 Bacteria 1780
175 Ga0495585_0080569 3300046492 Bacteria 1764
176 Ga0495585_0089276 3300046492 Bacteria 1661
177 Ga0495585_0089288 3300046492 Bacteria 1661
178 Ga0495585_0179805 3300046492 Bacteria 1088
179 Ga0495585_0373575 3300046492 Bacteria 689
180 Ga0495585_0478527 3300046492 Bacteria 593
181 Ga0495594_0112367 3300046499 Bacteria 1536
182 Ga0495594_0393596 3300046499 Bacteria 788
183 Ga0495596_0000717 3300046500 Bacteria 20473
184 Ga0495596_0001655 3300046500 Bacteria 12658
185 Ga0495596_0003345 3300046500 Bacteria 8152
186 Ga0495607_0024050 3300046501 Bacteria 3803
187 Ga0495607_0040884 3300046501 Bacteria 2756
188 Ga0495607_0087407 3300046501 Bacteria 1696
189 Ga0495607_0121954 3300046501 Bacteria 1367
190 Ga0495607_0217814 3300046501 Bacteria 935
191 Ga0495607_0242371 3300046501 Bacteria 871
192 Ga0495583_0000316 3300046506 Bacteria 76314
193 Ga0495583_0000757 3300046506 Bacteria 40999
194 Ga0495583_0074238 3300046506 Bacteria 1489
195 Ga0495583_0106225 3300046506 Bacteria 1193
196 Ga0495583_0290277 3300046506 Bacteria 651
197 Ga0495606_0264037 3300046507 Bacteria 949
198 Ga0495606_0397592 3300046507 Bacteria 719
199 Ga0495610_0051465 3300046512 Bacteria 2004
200 Ga0495616_0000418 3300046513 Bacteria 32770
201 Ga0495616_0001558 3300046513 Bacteria 15796
202 Ga0495616_0005192 3300046513 Bacteria 8057
203 Ga0495616_0007825 3300046513 Bacteria 6378
204 Ga0495616_0115718 3300046513 Bacteria 1242
205 Ga0495616_0241762 3300046513 Bacteria 778
206 Ga0495628_0172431 3300046516 Bacteria 1640
207 Ga0495630_0237864 3300046517 Bacteria 1391
208 Ga0495637_0215201 3300046520 Bacteria 701
209 Ga0495643_0031886 3300046522 Bacteria 2929
210 Ga0495643_0034494 3300046522 Bacteria 2791
211 Ga0495644_0001158 3300046523 Bacteria 10821
212 Ga0495644_0003279 3300046523 Bacteria 6400
213 Ga0495644_0004186 3300046523 Bacteria 5672
214 Ga0495644_0072885 3300046523 Bacteria 1291
215 Ga0495644_0091179 3300046523 Bacteria 1150
216 Ga0495648_0000080 3300046524 Bacteria 126026
217 Ga0495648_0000213 3300046524 Bacteria 67606
218 Ga0495648_0040720 3300046524 Bacteria 2943
219 Ga0495648_0132656 3300046524 Bacteria 1322
220 Ga0495648_0255768 3300046524 Bacteria 843
221 Ga0495663_0001194 3300046525 Bacteria 8375
222 Ga0495663_0029003 3300046525 Bacteria 1631
223 Ga0495666_0010289 3300046526 Bacteria 4664
224 Ga0495666_0097991 3300046526 Bacteria 1382
225 Ga0495642_0025695 3300046528 Bacteria 2335
226 Ga0495642_0026057 3300046528 Bacteria 2320
227 Ga0495642_0073383 3300046528 Bacteria 1434
228 Ga0495642_0152061 3300046528 Bacteria 1001
229 Ga0495652_0089255 3300046529 Bacteria 2524
230 Ga0495665_0195424 3300046531 Bacteria 1049
231 Ga0495665_0291473 3300046531 Bacteria 836
232 Ga0495640_0237912 3300046533 Bacteria 1144
233 Ga0495586_0011829 3300046535 Bacteria 4638
