F428952

General Info

Members Datasets Scaffolds Average Seq Length
381 218 375 356

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10090997|Ga0114129_100909973
Length 369
Sequence MGKKRSARKVEDMSAVSAPETGPDAGAVWHYGDPLGEQRAAADGAVVVDRSHRAVLMLTGKDRKTWLHSISSQHVSDLPDGAVTQNLSLDGQGRVEDHWIQTQLDGVTYLDTEAWRGEPLLTYLRKMVFWADASVEPADLAVLSLLGPKLADPQVVDALGIGSLPAEDAAVPLPGGGFLRRMAGQTIELDLVVPREQAAAWRQRLVDAGVRPAGVWAYEAHRVAALRPRLGVDTDERTIPHEVGWIGTAVHLDKGCYRGQETVARVHNLGKPPRMLVLVHLDGAADRPATGDPVLAGGRTVGRLGTVVDHVDEGPIALALLKRGLPADTPLTTGGQTEVAAVIDPDSMPPTDAVGAGRLAVEQLRGRAR

Samples

Sample ID Description Type Environment
1 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
2 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
3 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
4 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
5 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
6 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
211 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
214 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.97
Nodule 0.26
Rhizoplane 13.39
Rhizosphere 67.98
Stem 0
Stem Tuber 0
Unclassified 8.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10001174 3300002077 Bacteria 5107
2 JGI24744J21845_10002957 3300002077 Bacteria 3478
3 Ga0070676_10058441 3300005328 Bacteria 2285
4 Ga0068869_100002932 3300005334 Bacteria 10356
5 Ga0070666_10080072 3300005335 Bacteria 2232
6 Ga0070682_100051447 3300005337 Bacteria 2575
7 Ga0070682_100168043 3300005337 Bacteria 1522
8 Ga0068868_100019230 3300005338 Bacteria 5117
9 Ga0070660_100068648 3300005339 Bacteria 2763
10 Ga0070689_100073179 3300005340 Bacteria 2679
11 Ga0070687_100037260 3300005343 Bacteria 2430
12 Ga0070687_100173044 3300005343 Bacteria 1287
13 Ga0070692_10026143 3300005345 Bacteria 2882
14 Ga0070668_100006625 3300005347 Bacteria 8583
15 Ga0070668_100009869 3300005347 Bacteria 7071
16 Ga0070668_100068015 3300005347 Bacteria 2768
17 Ga0070668_100096613 3300005347 Bacteria 2335
18 Ga0070669_100001060 3300005353 Bacteria 20122
19 Ga0070669_100068281 3300005353 Bacteria 2624
20 Ga0070675_100468882 3300005354 Bacteria 1131
21 Ga0070671_100000693 3300005355 Bacteria 24230
22 Ga0070674_100041160 3300005356 Bacteria 3129
23 Ga0070674_100056610 3300005356 Bacteria 2719
24 Ga0070674_100379163 3300005356 Bacteria 1150
25 Ga0070688_100020667 3300005365 Bacteria 3831
26 Ga0070659_100015792 3300005366 Bacteria 5659
27 Ga0070667_100000960 3300005367 Bacteria 26531
28 Ga0070667_100017794 3300005367 Bacteria 5891
29 Ga0070667_100042622 3300005367 Bacteria 3808
30 Ga0070667_100095006 3300005367 Bacteria 2569
31 Ga0070714_100013034 3300005435 Bacteria 6651
32 Ga0070714_100179863 3300005435 Bacteria 1924
33 Ga0070710_10001385 3300005437 Bacteria 11439
34 Ga0070710_10007934 3300005437 Bacteria 5158
35 Ga0070710_10014992 3300005437 Bacteria 3913
36 Ga0070711_100002751 3300005439 Bacteria 10083
37 Ga0070711_100010221 3300005439 Bacteria 5801
38 Ga0070700_100002767 3300005441 Bacteria 8967
39 Ga0070694_100015528 3300005444 Bacteria 4785
40 Ga0070663_100076732 3300005455 Bacteria 2445
41 Ga0070663_100103658 3300005455 Bacteria 2127
42 Ga0070678_100002337 3300005456 Bacteria 10354
43 Ga0070678_100051691 3300005456 Bacteria 2980
44 Ga0070678_100225975 3300005456 Bacteria 1558
45 Ga0070662_100010075 3300005457 Bacteria 6192
46 Ga0070662_100031513 3300005457 Bacteria 3721
47 Ga0068867_100005051 3300005459 Bacteria 9313
48 Ga0068853_100003834 3300005539 Bacteria 11516
49 Ga0070695_100027954 3300005545 Bacteria 3497
50 Ga0070696_100006372 3300005546 Bacteria 7894
51 Ga0070665_100030751 3300005548 Bacteria 5403
52 Ga0070665_100288864 3300005548 Bacteria 1642
53 Ga0070704_100013226 3300005549 Bacteria 5117
54 Ga0068854_100003641 3300005578 Bacteria 9642
55 Ga0068854_100021027 3300005578 Bacteria 4423
56 Ga0070702_100031729 3300005615 Bacteria 2893
57 Ga0068852_100171324 3300005616 Bacteria 2035
58 Ga0068859_100004535 3300005617 Bacteria 14163
59 Ga0068859_100171541 3300005617 Bacteria 2250
60 Ga0068866_10001953 3300005718 Bacteria 8594
61 Ga0068861_100015468 3300005719 Bacteria 5377
62 Ga0068870_10122080 3300005840 Bacteria 1502
63 Ga0068863_100000105 3300005841 Bacteria 90388
64 Ga0068863_100006517 3300005841 Bacteria 11453
65 Ga0068858_100010352 3300005842 Bacteria 8832
66 Ga0068858_100043854 3300005842 Bacteria 4147
67 Ga0068858_100123180 3300005842 Bacteria 2426
68 Ga0068860_100000209 3300005843 Bacteria 92811
69 Ga0068860_100039127 3300005843 Bacteria 4536
70 Ga0068860_100132431 3300005843 Bacteria 2393
71 Ga0068862_100000400 3300005844 Bacteria 46788
72 Ga0068862_100005740 3300005844 Bacteria 10354
73 Ga0068862_100121536 3300005844 Bacteria 2302
74 Ga0081455_10063460 3300005937 Bacteria 3100
75 Ga0075365_10006929 3300006038 Bacteria 6295
76 Ga0075365_10010254 3300006038 Bacteria 5445
77 Ga0075365_10014943 3300006038 Bacteria 4683
78 Ga0075365_10194326 3300006038 Bacteria 1420
79 Ga0075368_10055450 3300006042 Bacteria 1580
80 Ga0075363_100012220 3300006048 Bacteria 4133
81 Ga0075363_100028716 3300006048 Bacteria 2864
82 Ga0075363_100033222 3300006048 Bacteria 2685
83 Ga0075363_100041847 3300006048 Bacteria 2417
84 Ga0075364_10038668 3300006051 Bacteria 3091
85 Ga0075364_10174895 3300006051 Bacteria 1452
86 Ga0070715_10008744 3300006163 Bacteria 3541
87 Ga0070716_100007934 3300006173 Bacteria 5255
88 Ga0070716_100045054 3300006173 Bacteria 2474
89 Ga0070712_100003957 3300006175 Bacteria 9111
90 Ga0075362_10006017 3300006177 Bacteria 4491
91 Ga0075367_10131615 3300006178 Bacteria 1546