234 Ga0495586_0042668 3300046535 Bacteria 2442
235 Ga0495609_0000421 3300046538 Bacteria 35331
236 Ga0495609_0002452 3300046538 Bacteria 11404
237 Ga0495609_0005322 3300046538 Bacteria 6803
238 Ga0495609_0013962 3300046538 Bacteria 3785
239 Ga0495609_0017225 3300046538 Bacteria 3357
240 Ga0495609_0211133 3300046538 Bacteria 808
241 Ga0495621_0046548 3300046539 Bacteria 1539
242 Ga0495621_0088694 3300046539 Bacteria 1163
243 Ga0495597_0001381 3300046542 Bacteria 17523
244 Ga0495597_0025002 3300046542 Bacteria 2752
245 Ga0495597_0098614 3300046542 Bacteria 1234
246 Ga0495622_0012870 3300046557 Bacteria 3879
247 Ga0495622_0021182 3300046557 Bacteria 3028
248 Ga0495622_0026616 3300046557 Bacteria 2699
249 Ga0495622_0068049 3300046557 Bacteria 1645
250 Ga0495622_0170250 3300046557 Bacteria 979
251 Ga0495622_0242236 3300046557 Bacteria 795
252 Ga0495633_0004174 3300046558 Bacteria 9284
253 Ga0495633_0012612 3300046558 Bacteria 4486
254 Ga0495633_0016235 3300046558 Bacteria 3846
255 Ga0495633_0023037 3300046558 Bacteria 3088
256 Ga0495633_0026083 3300046558 Bacteria 2870
257 Ga0495633_0047499 3300046558 Bacteria 2028
258 Ga0495633_0054091 3300046558 Bacteria 1888
259 Ga0495656_0017732 3300046615 Bacteria 2721
260 Ga0495656_0033515 3300046615 Bacteria 2097
261 Ga0495656_0043544 3300046615 Bacteria 1885
262 Ga0495656_0106692 3300046615 Bacteria 1304
263 Ga0495656_0282385 3300046615 Bacteria 846
264 Ga0495656_0719681 3300046615 Bacteria 537
265 Ga0495668_0006882 3300046616 Bacteria 7372
266 Ga0495668_0024877 3300046616 Bacteria 3404
267 Ga0495668_0061587 3300046616 Bacteria 2069
268 Ga0495668_0068861 3300046616 Bacteria 1946
269 Ga0495634_0173654 3300046642 Bacteria 1353
270 Ga0495611_0006191 3300046648 Bacteria 5105
271 Ga0495611_0062376 3300046648 Bacteria 1695
272 Ga0495611_0126380 3300046648 Bacteria 1192
273 Ga0495611_0170148 3300046648 Bacteria 1018
274 Ga0495611_0224055 3300046648 Bacteria 874
275 Ga0495625_0005494 3300046660 Bacteria 11534
276 Ga0495625_0032231 3300046660 Bacteria 3889
277 Ga0495625_0083679 3300046660 Bacteria 2217
278 Ga0495625_0285195 3300046660 Bacteria 1061
279 Ga0495625_0558473 3300046660 Bacteria 692
280 Ga0495625_0609460 3300046660 Bacteria 654
281 Ga0495625_0731373 3300046660 Bacteria 582
282 Ga0495659_0001095 3300046664 Bacteria 9433
283 Ga0495659_0032378 3300046664 Bacteria 1829
284 Ga0495661_0014847 3300046665 Bacteria 5210
285 Ga0495661_0035173 3300046665 Bacteria 3146
286 Ga0495661_0119348 3300046665 Bacteria 1458
287 Ga0495661_0123025 3300046665 Bacteria 1430
288 Ga0495661_0208450 3300046665 Bacteria 1019
289 Ga0495661_0289333 3300046665 Bacteria 823
290 Ga0495661_0433754 3300046665 Bacteria 634
291 Ga0495588_0027074 3300046674 Bacteria 2864
292 Ga0495588_0036658 3300046674 Bacteria 2488
293 Ga0495588_0310425 3300046674 Bacteria 830
294 Ga0495623_0276146 3300046679 Bacteria 936
295 Ga0495646_0021053 3300046680 Bacteria 4122
296 Ga0495669_0001126 3300046684 Bacteria 11077
297 Ga0495670_0000661 3300046691 Bacteria 16500
298 Ga0495670_0005741 3300046691 Bacteria 6085
299 Ga0495670_0016035 3300046691 Bacteria 3683
300 Ga0495670_0037285 3300046691 Bacteria 2423
301 Ga0495670_0064356 3300046691 Bacteria 1847
302 Ga0495670_0229843 3300046691 Bacteria 986
303 Ga0495670_0383372 3300046691 Bacteria 758
304 Ga0495671_0011733 3300046692 Bacteria 4805
305 Ga0495671_0287518 3300046692 Bacteria 791
306 Ga0495589_0172729 3300046794 Bacteria 1027
307 Ga0495589_0229229 3300046794 Bacteria 871
308 Ga0495600_0091051 3300046809 Bacteria 1989
309 Ga0495600_0417606 3300046809 Bacteria 833
310 Ga0495660_0207881 3300046810 Bacteria 930
311 Ga0495660_0240492 3300046810 Bacteria 844
312 Ga0495604_0283818 3300047317 Bacteria 1117
313 Ga0495636_0001457 3300047318 Bacteria 8964
314 Ga0495636_0238702 3300047318 Bacteria 838
315 Ga0495672_0005121 3300047320 Bacteria 10460
316 Ga0495672_0201995 3300047320 Bacteria 993
317 Ga0495672_0276330 3300047320 Bacteria 804
318 Ga0495676_0148059 3300047321 Bacteria 1674
319 Ga0495683_0000061 3300047323 Bacteria 114589
320 Ga0495683_0000822 3300047323 Bacteria 22096
321 Ga0495683_0017586 3300047323 Bacteria 3705
322 Ga0495687_000213 3300047443 Bacteria 83235
323 Ga0495687_026923 3300047443 Bacteria 2698
324 Ga0495687_186704 3300047443 Bacteria 671
325 Ga0495687_195443 3300047443 Bacteria 647
326 Ga0495675_0018731 3300047444 Bacteria 4397
327 Ga0495675_0024309 3300047444 Bacteria 3861
328 Ga0495677_0009459 3300047445 Bacteria 3599
329 Ga0495677_0009689 3300047445 Bacteria 3551
330 Ga0495677_0022295 3300047445 Bacteria 2296
331 Ga0495677_0040277 3300047445 Bacteria 1708
332 Ga0495679_078918 3300047446 Bacteria 937
333 Ga0495685_000675 3300047447 Bacteria 10407
334 Ga0495685_151985 3300047447 Bacteria 752
335 Ga0495673_0011516 3300047469 Bacteria 4751
336 Ga0495673_0099619 3300047469 Bacteria 1176
337 Ga0495673_0202350 3300047469 Bacteria 742
338 Ga0495681_0004378 3300047470 Bacteria 9645
339 Ga0495681_0017772 3300047470 Bacteria 3938
340 Ga0495593_0078018 3300047673 Bacteria 1715
341 Ga0495593_0245501 3300047673 Bacteria 896
342 Ga0495602_0109951 3300048088 Bacteria 2241
343 Ga0495614_0092671 3300048089 Bacteria 1315
344 Ga0495615_0000336 3300048090 Bacteria 7759
345 Ga0495626_0006915 3300048091 Bacteria 6389
346 Ga0495626_0027560 3300048091 Bacteria 2762
347 Ga0496100_0120855 3300048903 Bacteria 1832
348 Ga0496110_0225312 3300048913 Bacteria 1705
349 Ga0496114_0154120 3300048917 Bacteria 1994
350 Ga0496115_0394634 3300048918 Bacteria 1123
351 Ga0496125_0000368 3300048928 Bacteria 84924
352 Ga0496126_0717288 3300048929 Bacteria 775
353 Ga0495678_000760 3300049459 Bacteria 29264