92 Ga0075369_10000684 3300006186 Bacteria 10833
93 Ga0075369_10095615 3300006186 Bacteria 1329
94 Ga0075366_10074083 3300006195 Bacteria 2030
95 Ga0075370_10021810 3300006353 Bacteria 3511
96 Ga0075370_10030623 3300006353 Bacteria 3003
97 Ga0068871_100050321 3300006358 Bacteria 3370
98 Ga0075428_100005448 3300006844 Bacteria 14146
99 Ga0075430_100029560 3300006846 Bacteria 4650
100 Ga0068865_100002783 3300006881 Bacteria 10391
101 Ga0068865_100151200 3300006881 Bacteria 1761
102 Ga0097620_100004535 3300006931 Bacteria 14163
103 Ga0097620_100171556 3300006931 Bacteria 2250
104 Ga0105245_10006580 3300009098 Bacteria 10200
105 Ga0105247_10000141 3300009101 Bacteria 70210
106 Ga0105247_10003401 3300009101 Bacteria 10399
107 Ga0114129_10090997 3300009147 Bacteria 4228
108 Ga0105243_10071346 3300009148 Bacteria 2808
109 Ga0105241_10006169 3300009174 Bacteria 8841
110 Ga0105241_10411272 3300009174 Bacteria 1189
111 Ga0105242_10004138 3300009176 Bacteria 11293
112 Ga0105248_10001091 3300009177 Bacteria 30053
113 Ga0105248_10031723 3300009177 Bacteria 5903
114 Ga0105248_10304932 3300009177 Bacteria 1793
115 Ga0105237_10001867 3300009545 Bacteria 26871
116 Ga0105249_10000031 3300009553 Bacteria 220006
117 Ga0105249_10046773 3300009553 Bacteria 3939
118 Ga0105249_10111788 3300009553 Bacteria 2583
119 Ga0105239_10007046 3300010375 Bacteria 12936
120 Ga0105239_10078911 3300010375 Bacteria 3623
121 Ga0105246_10215937 3300011119 Bacteria 1500
122 Ga0157369_10090170 3300013105 Bacteria 3273
123 Ga0157378_10046847 3300013297 Bacteria 3842
124 Ga0163162_10078903 3300013306 Bacteria 3358
125 Ga0157372_10415364 3300013307 Bacteria 1568
126 Ga0157375_10001251 3300013308 Bacteria 21991
127 Ga0157375_10292102 3300013308 Bacteria 1793
128 Ga0163163_10045788 3300014325 Bacteria 4296
129 Ga0157380_10018585 3300014326 Bacteria 5162
130 Ga0157377_10064889 3300014745 Bacteria 2096
131 Ga0157377_10100709 3300014745 Bacteria 1721
132 Ga0157379_10008367 3300014968 Bacteria 8990
133 Ga0157379_10094948 3300014968 Bacteria 2676
134 Ga0157376_10032320 3300014969 Bacteria 4201
135 Ga0163161_10021613 3300017792 Bacteria 4522
136 Ga0163161_10118394 3300017792 Bacteria 1988
137 Ga0213876_10001902 3300021384 Bacteria 12559
138 Ga0213876_10038564 3300021384 Bacteria 2522
139 Ga0213875_10021377 3300021388 Bacteria 3100
140 Ga0207692_10003535 3300025898 Bacteria 6110
141 Ga0207642_10000179 3300025899 Bacteria 18334
142 Ga0207710_10000164 3300025900 Bacteria 70180
143 Ga0207710_10001390 3300025900 Bacteria 12141
144 Ga0207688_10001929 3300025901 Bacteria 11111
145 Ga0207688_10002258 3300025901 Bacteria 10371
146 Ga0207680_10077955 3300025903 Bacteria 2074
147 Ga0207680_10090671 3300025903 Bacteria 1943
148 Ga0207685_10001342 3300025905 Bacteria 5082
149 Ga0207685_10002772 3300025905 Bacteria 4099
150 Ga0207645_10017196 3300025907 Bacteria 4776
151 Ga0207645_10047682 3300025907 Bacteria 2735
152 Ga0207693_10005747 3300025915 Bacteria 10294
153 Ga0207693_10013467 3300025915 Bacteria 6594
154 Ga0207663_10002588 3300025916 Bacteria 8701
155 Ga0207663_10016705 3300025916 Bacteria 4076
156 Ga0207657_10160359 3300025919 Bacteria 1827
157 Ga0207681_10000456 3300025923 Bacteria 28674
158 Ga0207681_10119405 3300025923 Bacteria 1931
159 Ga0207687_10041467 3300025927 Bacteria 3161
160 Ga0207664_10149096 3300025929 Bacteria 1986
161 Ga0207644_10029843 3300025931 Bacteria 3785
162 Ga0207644_10213613 3300025931 Bacteria 1526
163 Ga0207644_10231272 3300025931 Bacteria 1469
164 Ga0207690_10087294 3300025932 Bacteria 2195
165 Ga0207690_10179197 3300025932 Bacteria 1594
166 Ga0207706_10033181 3300025933 Bacteria 4595
167 Ga0207706_10048673 3300025933 Bacteria 3748
168 Ga0207686_10027906 3300025934 Bacteria 3311
169 Ga0207709_10002137 3300025935 Bacteria 12664
170 Ga0207670_10009159 3300025936 Bacteria 5631
171 Ga0207669_10001598 3300025937 Bacteria 9649
172 Ga0207704_10002309 3300025938 Bacteria 8573
173 Ga0207704_10026691 3300025938 Bacteria 3172
174 Ga0207665_10021691 3300025939 Bacteria 4225
175 Ga0207665_10054257 3300025939 Bacteria 2703
176 Ga0207691_10026272 3300025940 Bacteria 5465
177 Ga0207691_10065125 3300025940 Bacteria 3300
178 Ga0207711_10000196 3300025941 Bacteria 64910
179 Ga0207711_10003673 3300025941 Bacteria 13256
180 Ga0207711_10371536 3300025941 Bacteria 1326
181 Ga0207689_10002479 3300025942 Bacteria 17159
182 Ga0207689_10029767 3300025942 Bacteria 4554
183 Ga0207667_10108612 3300025949 Bacteria 2862
184 Ga0207712_10000029 3300025961 Bacteria 220014
185 Ga0207712_10034853 3300025961 Bacteria 3414
186 Ga0207712_10074058 3300025961 Bacteria 2458
187 Ga0207668_10025503 3300025972 Bacteria 3826
188 Ga0207668_10028943 3300025972 Bacteria 3627
189 Ga0207640_10001076 3300025981 Bacteria 15126
190 Ga0207658_10000517 3300025986 Bacteria 35169
191 Ga0207658_10011131 3300025986 Bacteria 6126
192 Ga0207658_10070096 3300025986 Bacteria 2651
193 Ga0207658_10118017 3300025986 Bacteria 2110
194 Ga0207658_10172298 3300025986 Bacteria 1784
195 Ga0207677_10013097 3300026023 Bacteria 4794
196 Ga0207703_10007260 3300026035 Bacteria 8811
197 Ga0207703_10074182 3300026035 Bacteria 2816
198 Ga0207703_10166927 3300026035 Bacteria 1933
199 Ga0207639_10003868 3300026041 Bacteria 10088
200 Ga0207678_10043825 3300026067 Bacteria 3871
201 Ga0207678_10123082 3300026067 Bacteria 2213
202 Ga0207708_10019587 3300026075 Bacteria 5101
203 Ga0207708_10088725 3300026075 Bacteria 2382
204 Ga0207641_10000581 3300026088 Bacteria 40291
205 Ga0207641_10026429 3300026088 Bacteria 4790
206 Ga0207675_100008196 3300026118 Bacteria 9845
207 Ga0207675_100135793 3300026118 Bacteria 2334
208 Ga0207683_10006112 3300026121 Bacteria 10312
209 Ga0207683_10017811 3300026121 Bacteria 6058
210 Ga0207698_10047714 3300026142 Bacteria 3247
211 Ga0207698_10169790 3300026142 Bacteria 1919
212 Ga0209813_10023766 3300027866 Bacteria 1745
213 Ga0268266_10006438 3300028379 Bacteria 10754
214 Ga0268266_10227640 3300028379 Bacteria 1716
215 Ga0268265_10000389 3300028380 Bacteria 46920
216 Ga0268265_10015615 3300028380 Bacteria 5199
217 Ga0268264_10000017 3300028381 Bacteria 498037
218 Ga0268264_10004905 3300028381 Bacteria 11335
219 Ga0307413_10166908 3300031824 Bacteria 1553
220 Ga0307410_10007287 3300031852 Bacteria 6045
221 Ga0307409_100011193 3300031995 Bacteria 5638
222 Ga0307414_10161883 3300032004 Bacteria 1778
223 Ga0307415_100137723 3300032126 Bacteria 1859
224 Ga0373962_0037065 3300035242 Bacteria 1360
225 Ga0436364_0090351 3300037853 Bacteria 12081
226 Ga0436364_0632914 3300037853 Bacteria 6072
227 Ga0436365_1818399 3300039437 Bacteria 33160
228 Ga0436365_1833781 3300039437 Bacteria 32006
229 Ga0436363_1636492 3300039450 Bacteria 3700
230 Ga0439466_0001147 3300041411 Bacteria 10298
231 Ga0439466_0012543 3300041411 Bacteria 3120
232 Ga0439465_0000834 3300041413 Bacteria 9713
233 Ga0439465_0001830 3300041413 Bacteria 6955
234 Ga0439465_0001856 3300041413 Bacteria 6913
235 Ga0439431_0006206 3300041997 Bacteria 2638
236 Ga0439434_0019119 3300042435 Bacteria 2053
237 Ga0466972_0013919 3300044658 Bacteria 4035
238 Ga0466965_0002797 3300044683 Bacteria 7508
239 Ga0466966_0024221 3300044684 Bacteria 3972
240 Ga0466966_0061612 3300044684 Bacteria 2366
241 Ga0466961_0014354 3300044693 Bacteria 5083
242 Ga0466961_0153025 3300044693 Bacteria 1439
243 Ga0466963_0053479 3300044694 Bacteria 2681
244 Ga0466963_0071248 3300044694 Bacteria 2339
245 Ga0466964_0003506 3300044706 Bacteria 5728
246 Ga0466971_0005069 3300044719 Bacteria 5706
247 Ga0466971_0050061 3300044719 Bacteria 1880
248 Ga0466968_0022362 3300044735 Bacteria 2570
249 Ga0466970_0020813 3300044765 Bacteria 3412
250 Ga0466957_0020030 3300044842 Bacteria 3937
251 Ga0466957_0186882 3300044842 Bacteria 1355
252 Ga0466960_0014545 3300044901 Bacteria 3372
253 Ga0466959_0003472 3300045049 Bacteria 10320
254 Ga0466959_0023697 3300045049 Bacteria 4543
255 Ga0466959_0031822 3300045049 Bacteria 3904
256 Ga0466958_0016528 3300045836 Bacteria 4250
257 Ga0466958_0019392 3300045836 Bacteria 3959
258 Ga0466958_0185829 3300045836 Bacteria 1320
259 Ga0466967_0034788 3300045976 Bacteria 4281
260 Ga0466967_0058051 3300045976 Bacteria 3419
261 Ga0466967_0061763 3300045976 Bacteria 3325
262 Ga0495629_0019549 3300046459 Bacteria 4838
263 Ga0495638_0002708 3300046460 Bacteria 14252
264 Ga0495638_0021490 3300046460 Bacteria 4251
265 Ga0495641_0030727 3300046461 Bacteria 2572
266 Ga0495639_0027016 3300046475 Bacteria 2540
267 Ga0495606_0047622 3300046507 Bacteria 2825
268 Ga0495648_0017429 3300046524 Bacteria 5132
269 Ga0495640_0055687 3300046533 Bacteria 2705
270 Ga0495668_0010283 3300046616 Bacteria 5676
271 Ga0495674_0075580 3300047319 Bacteria 2899
272 Ga0495672_0019498 3300047320 Bacteria 4470
273 Ga0495672_0025777 3300047320 Bacteria 3758
274 Ga0495676_0087904 3300047321 Bacteria 2333
275 Ga0495673_0000524 3300047469 Bacteria 40257
276 Ga0495593_0009997 3300047673 Bacteria 5498
277 Ga0496100_0002372 3300048903 Bacteria 9526
278 Ga0496100_0004442 3300048903 Bacteria 7436
279 Ga0496100_0006094 3300048903 Bacteria 6554
280 Ga0496100_0014470 3300048903 Bacteria 4580
281 Ga0496100_0025025 3300048903 Bacteria 3647
282 Ga0496101_0000031 3300048904 Bacteria 195195
283 Ga0496101_0000462 3300048904 Bacteria 25778
284 Ga0496101_0004267 3300048904 Bacteria 8963
285 Ga0496101_0024169 3300048904 Bacteria 4203
286 Ga0496102_0000065 3300048905 Bacteria 161370
287 Ga0496102_0000387 3300048905 Bacteria 51915
288 Ga0496102_0004258 3300048905 Bacteria 12095
289 Ga0496102_0033307 3300048905 Bacteria 4628
290 Ga0496102_0110407 3300048905 Bacteria 2563
291 Ga0496102_0163161 3300048905 Bacteria 2096
292 Ga0496103_0000048 3300048906 Bacteria 160911
293 Ga0496103_0000292 3300048906 Bacteria 46843
294 Ga0496103_0008169 3300048906 Bacteria 6211
295 Ga0496103_0037103 3300048906 Bacteria 2986
296 Ga0496103_0144361 3300048906 Bacteria 1523
297 Ga0496104_0043139 3300048907 Bacteria 4236
298 Ga0496104_0066382 3300048907 Bacteria 3426
299 Ga0496104_0218974 3300048907 Bacteria 1816
300 Ga0496105_0004783 3300048908 Bacteria 10224
301 Ga0496105_0036301 3300048908 Bacteria 4060
302 Ga0496106_0014170 3300048909 Bacteria 5888
303 Ga0496106_0021865 3300048909 Bacteria 4751
304 Ga0496106_0024285 3300048909 Bacteria 4505
305 Ga0496107_0000521 3300048910 Bacteria 21374
306 Ga0496107_0012739 3300048910 Bacteria 5876
307 Ga0496107_0036367 3300048910 Bacteria 3532
308 Ga0496107_0128730 3300048910 Bacteria 1868
309 Ga0496108_0018250 3300048911 Bacteria 5745
310 Ga0496108_0079023 3300048911 Bacteria 2785
311 Ga0496109_0003239 3300048912 Bacteria 13560
312 Ga0496109_0055463 3300048912 Bacteria 3615
313 Ga0496109_0113572 3300048912 Bacteria 2519
314 Ga0496109_0434803 3300048912 Bacteria 1239
315 Ga0496110_0012823 3300048913 Bacteria 6905
316 Ga0496110_0025582 3300048913 Bacteria 5046
317 Ga0496111_0021874 3300048914 Bacteria 4470
318 Ga0496112_0005299 3300048915 Bacteria 11126
319 Ga0496112_0019057 3300048915 Bacteria 6468
320 Ga0496112_0032478 3300048915 Bacteria 5069
321 Ga0496112_0077919 3300048915 Bacteria 3278
322 Ga0496112_0172227 3300048915 Bacteria 2130