354 Ga0495682_0001078 3300049460 Bacteria 16042
355 Ga0495682_0002653 3300049460 Bacteria 8358
356 Ga0495682_0078904 3300049460 Bacteria 1184
357 Ga0495682_0092896 3300049460 Bacteria 1083
358 Ga0495682_0197507 3300049460 Bacteria 714
359 Ga0501034_0116560 3300049571 Bacteria 2659
360 Ga0501034_0309967 3300049571 Bacteria 1513
361 Ga0501034_0366449 3300049571 Bacteria 1367
362 Ga0501046_0232821 3300049580 Bacteria 1360
363 Ga0501073_0041239 3300049589 Bacteria 3262
364 Ga0501245_013047 3300049708 Bacteria 1225
365 Ga0501080_0195193 3300049742 Bacteria 1860
366 Ga0501035_0401610 3300049822 Bacteria 1140
367 Ga0501044_0098518 3300049823 Bacteria 2943
368 nmdc:mga03683_69439_c1 3300050489 Bacteria 1503
369 nmdc:mga03n38_11852_c1 3300050490 Bacteria 3261
370 nmdc:mga0k408_12485_c1 3300050493 Bacteria 4643
371 nmdc:mga0k408_9739_c1 3300050493 Bacteria 5188
372 nmdc:mga06z11_119100_c1 3300050494 Bacteria 1471
373 nmdc:mga04h51_211050_c1 3300050495 Bacteria 766
374 nmdc:mga07m45_40135_c1 3300050496 Bacteria 2619
375 Ga0495655_0255799 3300053083 Bacteria 590
376 Ga0500618_005418 3300053125 Bacteria 3884
377 Ga0500624_034155 3300053157 Bacteria 888
378 2550694218 2548876994 Bacteria 4904866
379 2644250617 2643221645 Bacteria 7207331
380 2904483701 2904479285 Bacteria 5073931
381 2919707825 2919704043 Bacteria 5560311
382 Ga0070665_100437871
383 Ga0070658_10308976
384 Ga0070658_10309388
385 Ga0070658_11237944
386 Ga0070670_100138830
387 Ga0070660_100336233
388 Ga0070668_100114610
389 Ga0070669_100760281
390 Ga0070675_100024663
391 Ga0070659_100071873
392 Ga0070659_100418536
393 Ga0070667_100525051
394 Ga0070714_100301513
395 Ga0070713_101026788
396 Ga0070678_100347226
397 Ga0070678_100382524
398 Ga0068867_100000004
399 Ga0068867_100683388
400 Ga0068867_100799672
401 Ga0070685_10799787
402 Ga0070672_101050261
403 Ga0070665_100027896
404 Ga0075363_100032217
405 Ga0075362_10054585
406 Ga0075367_10107376
407 Ga0075366_10004534
408 Ga0075370_10031926
409 Ga0075370_10621985
410 Ga0068871_100346948
411 Ga0105245_10387013
412 Ga0105243_10003190
413 Ga0105243_10902572
414 Ga0105242_10001596
415 Ga0105248_10760920
416 Ga0105249_12563808
417 Ga0157375_10522667
418 Ga0157380_10246706
419 Ga0157380_12800355
420 Ga0182008_10074046
421 Ga0157377_10000010
422 Ga0182006_1043112
423 Ga0213872_10000403
424 Ga0209437_100234
425 Ga0207682_10107674
426 Ga0207705_10244543
427 Ga0207649_10000762
428 Ga0207681_10011710
429 Ga0207681_11483721
430 Ga0207659_10043127
431 Ga0207690_10055691
432 Ga0207690_10339610
433 Ga0207709_10000990
434 Ga0207691_11049523
435 Ga0207658_10491869
436 Ga0207648_10000002
437 Ga0207648_12063083
438 Ga0207683_10192615
439 Ga0207683_10797377
440 Ga0207698_10091446
441 Ga0209998_10163321
442 Ga0268266_10118456
443 Ga0268266_10382655
444 Ga0265332_10103969