323 Ga0496113_0235163 3300048916 Bacteria 1461
324 Ga0496114_0007157 3300048917 Bacteria 8801
325 Ga0496114_0070756 3300048917 Bacteria 2931
326 Ga0496115_0001385 3300048918 Bacteria 17323
327 Ga0496115_0006246 3300048918 Bacteria 8716
328 Ga0496116_0000125 3300048919 Bacteria 160885
329 Ga0496116_0007305 3300048919 Bacteria 9841
330 Ga0496117_0000111 3300048920 Bacteria 184570
331 Ga0496117_0001572 3300048920 Bacteria 32413
332 Ga0496117_0157292 3300048920 Bacteria 1336
333 Ga0496118_0000083 3300048921 Bacteria 184570
334 Ga0496118_0000272 3300048921 Bacteria 91016
335 Ga0496118_0001353 3300048921 Bacteria 36982
336 Ga0496119_0002640 3300048922 Bacteria 19420
337 Ga0496119_0027667 3300048922 Bacteria 3890
338 Ga0496119_0060815 3300048922 Bacteria 2259
339 Ga0496120_0013212 3300048923 Bacteria 5572
340 Ga0496120_0015070 3300048923 Bacteria 5115
341 Ga0496121_0000728 3300048924 Bacteria 60874
342 Ga0496124_0085384 3300048927 Bacteria 2586
343 Ga0496125_0031000 3300048928 Bacteria 4773
344 Ga0496125_0092316 3300048928 Bacteria 2264
345 Ga0496126_0000220 3300048929 Bacteria 124547
346 Ga0496126_0001476 3300048929 Bacteria 36542
347 Ga0496126_0095751 3300048929 Bacteria 2603
348 Ga0501034_0046887 3300049571 Bacteria 4366
349 Ga0501034_0338218 3300049571 Bacteria 1436
350 Ga0501069_0175020 3300049585 Bacteria 1239
351 nmdc:mga03n38_15549_c1 3300050490 Bacteria 2940
352 nmdc:mga03n38_84882_c1 3300050490 Bacteria 1496
353 nmdc:mga00v17_161227_c1 3300050491 Bacteria 1444
354 nmdc:mga00v17_26858_c1 3300050491 Bacteria 3358
355 nmdc:mga00v17_2758_c1 3300050491 Bacteria 9012
356 nmdc:mga0yw44_14775_c1 3300050492 Bacteria 4158
357 nmdc:mga0yw44_19636_c1 3300050492 Bacteria 3731
358 nmdc:mga06z11_3182_c1 3300050494 Bacteria 6337
359 nmdc:mga07m45_18539_c1 3300050496 Bacteria 3759
360 nmdc:mga07m45_9460_c1 3300050496 Bacteria 5056
361 nmdc:mga05p37_68519_c1 3300050507 Bacteria 4363
362 nmdc:mga0qj67_16380_c1 3300050509 Bacteria 5621
363 nmdc:mga08y16_105645_c1 3300050511 Bacteria 2931
364 nmdc:mga0sz30_29227_c1 3300050516 Bacteria 2271
365 nmdc:mga0sz30_83198_c1 3300050516 Bacteria 1386
366 Ga0495655_0038740 3300053083 Bacteria 1204
367 Ga0500643_003235 3300053087 Bacteria 7931
368 Ga0500643_016362 3300053087 Bacteria 2514
369 Ga0500562_015948 3300053108 Bacteria 1930
370 Ga0500652_003572 3300053131 Bacteria 4718
371 Ga0500559_0102452 3300053136 Bacteria 1320
372 Ga0500616_0002138 3300053153 Bacteria 17100
373 Ga0500645_000056 3300053730 Bacteria 92126
374 Ga0466962_0006764 3300061719 Bacteria 5501
375 Ga0466962_0046047 3300061719 Bacteria 2085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0186882 Ga0466957_0186882_402_1334 303
2 3300053087 Ga0500643_016362 Ga0500643_016362_892_1914 319
3 3300047320 Ga0495672_0025777 Ga0495672_0025777_2169_3230 321
4 3300037853 Ga0436364_0090351 Ga0436364_0090351_9911_10975 330
5 3300048929 Ga0496126_0001476 Ga0496126_0001476_24440_25531 336
6 3300044694 Ga0466963_0053479 Ga0466963_0053479_1396_2493 337
7 3300048905 Ga0496102_0163161 Ga0496102_0163161_840_1922 339
8 3300048906 Ga0496103_0037103 Ga0496103_0037103_137_1219 339
9 3300048920 Ga0496117_0157292 Ga0496117_0157292_93_1175 339
10 3300048921 Ga0496118_0000272 Ga0496118_0000272_50927_52009 339
11 3300053153 Ga0500616_0002138 Ga0500616_0002138_6243_7277 340
12 3300006038 Ga0075365_10014943 Ga0075365_100149436 341
13 3300006051 Ga0075364_10174895 Ga0075364_101748952 341
14 3300009174 Ga0105241_10411272 Ga0105241_104112722 341
15 3300039437 Ga0436365_1833781 Ga0436365_1833781_25880_26926 341
16 3300005578 Ga0068854_100021027 Ga0068854_1000210273 342
17 3300005616 Ga0068852_100171324 Ga0068852_1001713243 342
18 3300013308 Ga0157375_10292102 Ga0157375_102921022 342
19 3300014325 Ga0163163_10045788 Ga0163163_100457883 342
20 3300026142 Ga0207698_10169790 Ga0207698_101697902 342
21 3300035242 Ga0373962_0037065 Ga0373962_0037065_127_1155 342
22 3300045976 Ga0466967_0034788 Ga0466967_0034788_1334_2362 342
23 3300048903 Ga0496100_0025025 Ga0496100_0025025_107_1156 342
24 3300048905 Ga0496102_0033307 Ga0496102_0033307_174_1202 342
25 3300048906 Ga0496103_0144361 Ga0496103_0144361_162_1190 342
26 3300048908 Ga0496105_0036301 Ga0496105_0036301_2139_3167 342
27 3300048909 Ga0496106_0021865 Ga0496106_0021865_1107_2156 342
28 3300048910 Ga0496107_0128730 Ga0496107_0128730_490_1539 342
29 3300048911 Ga0496108_0079023 Ga0496108_0079023_130_1158 342
30 3300048912 Ga0496109_0113572 Ga0496109_0113572_52_1080 342
31 3300048913 Ga0496110_0025582 Ga0496110_0025582_839_1867 342
32 3300048914 Ga0496111_0021874 Ga0496111_0021874_2431_3459 342
33 3300048915 Ga0496112_0005299 Ga0496112_0005299_1585_2613 342
34 3300048915 Ga0496112_0077919 Ga0496112_0077919_1053_2081 342
35 3300048928 Ga0496125_0092316 Ga0496125_0092316_126_1217 342
36 3300048929 Ga0496126_0095751 Ga0496126_0095751_735_1826 342
37 3300050492 nmdc:mga0yw44_14775_c1 nmdc:mga0yw44_14775_c1_2467_3495 342
38 3300053083 Ga0495655_0038740 Ga0495655_0038740_52_1080 342
39 3300053730 Ga0500645_000056 Ga0500645_000056_64638_65729 342
40 3300061719 Ga0466962_0006764 Ga0466962_0006764_1409_2497 342
41 3300053131 Ga0500652_003572 Ga0500652_003572_1504_2595 343
42 3300005842 Ga0068858_100123180 Ga0068858_1001231802 344
43 3300026035 Ga0207703_10166927 Ga0207703_101669272 344
44 3300048912 Ga0496109_0434803 Ga0496109_0434803_143_1228 344
45 3300053136 Ga0500559_0102452 Ga0500559_0102452_200_1288 344
46 3300013105 Ga0157369_10090170 Ga0157369_100901702 346
47 3300048922 Ga0496119_0060815 Ga0496119_0060815_1151_2230 346
48 3300006186 Ga0075369_10095615 Ga0075369_100956151 351
49 3300046460 Ga0495638_0021490 Ga0495638_0021490_330_1457 351
50 3300053108 Ga0500562_015948 Ga0500562_015948_227_1300 351
51 iso_pu_bacteria 2902792274 2902797214 351
52 iso_pu_bacteria 2939582691 2939585109 351
53 3300005337 Ga0070682_100051447 Ga0070682_1000514471 352
54 3300005356 Ga0070674_100379163 Ga0070674_1003791631 352
55 3300005840 Ga0068870_10122080 Ga0068870_101220802 352
56 3300009177 Ga0105248_10304932 Ga0105248_103049323 352
57 3300025931 Ga0207644_10231272 Ga0207644_102312722 352
58 3300025941 Ga0207711_10371536 Ga0207711_103715361 352
59 3300045836 Ga0466958_0185829 Ga0466958_0185829_122_1204 352
60 3300046460 Ga0495638_0002708 Ga0495638_0002708_1985_3061 352
61 3300048903 Ga0496100_0002372 Ga0496100_0002372_5492_6568 352
62 3300048904 Ga0496101_0004267 Ga0496101_0004267_981_2057 352
63 3300048907 Ga0496104_0043139 Ga0496104_0043139_1095_2171 352
64 3300048908 Ga0496105_0004783 Ga0496105_0004783_216_1292 352
65 3300048909 Ga0496106_0024285 Ga0496106_0024285_627_1703 352
66 3300048918 Ga0496115_0006246 Ga0496115_0006246_4277_5353 352
67 3300049571 Ga0501034_0338218 Ga0501034_0338218_178_1257 352
68 3300049585 Ga0501069_0175020 Ga0501069_0175020_115_1194 352
69 iso_pu_bacteria 2738541274 2738706329 352
70 iso_pu_bacteria 2738543028 2739328819 352
71 iso_pu_bacteria 2842134933 2842139515 352
72 iso_pu_bacteria 2902799365 2902804109 352
73 3300005347 Ga0070668_100009869 Ga0070668_1000098696 353
74 3300025972 Ga0207668_10028943 Ga0207668_100289434 353
75 3300006038 Ga0075365_10010254 Ga0075365_100102548 354
76 3300006038 Ga0075365_10194326 Ga0075365_101943262 354
77 3300006042 Ga0075368_10055450 Ga0075368_100554502 354
78 3300006048 Ga0075363_100033222 Ga0075363_1000332223 354
79 3300006178 Ga0075367_10131615 Ga0075367_101316152 354
80 3300006195 Ga0075366_10074083 Ga0075366_100740833 354
81 3300006353 Ga0075370_10021810 Ga0075370_100218102 354
82 3300027866 Ga0209813_10023766 Ga0209813_100237661 354
83 3300005353 Ga0070669_100001060 Ga0070669_10000106018 355
84 3300005367 Ga0070667_100000960 Ga0070667_10000096020 355
85 3300005617 Ga0068859_100004535 Ga0068859_1000045353 355
86 3300005841 Ga0068863_100000105 Ga0068863_10000010521 355
87 3300005843 Ga0068860_100000209 Ga0068860_10000020920 355
88 3300005844 Ga0068862_100000400 Ga0068862_10000040021 355
89 3300006931 Ga0097620_100004535 Ga0097620_1000045353 355
90 3300009101 Ga0105247_10000141 Ga0105247_1000014118 355
91 3300009177 Ga0105248_10001091 Ga0105248_1000109119 355
92 3300009545 Ga0105237_10001867 Ga0105237_1000186714 355
93 3300009553 Ga0105249_10000031 Ga0105249_10000031211 355
94 3300010375 Ga0105239_10007046 Ga0105239_100070463 355
95 3300025900 Ga0207710_10000164 Ga0207710_1000016418 355
96 3300025923 Ga0207681_10000456 Ga0207681_100004566 355
97 3300025941 Ga0207711_10000196 Ga0207711_1000019649 355
98 3300025961 Ga0207712_10000029 Ga0207712_10000029211 355
99 3300025986 Ga0207658_10000517 Ga0207658_1000051730 355
100 3300026088 Ga0207641_10000581 Ga0207641_100005816 355
101 3300028380 Ga0268265_10000389 Ga0268265_1000038920 355
102 3300028381 Ga0268264_10000017 Ga0268264_10000017165 355
103 3300044901 Ga0466960_0014545 Ga0466960_0014545_1396_2475 355
104 3300046507 Ga0495606_0047622 Ga0495606_0047622_111_1190 355
105 3300046524 Ga0495648_0017429 Ga0495648_0017429_655_1734 355
106 3300046616 Ga0495668_0010283 Ga0495668_0010283_2343_3422 355
107 3300047320 Ga0495672_0019498 Ga0495672_0019498_1881_2960 355
108 3300047469 Ga0495673_0000524 Ga0495673_0000524_12231_13310 355
109 3300048903 Ga0496100_0004442 Ga0496100_0004442_1149_2228 355
110 3300048903 Ga0496100_0006094 Ga0496100_0006094_4762_5841 355
111 3300048904 Ga0496101_0000031 Ga0496101_0000031_64385_65464 355
112 3300048904 Ga0496101_0024169 Ga0496101_0024169_223_1302 355
113 3300048905 Ga0496102_0000065 Ga0496102_0000065_110946_112025 355
114 3300048905 Ga0496102_0000387 Ga0496102_0000387_34638_35717 355
115 3300048906 Ga0496103_0000048 Ga0496103_0000048_110487_111566 355
116 3300048906 Ga0496103_0000292 Ga0496103_0000292_28964_30043 355
117 3300048910 Ga0496107_0036367 Ga0496107_0036367_365_1444 355
118 3300048919 Ga0496116_0000125 Ga0496116_0000125_49346_50425 355
119 3300048919 Ga0496116_0007305 Ga0496116_0007305_2253_3332 355
120 3300048920 Ga0496117_0000111 Ga0496117_0000111_49346_50425 355
121 3300048920 Ga0496117_0001572 Ga0496117_0001572_15136_16215 355
122 3300048921 Ga0496118_0000083 Ga0496118_0000083_49346_50425 355
123 3300048921 Ga0496118_0001353 Ga0496118_0001353_28845_29924 355
124 3300048922 Ga0496119_0002640 Ga0496119_0002640_13719_14798 355
125 3300048922 Ga0496119_0027667 Ga0496119_0027667_22_1101 355
126 3300048923 Ga0496120_0013212 Ga0496120_0013212_4472_5551 355
127 3300048923 Ga0496120_0015070 Ga0496120_0015070_2708_3787 355
128 3300048924 Ga0496121_0000728 Ga0496121_0000728_41546_42625 355
129 3300048927 Ga0496124_0085384 Ga0496124_0085384_1019_2098 355
130 3300048928 Ga0496125_0031000 Ga0496125_0031000_2436_3515 355
131 3300048929 Ga0496126_0000220 Ga0496126_0000220_68421_69500 355
132 3300049571 Ga0501034_0046887 Ga0501034_0046887_328_1395 355
133 3300053087 Ga0500643_003235 Ga0500643_003235_1221_2300 355
134 3300021384 Ga0213876_10038564 Ga0213876_100385643 356
135 3300002077 JGI24744J21845_10001174 JGI24744J21845_100011746 357
136 3300002077 JGI24744J21845_10002957 JGI24744J21845_100029572 357
137 3300005328 Ga0070676_10058441 Ga0070676_100584412 357
138 3300005334 Ga0068869_100002932 Ga0068869_10000293213 357