445 Ga0265340_10104266
446 Ga0265316_10568837
447 Ga0307513_10002530
448 Ga0307516_10145805
449 Ga0307405_10373367
450 Ga0307405_10898068
451 Ga0307405_11695595
452 Ga0307406_10317321
453 Ga0307412_10420661
454 Ga0307412_10919403
455 Ga0307416_100835800
456 Ga0373959_0010956
457 Ga0395899_0003035
458 Ga0395899_0014722
459 Ga0395899_0184706
460 Ga0395899_0254804
461 Ga0395900_0002450
462 Ga0395900_0013499
463 Ga0395900_0101968
464 Ga0395900_0697770
465 Ga0395900_0988153
466 Ga0395898_0008670
467 Ga0395898_0010304
468 Ga0395898_0324256
469 Ga0395905_0000430
470 Ga0395905_0003822
471 Ga0395905_0022056
472 Ga0395905_0040942
473 Ga0395905_0062275
474 Ga0395905_0083864
475 Ga0395905_0112250
476 Ga0395905_0264525
477 Ga0395905_0319369
478 Ga0395905_0709465
479 Ga0395905_1483046
480 Ga0395901_0019931
481 Ga0395901_0031995
482 Ga0395901_0120350
483 Ga0395901_0206990
484 Ga0395901_0306038
485 Ga0395901_0314414
486 Ga0395901_1365099
487 Ga0395901_1526216
488 Ga0436361_0851270
489 Ga0451791_1732551
490 Ga0439434_0015902
491 Ga0450918_008196
492 Ga0451577_0304689
493 Ga0451577_0679022
494 Ga0466969_0031868
495 Ga0466969_0054789
496 Ga0453683_0849720
497 Ga0466965_0005191
498 Ga0466965_0231797
499 Ga0466966_0003982
500 Ga0466966_0030442
501 Ga0466966_0094961
502 Ga0466966_0123272
503 Ga0466961_0013200
504 Ga0466964_0568494
505 Ga0466964_0897098
506 Ga0453684_2418622
507 Ga0466971_0394535
508 Ga0466968_0022220
509 Ga0466968_0278043
510 Ga0466968_0460281
511 Ga0466970_0018388
512 Ga0466970_0203530
513 Ga0466957_0018795
514 Ga0466960_0114378
515 Ga0466960_0568041
516 Ga0466959_0093072
517 Ga0466959_0643111
518 Ga0466959_0879805
519 Ga0451576_2108290
520 Ga0466958_0455229
521 Ga0495617_010507
522 Ga0495617_016497
523 Ga0495617_110221
524 Ga0495590_0001091
525 Ga0495590_0019076
526 Ga0495590_0049418
527 Ga0495629_0031682
528 Ga0495629_0081775
529 Ga0495638_0013759
530 Ga0495638_0508640
531 Ga0495653_0176143
532 Ga0495650_0000077
533 Ga0495580_0866772
534 Ga0495582_0110846
535 Ga0495582_0583301
536 Ga0495605_0001276
537 Ga0495605_0101547
538 Ga0495639_0095014
539 Ga0495584_0000226
540 Ga0495584_0002210
541 Ga0495584_0029833
542 Ga0495584_0046610
543 Ga0495584_0122001
544 Ga0495584_0203751
545 Ga0495584_0226866
546 Ga0495584_0331039
547 Ga0495585_0000050
548 Ga0495585_0000171
549 Ga0495585_0000242
550 Ga0495585_0005562
551 Ga0495585_0013631
552 Ga0495585_0021600
553 Ga0495585_0054825
554 Ga0495585_0057214
555 Ga0495585_0079345
556 Ga0495585_0080569
557 Ga0495585_0089276
558 Ga0495585_0089288
559 Ga0495585_0179805
560 Ga0495585_0373575
561 Ga0495585_0478527
562 Ga0495594_0112367
563 Ga0495594_0393596
564 Ga0495596_0000717
565 Ga0495596_0001655
566 Ga0495596_0003345
567 Ga0495607_0024050
568 Ga0495607_0040884
569 Ga0495607_0087407
570 Ga0495607_0121954