139 3300005335 Ga0070666_10080072 Ga0070666_100800722 357
140 3300005337 Ga0070682_100168043 Ga0070682_1001680431 357
141 3300005338 Ga0068868_100019230 Ga0068868_1000192305 357
142 3300005339 Ga0070660_100068648 Ga0070660_1000686481 357
143 3300005340 Ga0070689_100073179 Ga0070689_1000731793 357
144 3300005343 Ga0070687_100037260 Ga0070687_1000372603 357
145 3300005343 Ga0070687_100173044 Ga0070687_1001730441 357
146 3300005345 Ga0070692_10026143 Ga0070692_100261433 357
147 3300005347 Ga0070668_100006625 Ga0070668_1000066258 357
148 3300005347 Ga0070668_100068015 Ga0070668_1000680153 357
149 3300005347 Ga0070668_100096613 Ga0070668_1000966131 357
150 3300005353 Ga0070669_100068281 Ga0070669_1000682812 357
151 3300005354 Ga0070675_100468882 Ga0070675_1004688821 357
152 3300005355 Ga0070671_100000693 Ga0070671_10000069321 357
153 3300005356 Ga0070674_100041160 Ga0070674_1000411602 357
154 3300005356 Ga0070674_100056610 Ga0070674_1000566103 357
155 3300005365 Ga0070688_100020667 Ga0070688_1000206673 357
156 3300005366 Ga0070659_100015792 Ga0070659_1000157922 357
157 3300005367 Ga0070667_100017794 Ga0070667_1000177946 357
158 3300005367 Ga0070667_100042622 Ga0070667_1000426223 357
159 3300005367 Ga0070667_100095006 Ga0070667_1000950063 357
160 3300005435 Ga0070714_100013034 Ga0070714_1000130346 357
161 3300005435 Ga0070714_100179863 Ga0070714_1001798632 357
162 3300005437 Ga0070710_10001385 Ga0070710_100013852 357
163 3300005437 Ga0070710_10007934 Ga0070710_100079342 357
164 3300005437 Ga0070710_10014992 Ga0070710_100149925 357
165 3300005439 Ga0070711_100002751 Ga0070711_1000027512 357
166 3300005439 Ga0070711_100010221 Ga0070711_1000102216 357
167 3300005441 Ga0070700_100002767 Ga0070700_1000027678 357
168 3300005444 Ga0070694_100015528 Ga0070694_1000155285 357
169 3300005455 Ga0070663_100076732 Ga0070663_1000767321 357
170 3300005455 Ga0070663_100103658 Ga0070663_1001036582 357
171 3300005456 Ga0070678_100002337 Ga0070678_1000023379 357
172 3300005456 Ga0070678_100051691 Ga0070678_1000516913 357
173 3300005456 Ga0070678_100225975 Ga0070678_1002259751 357
174 3300005457 Ga0070662_100010075 Ga0070662_1000100756 357
175 3300005457 Ga0070662_100031513 Ga0070662_1000315134 357
176 3300005459 Ga0068867_100005051 Ga0068867_1000050519 357
177 3300005539 Ga0068853_100003834 Ga0068853_1000038346 357
178 3300005545 Ga0070695_100027954 Ga0070695_1000279542 357
179 3300005546 Ga0070696_100006372 Ga0070696_1000063722 357
180 3300005548 Ga0070665_100030751 Ga0070665_1000307515 357
181 3300005548 Ga0070665_100288864 Ga0070665_1002888641 357
182 3300005549 Ga0070704_100013226 Ga0070704_1000132262 357
183 3300005578 Ga0068854_100003641 Ga0068854_1000036412 357
184 3300005615 Ga0070702_100031729 Ga0070702_1000317293 357
185 3300005617 Ga0068859_100171541 Ga0068859_1001715411 357
186 3300005718 Ga0068866_10001953 Ga0068866_100019538 357
187 3300005719 Ga0068861_100015468 Ga0068861_1000154686 357
188 3300005841 Ga0068863_100006517 Ga0068863_10000651711 357
189 3300005842 Ga0068858_100010352 Ga0068858_1000103528 357
190 3300005842 Ga0068858_100043854 Ga0068858_1000438544 357
191 3300005843 Ga0068860_100039127 Ga0068860_1000391275 357
192 3300005843 Ga0068860_100132431 Ga0068860_1001324312 357
193 3300005844 Ga0068862_100005740 Ga0068862_1000057402 357
194 3300005844 Ga0068862_100121536 Ga0068862_1001215362 357
195 3300005937 Ga0081455_10063460 Ga0081455_100634602 357
196 3300006038 Ga0075365_10006929 Ga0075365_1000692910 357
197 3300006048 Ga0075363_100012220 Ga0075363_1000122204 357
198 3300006048 Ga0075363_100028716 Ga0075363_1000287161 357
199 3300006048 Ga0075363_100041847 Ga0075363_1000418472 357
200 3300006051 Ga0075364_10038668 Ga0075364_100386682 357
201 3300006163 Ga0070715_10008744 Ga0070715_100087443 357
202 3300006173 Ga0070716_100007934 Ga0070716_1000079346 357
203 3300006173 Ga0070716_100045054 Ga0070716_1000450543 357
204 3300006175 Ga0070712_100003957 Ga0070712_1000039578 357
205 3300006177 Ga0075362_10006017 Ga0075362_100060173 357
206 3300006186 Ga0075369_10000684 Ga0075369_100006842 357
207 3300006353 Ga0075370_10030623 Ga0075370_100306233 357
208 3300006358 Ga0068871_100050321 Ga0068871_1000503213 357
209 3300006844 Ga0075428_100005448 Ga0075428_10000544815 357
210 3300006846 Ga0075430_100029560 Ga0075430_1000295603 357
211 3300006881 Ga0068865_100002783 Ga0068865_1000027839 357
212 3300006881 Ga0068865_100151200 Ga0068865_1001512002 357
213 3300006931 Ga0097620_100171556 Ga0097620_1001715561 357
214 3300009098 Ga0105245_10006580 Ga0105245_100065809 357
215 3300009101 Ga0105247_10003401 Ga0105247_100034012 357
216 3300009147 Ga0114129_10090997 Ga0114129_100909973 357
217 3300009148 Ga0105243_10071346 Ga0105243_100713463 357
218 3300009174 Ga0105241_10006169 Ga0105241_100061696 357
219 3300009176 Ga0105242_10004138 Ga0105242_100041389 357
220 3300009177 Ga0105248_10031723 Ga0105248_100317232 357
221 3300009553 Ga0105249_10046773 Ga0105249_100467733 357
222 3300009553 Ga0105249_10111788 Ga0105249_101117882 357
223 3300010375 Ga0105239_10078911 Ga0105239_100789113 357
224 3300011119 Ga0105246_10215937 Ga0105246_102159371 357
225 3300013297 Ga0157378_10046847 Ga0157378_100468474 357
226 3300013306 Ga0163162_10078903 Ga0163162_100789032 357
227 3300013307 Ga0157372_10415364 Ga0157372_104153642 357
228 3300013308 Ga0157375_10001251 Ga0157375_100012519 357
229 3300014326 Ga0157380_10018585 Ga0157380_100185856 357
230 3300014745 Ga0157377_10064889 Ga0157377_100648891 357
231 3300014745 Ga0157377_10100709 Ga0157377_101007092 357
232 3300014968 Ga0157379_10008367 Ga0157379_100083678 357
233 3300014968 Ga0157379_10094948 Ga0157379_100949482 357
234 3300014969 Ga0157376_10032320 Ga0157376_100323204 357
235 3300017792 Ga0163161_10021613 Ga0163161_100216132 357
236 3300017792 Ga0163161_10118394 Ga0163161_101183941 357
237 3300021384 Ga0213876_10001902 Ga0213876_100019028 357
238 3300021388 Ga0213875_10021377 Ga0213875_100213771 357
239 3300025898 Ga0207692_10003535 Ga0207692_100035353 357
240 3300025899 Ga0207642_10000179 Ga0207642_1000017915 357
241 3300025900 Ga0207710_10001390 Ga0207710_100013909 357
242 3300025901 Ga0207688_10001929 Ga0207688_100019292 357
243 3300025901 Ga0207688_10002258 Ga0207688_100022582 357
244 3300025903 Ga0207680_10077955 Ga0207680_100779551 357
245 3300025903 Ga0207680_10090671 Ga0207680_100906711 357
246 3300025905 Ga0207685_10001342 Ga0207685_100013425 357
247 3300025905 Ga0207685_10002772 Ga0207685_100027724 357
248 3300025907 Ga0207645_10017196 Ga0207645_100171962 357
249 3300025907 Ga0207645_10047682 Ga0207645_100476823 357
250 3300025915 Ga0207693_10005747 Ga0207693_100057472 357
251 3300025915 Ga0207693_10013467 Ga0207693_100134676 357
252 3300025916 Ga0207663_10002588 Ga0207663_100025883 357
253 3300025916 Ga0207663_10016705 Ga0207663_100167052 357
254 3300025919 Ga0207657_10160359 Ga0207657_101603591 357
255 3300025923 Ga0207681_10119405 Ga0207681_101194052 357
256 3300025927 Ga0207687_10041467 Ga0207687_100414671 357
257 3300025929 Ga0207664_10149096 Ga0207664_101490963 357
258 3300025931 Ga0207644_10029843 Ga0207644_100298433 357
259 3300025931 Ga0207644_10213613 Ga0207644_102136131 357
260 3300025932 Ga0207690_10087294 Ga0207690_100872943 357
261 3300025932 Ga0207690_10179197 Ga0207690_101791973 357
262 3300025933 Ga0207706_10033181 Ga0207706_100331814 357
263 3300025933 Ga0207706_10048673 Ga0207706_100486732 357
264 3300025934 Ga0207686_10027906 Ga0207686_100279063 357
265 3300025935 Ga0207709_10002137 Ga0207709_1000213710 357
266 3300025936 Ga0207670_10009159 Ga0207670_100091593 357
267 3300025937 Ga0207669_10001598 Ga0207669_100015988 357
268 3300025938 Ga0207704_10002309 Ga0207704_100023098 357
269 3300025938 Ga0207704_10026691 Ga0207704_100266914 357
270 3300025939 Ga0207665_10021691 Ga0207665_100216912 357
271 3300025939 Ga0207665_10054257 Ga0207665_100542572 357
272 3300025940 Ga0207691_10026272 Ga0207691_100262726 357
273 3300025940 Ga0207691_10065125 Ga0207691_100651254 357
274 3300025941 Ga0207711_10003673 Ga0207711_100036735 357
275 3300025942 Ga0207689_10002479 Ga0207689_100024792 357
276 3300025942 Ga0207689_10029767 Ga0207689_100297672 357
277 3300025949 Ga0207667_10108612 Ga0207667_101086123 357
278 3300025961 Ga0207712_10034853 Ga0207712_100348532 357
279 3300025961 Ga0207712_10074058 Ga0207712_100740583 357
280 3300025972 Ga0207668_10025503 Ga0207668_100255032 357
281 3300025981 Ga0207640_10001076 Ga0207640_100010769 357
282 3300025986 Ga0207658_10011131 Ga0207658_100111312 357
283 3300025986 Ga0207658_10070096 Ga0207658_100700963 357
284 3300025986 Ga0207658_10118017 Ga0207658_101180171 357
285 3300025986 Ga0207658_10172298 Ga0207658_101722982 357
286 3300026023 Ga0207677_10013097 Ga0207677_100130973 357
287 3300026035 Ga0207703_10007260 Ga0207703_100072602 357
288 3300026035 Ga0207703_10074182 Ga0207703_100741823 357
289 3300026041 Ga0207639_10003868 Ga0207639_100038687 357
290 3300026067 Ga0207678_10043825 Ga0207678_100438252 357
291 3300026067 Ga0207678_10123082 Ga0207678_101230822 357
292 3300026075 Ga0207708_10019587 Ga0207708_100195872 357
293 3300026075 Ga0207708_10088725 Ga0207708_100887252 357
294 3300026088 Ga0207641_10026429 Ga0207641_100264293 357
295 3300026118 Ga0207675_100008196 Ga0207675_1000081969 357
296 3300026118 Ga0207675_100135793 Ga0207675_1001357931 357
297 3300026121 Ga0207683_10006112 Ga0207683_100061122 357
298 3300026121 Ga0207683_10017811 Ga0207683_100178112 357
299 3300026142 Ga0207698_10047714 Ga0207698_100477145 357
300 3300028379 Ga0268266_10006438 Ga0268266_100064388 357
301 3300028379 Ga0268266_10227640 Ga0268266_102276401 357
302 3300028380 Ga0268265_10015615 Ga0268265_100156151 357
303 3300028381 Ga0268264_10004905 Ga0268264_100049059 357
304 3300031824 Ga0307413_10166908 Ga0307413_101669082 357
305 3300031852 Ga0307410_10007287 Ga0307410_100072874 357
306 3300031995 Ga0307409_100011193 Ga0307409_1000111934 357
307 3300032004 Ga0307414_10161883 Ga0307414_101618832 357
308 3300032126 Ga0307415_100137723 Ga0307415_1001377232 357
309 3300037853 Ga0436364_0632914 Ga0436364_0632914_4550_5647 357
310 3300039437 Ga0436365_1818399 Ga0436365_1818399_25416_26513 357
311 3300039450 Ga0436363_1636492 Ga0436363_1636492_1620_2714 357
312 3300041411 Ga0439466_0001147 Ga0439466_0001147_4476_5549 357
313 3300041411 Ga0439466_0012543 Ga0439466_0012543_940_2013 357
314 3300041413 Ga0439465_0000834 Ga0439465_0000834_3177_4250 357
315 3300041413 Ga0439465_0001830 Ga0439465_0001830_2259_3332 357
316 3300041413 Ga0439465_0001856 Ga0439465_0001856_597_1670 357
317 3300041997 Ga0439431_0006206 Ga0439431_0006206_985_2058 357
318 3300042435 Ga0439434_0019119 Ga0439434_0019119_822_1895 357
319 3300044658 Ga0466972_0013919 Ga0466972_0013919_2206_3279 357
320 3300044683 Ga0466965_0002797 Ga0466965_0002797_3906_4979 357
321 3300044684 Ga0466966_0024221 Ga0466966_0024221_330_1424 357
322 3300044684 Ga0466966_0061612 Ga0466966_0061612_1085_2179 357
323 3300044693 Ga0466961_0014354 Ga0466961_0014354_3518_4612 357
324 3300044693 Ga0466961_0153025 Ga0466961_0153025_315_1409 357