571 Ga0495607_0217814
572 Ga0495607_0242371
573 Ga0495583_0000316
574 Ga0495583_0000757
575 Ga0495583_0074238
576 Ga0495583_0106225
577 Ga0495583_0290277
578 Ga0495606_0264037
579 Ga0495606_0397592
580 Ga0495610_0051465
581 Ga0495616_0000418
582 Ga0495616_0001558
583 Ga0495616_0005192
584 Ga0495616_0007825
585 Ga0495616_0115718
586 Ga0495616_0241762
587 Ga0495628_0172431
588 Ga0495630_0237864
589 Ga0495637_0215201
590 Ga0495643_0031886
591 Ga0495643_0034494
592 Ga0495644_0001158
593 Ga0495644_0003279
594 Ga0495644_0004186
595 Ga0495644_0072885
596 Ga0495644_0091179
597 Ga0495648_0000080
598 Ga0495648_0000213
599 Ga0495648_0040720
600 Ga0495648_0132656
601 Ga0495648_0255768
602 Ga0495663_0001194
603 Ga0495663_0029003
604 Ga0495666_0010289
605 Ga0495666_0097991
606 Ga0495642_0025695
607 Ga0495642_0026057
608 Ga0495642_0073383
609 Ga0495642_0152061
610 Ga0495652_0089255
611 Ga0495665_0195424
612 Ga0495665_0291473
613 Ga0495640_0237912
614 Ga0495586_0011829
615 Ga0495586_0042668
616 Ga0495609_0000421
617 Ga0495609_0002452
618 Ga0495609_0005322
619 Ga0495609_0013962
620 Ga0495609_0017225
621 Ga0495609_0211133
622 Ga0495621_0046548
623 Ga0495621_0088694
624 Ga0495597_0001381
625 Ga0495597_0025002
626 Ga0495597_0098614
627 Ga0495622_0012870
628 Ga0495622_0021182
629 Ga0495622_0026616
630 Ga0495622_0068049
631 Ga0495622_0170250
632 Ga0495622_0242236
633 Ga0495633_0004174
634 Ga0495633_0012612
635 Ga0495633_0016235
636 Ga0495633_0023037
637 Ga0495633_0026083
638 Ga0495633_0047499
639 Ga0495633_0054091
640 Ga0495656_0017732
641 Ga0495656_0033515
642 Ga0495656_0043544
643 Ga0495656_0106692
644 Ga0495656_0282385
645 Ga0495656_0719681
646 Ga0495668_0006882
647 Ga0495668_0024877
648 Ga0495668_0061587
649 Ga0495668_0068861
650 Ga0495634_0173654
651 Ga0495611_0006191
652 Ga0495611_0062376
653 Ga0495611_0126380
654 Ga0495611_0170148
655 Ga0495611_0224055
656 Ga0495625_0005494
657 Ga0495625_0032231
658 Ga0495625_0083679
659 Ga0495625_0285195
660 Ga0495625_0558473
661 Ga0495625_0609460
662 Ga0495625_0731373
663 Ga0495659_0001095
664 Ga0495659_0032378
665 Ga0495661_0014847
666 Ga0495661_0035173
667 Ga0495661_0119348
668 Ga0495661_0123025
669 Ga0495661_0208450
670 Ga0495661_0289333
671 Ga0495661_0433754
672 Ga0495588_0027074
673 Ga0495588_0036658
674 Ga0495588_0310425
675 Ga0495623_0276146
676 Ga0495646_0021053
677 Ga0495669_0001126
678 Ga0495670_0000661
679 Ga0495670_0005741
680 Ga0495670_0016035
681 Ga0495670_0037285
682 Ga0495670_0064356
683 Ga0495670_0229843
684 Ga0495670_0383372
685 Ga0495671_0011733
686 Ga0495671_0287518
687 Ga0495589_0172729
688 Ga0495589_0229229
689 Ga0495600_0091051
690 Ga0495600_0417606
691 Ga0495660_0207881
692 Ga0495660_0240492
693 Ga0495604_0283818
694 Ga0495636_0001457
695 Ga0495636_0238702
696 Ga0495672_0005121
697 Ga0495672_0201995
698 Ga0495672_0276330
699 Ga0495676_0148059
700 Ga0495683_0000061
701 Ga0495683_0000822
702 Ga0495683_0017586
703 Ga0495687_000213
704 Ga0495687_026923
705 Ga0495687_186704
706 Ga0495687_195443
707 Ga0495675_0018731
708 Ga0495675_0024309
709 Ga0495677_0009459
710 Ga0495677_0009689
711 Ga0495677_0022295
712 Ga0495677_0040277
713 Ga0495679_078918
714 Ga0495685_000675
715 Ga0495685_151985
716 Ga0495673_0011516
717 Ga0495673_0099619
718 Ga0495673_0202350
719 Ga0495681_0004378
720 Ga0495681_0017772
721 Ga0495593_0078018
722 Ga0495593_0245501
723 Ga0495602_0109951
724 Ga0495614_0092671
725 Ga0495615_0000336
726 Ga0495626_0006915
727 Ga0495626_0027560
728 Ga0496100_0120855
729 Ga0496110_0225312
730 Ga0496114_0154120
731 Ga0496115_0394634
732 Ga0496125_0000368
733 Ga0496126_0717288
734 Ga0495678_000760
735 Ga0495682_0001078
736 Ga0495682_0002653
737 Ga0495682_0078904
738 Ga0495682_0092896
739 Ga0495682_0197507
740 Ga0501034_0116560
741 Ga0501034_0309967
742 Ga0501034_0366449
743 Ga0501046_0232821
744 Ga0501073_0041239
745 Ga0501245_013047
746 Ga0501080_0195193
747 Ga0501035_0401610
748 Ga0501044_0098518
749 nmdc:mga03683_69439_c1
750 nmdc:mga03n38_11852_c1
751 nmdc:mga0k408_12485_c1
752 nmdc:mga0k408_9739_c1
753 nmdc:mga06z11_119100_c1
754 nmdc:mga04h51_211050_c1
755 nmdc:mga07m45_40135_c1
756 Ga0495655_0255799
757 Ga0500618_005418
758 Ga0500624_034155
759 2550694218
760 2644250617
761 2904483701
762 2919707825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02021

UPF0102

Uncharacterised protein family UPF0102

28

122

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.8833 16 123
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.8584 16 123
2ost-assembly1.cif.gz_C the structure of a bacterial homing endonuclease : i-ssp6803i 0.7412 9 71
2wcw-assembly2.cif.gz_C 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7367 14 118
2wcw-assembly1.cif.gz_B 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7308 12 118
ID Description Score Start End Superfamily
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9124 17 121 3.40.1350.10
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8915 16 123 3.40.1350.10
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8722 17 121 3.40.1350.10
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8661 16 123 3.40.1350.10
af_P9WFM9_15_126_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8297 16 117 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A0Q5Z592-F1-model_v4 UPF0102 protein ASG30_21765 0.9916 9 123 GO:0003676
AF-A0A4Q5UYT7-F1-model_v4 deleted 0.9911 16 123
AF-A0A3A6NYS4-F1-model_v4 UPF0102 protein C4516_02990 0.9878 9 121 GO:0003676
AF-A0A2N2SZ37-F1-model_v4 UPF0102 protein CVU24_12945 0.985 9 123 GO:0003676
AF-A0A3N4U7I9-F1-model_v4 UPF0102 protein EDC62_1798 0.9834 9 122 GO:0003676
GO:0004519

Map