325 3300044694 Ga0466963_0071248 Ga0466963_0071248_808_1902 357
326 3300044706 Ga0466964_0003506 Ga0466964_0003506_2231_3304 357
327 3300044719 Ga0466971_0005069 Ga0466971_0005069_1170_2243 357
328 3300044719 Ga0466971_0050061 Ga0466971_0050061_586_1680 357
329 3300044735 Ga0466968_0022362 Ga0466968_0022362_468_1541 357
330 3300044765 Ga0466970_0020813 Ga0466970_0020813_1993_3066 357
331 3300044842 Ga0466957_0020030 Ga0466957_0020030_272_1345 357
332 3300045049 Ga0466959_0003472 Ga0466959_0003472_7269_8342 357
333 3300045049 Ga0466959_0023697 Ga0466959_0023697_1070_2164 357
334 3300045049 Ga0466959_0031822 Ga0466959_0031822_2623_3717 357
335 3300045836 Ga0466958_0016528 Ga0466958_0016528_2914_4008 357
336 3300045836 Ga0466958_0019392 Ga0466958_0019392_1856_2950 357
337 3300045976 Ga0466967_0058051 Ga0466967_0058051_317_1390 357
338 3300045976 Ga0466967_0061763 Ga0466967_0061763_1976_3070 357
339 3300046459 Ga0495629_0019549 Ga0495629_0019549_1340_2413 357
340 3300046461 Ga0495641_0030727 Ga0495641_0030727_1346_2419 357
341 3300046475 Ga0495639_0027016 Ga0495639_0027016_242_1315 357
342 3300046533 Ga0495640_0055687 Ga0495640_0055687_1167_2240 357
343 3300047319 Ga0495674_0075580 Ga0495674_0075580_1506_2579 357
344 3300047321 Ga0495676_0087904 Ga0495676_0087904_1032_2105 357
345 3300047673 Ga0495593_0009997 Ga0495593_0009997_2373_3446 357
346 3300048903 Ga0496100_0014470 Ga0496100_0014470_1929_3002 357
347 3300048904 Ga0496101_0000462 Ga0496101_0000462_9666_10739 357
348 3300048905 Ga0496102_0004258 Ga0496102_0004258_2834_3907 357
349 3300048905 Ga0496102_0110407 Ga0496102_0110407_898_1971 357
350 3300048906 Ga0496103_0008169 Ga0496103_0008169_2982_4055 357
351 3300048907 Ga0496104_0066382 Ga0496104_0066382_348_1421 357
352 3300048907 Ga0496104_0218974 Ga0496104_0218974_611_1684 357
353 3300048909 Ga0496106_0014170 Ga0496106_0014170_132_1205 357
354 3300048910 Ga0496107_0000521 Ga0496107_0000521_10792_11865 357
355 3300048910 Ga0496107_0012739 Ga0496107_0012739_4382_5455 357
356 3300048911 Ga0496108_0018250 Ga0496108_0018250_4554_5627 357
357 3300048912 Ga0496109_0003239 Ga0496109_0003239_8514_9587 357
358 3300048912 Ga0496109_0055463 Ga0496109_0055463_984_2057 357
359 3300048913 Ga0496110_0012823 Ga0496110_0012823_5196_6269 357
360 3300048915 Ga0496112_0019057 Ga0496112_0019057_1066_2139 357
361 3300048915 Ga0496112_0032478 Ga0496112_0032478_3019_4092 357
362 3300048915 Ga0496112_0172227 Ga0496112_0172227_1002_2075 357
363 3300048916 Ga0496113_0235163 Ga0496113_0235163_372_1445 357
364 3300048917 Ga0496114_0007157 Ga0496114_0007157_1208_2281 357
365 3300048917 Ga0496114_0070756 Ga0496114_0070756_752_1825 357
366 3300048918 Ga0496115_0001385 Ga0496115_0001385_9678_10751 357
367 3300050490 nmdc:mga03n38_15549_c1 nmdc:mga03n38_15549_c1_181_1254 357
368 3300050490 nmdc:mga03n38_84882_c1 nmdc:mga03n38_84882_c1_160_1233 357
369 3300050491 nmdc:mga00v17_161227_c1 nmdc:mga00v17_161227_c1_33_1106 357
370 3300050491 nmdc:mga00v17_26858_c1 nmdc:mga00v17_26858_c1_161_1234 357
371 3300050491 nmdc:mga00v17_2758_c1 nmdc:mga00v17_2758_c1_7383_8456 357
372 3300050492 nmdc:mga0yw44_19636_c1 nmdc:mga0yw44_19636_c1_2306_3379 357
373 3300050494 nmdc:mga06z11_3182_c1 nmdc:mga06z11_3182_c1_2307_3380 357
374 3300050496 nmdc:mga07m45_18539_c1 nmdc:mga07m45_18539_c1_1279_2352 357
375 3300050496 nmdc:mga07m45_9460_c1 nmdc:mga07m45_9460_c1_2137_3210 357
376 3300050507 nmdc:mga05p37_68519_c1 nmdc:mga05p37_68519_c1_1294_2403 357
377 3300050509 nmdc:mga0qj67_16380_c1 nmdc:mga0qj67_16380_c1_1910_3019 357
378 3300050511 nmdc:mga08y16_105645_c1 nmdc:mga08y16_105645_c1_511_1584 357
379 3300050516 nmdc:mga0sz30_29227_c1 nmdc:mga0sz30_29227_c1_1173_2246 357
380 3300050516 nmdc:mga0sz30_83198_c1 nmdc:mga0sz30_83198_c1_207_1280 357
381 3300061719 Ga0466962_0046047 Ga0466962_0046047_433_1506 357

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01571

GCV_T

Aminomethyltransferase folate-binding domain

27

246

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uw8-assembly1.cif.gz_C structure of e. coli mce protein mlad, core mce domain 0.7157 264 316
6zy4-assembly1.cif.gz_A cryo-em structure of mlafedb in complex with adp 0.7053 265 315
1vrq-assembly1.cif.gz_C crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid 0.6514 11 196
2gah-assembly1.cif.gz_C heterotetrameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution 0.6239 18 196
1vrq-assembly1.cif.gz_C crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid 0.6028 11 196
ID Description Score Start End Superfamily
1wosA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8919 40 124 3.30.70.1400
1wsvB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8905 43 124 3.30.70.1400
4paaA04 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8851 42 125 3.30.70.1400
3girA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8785 43 123 3.30.70.1400
1yx2B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8736 43 124 3.30.70.1400
ID Description Score Start End GO Terms
AF-A0A3D5Y0V4-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.9232 38 122 GO:0016226
AF-A0A7C7CQ33-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT 0.9226 23 136 GO:0005829
GO:0008168
GO:0032259
AF-A0A2V9D826-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.922 21 124
AF-A0A523LA96-F1-model_v4 deleted 0.9206 23 136
AF-A0A847HZ31-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.9193 23 136 GO:0016226

Feature Viewer

pLDDT pTM Quality
74.12 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map