F428955

General Info

Members Datasets Scaffolds Average Seq Length
381 229 381 328

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10020447|Ga0105237_100204473
Length 346
Sequence VLKTAYHQAAVSRAGQAMKRRKFIKLLGGTAVLPLAVRAQQSERLKRIVMIQALESSDPEAQLRAKAFQQRLVELGWIEGRNVRIDYRWIGSNPDRIRSNVAEVASLKPDVIFAAATPVVAALRDETRAVPIVFVQVVDPVAAGLVASLGRPGGNITGVTNFEYAMGGKWLEALKEVSPSLVRVAVIYSPKTAPYAKSLLRSIADAAPSFSIEPIDTPYHEASEINLVIDNFAQTPNGGLVVLPDTSTLAHRDRIIEGAARHRLPAIYPFRYFVASGGLMSYGTDSIGAVKQATSYVDRILRGAHPDELPVQAPNNFDLVLNLKTAKALGVDLPPTLLARADDVIE

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
144 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
145 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 11.55
Rhizosphere 88.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214736892 2209111006 Bacteria 4025
2 ARcpr5oldR_c000405 3300000041 Bacteria 5944
3 ARcpr5oldR_c000596 3300000041 Bacteria 4431
4 ARSoilYngRDRAFT_c00585 3300000042 Bacteria 3911
5 ARcpr5yngRDRAFT_c000599 3300000043 Bacteria 4527
6 ARSoilOldRDRAFT_c000515 3300000044 Bacteria 4336
7 ARCol0yngRDRAFT_1000486 3300000652 Bacteria 4724
8 JGI24746J21847_1001737 3300001977 Bacteria 3493
9 JGI24737J22298_10026115 3300001990 Bacteria 1845
10 JGI24743J22301_10006619 3300001991 Bacteria 1982
11 JGI24750J21931_1001012 3300002070 Bacteria 3689
12 JGI24745J21846_1000511 3300002073 Bacteria 3446
13 JGI24744J21845_10001310 3300002077 Bacteria 4912
14 JGI24034J26672_10004194 3300002239 Bacteria 2033
15 JGI25404J52841_10006041 3300003659 Bacteria 2519
16 Ga0065715_10128869 3300005293 Bacteria 2041
17 Ga0070676_10049990 3300005328 Bacteria 2449
18 Ga0070670_100006844 3300005331 Bacteria 9659
19 Ga0068869_100008278 3300005334 Bacteria 6699
20 Ga0068869_100039849 3300005334 Bacteria 3356
21 Ga0070682_100209450 3300005337 Bacteria 1381
22 Ga0068868_100011030 3300005338 Bacteria 6569
23 Ga0070689_100109416 3300005340 Bacteria 2196
24 Ga0070687_100006758 3300005343 Bacteria 4726
25 Ga0070668_100280907 3300005347 Bacteria 1390
26 Ga0070671_100045484 3300005355 Bacteria 3649
27 Ga0070674_100267547 3300005356 Bacteria 1349
28 Ga0070673_100050098 3300005364 Bacteria 3263
29 Ga0070688_100124445 3300005365 Unclassified 1731
30 Ga0070667_100145429 3300005367 Bacteria 2079
31 Ga0070713_100364369 3300005436 Bacteria 1343
32 Ga0070710_10016809 3300005437 Bacteria 3731
33 Ga0070711_100132104 3300005439 Bacteria 1860
34 Ga0070705_100007601 3300005440 Bacteria 5340
35 Ga0070708_100201635 3300005445 Bacteria 1863
36 Ga0070708_100535784 3300005445 Bacteria 1105
37 Ga0070663_100078286 3300005455 Bacteria 2423
38 Ga0070663_100136430 3300005455 Bacteria 1868
39 Ga0070678_100038416 3300005456 Bacteria 3370
40 Ga0070662_100026553 3300005457 Bacteria 4012
41 Ga0070662_100206344 3300005457 Bacteria 1561
42 Ga0068867_100113305 3300005459 Bacteria 2086
43 Ga0070706_100191954 3300005467 Bacteria 1908
44 Ga0070707_100111237 3300005468 Bacteria 2656
45 Ga0070707_100130269 3300005468 Bacteria 2446
46 Ga0070699_100414684 3300005518 Unclassified 1219
47 Ga0070697_100132138 3300005536 Bacteria 2094
48 Ga0070697_100327780 3300005536 Unclassified 1319
49 Ga0068853_100021037 3300005539 Bacteria 5430
50 Ga0070672_100123579 3300005543 Unclassified 2121
51 Ga0070686_100029319 3300005544 Bacteria 3346
52 Ga0068857_100074223 3300005577 Bacteria 3031
53 Ga0070702_100183690 3300005615 Bacteria 1370
54 Ga0068852_100079987 3300005616 Bacteria 2896
55 Ga0068859_100128135 3300005617 Bacteria 2609
56 Ga0068864_100040061 3300005618 Bacteria 4007
57 Ga0068866_10016734 3300005718 Bacteria 3285
58 Ga0068861_100045929 3300005719 Bacteria 3291
59 Ga0068858_100011172 3300005842 Bacteria 8489
60 Ga0068860_100133790 3300005843 Bacteria 2380
61 Ga0068862_100042405 3300005844 Bacteria 3876
62 Ga0081455_10176929 3300005937 Bacteria 1619
63 Ga0081455_10213335 3300005937 Bacteria 1437
64 Ga0081455_10237341 3300005937 Bacteria 1342
65 Ga0081540_1000005 3300005983 Bacteria 227052
66 Ga0081540_1024662 3300005983 Bacteria 3484
67 Ga0081540_1093281 3300005983 Bacteria 1319
68 Ga0070717_10404625 3300006028 Bacteria 1226
69 Ga0070717_10410336 3300006028 Unclassified 1217
70 Ga0075432_10047834 3300006058 Bacteria 1504
71 Ga0070715_10033637 3300006163 Bacteria 2097
72 Ga0097621_100159784 3300006237 Bacteria 1936
73 Ga0068871_100236055 3300006358 Bacteria 1588
74 Ga0075428_100071733 3300006844 Bacteria 3785
75 Ga0075428_100115838 3300006844 Bacteria 2919
76 Ga0075428_100211206 3300006844 Bacteria 2097
77 Ga0075428_100226429 3300006844 Bacteria 2018
78 Ga0075428_100650135 3300006844 Bacteria 1124
79 Ga0075430_100025621 3300006846 Bacteria 5019
80 Ga0075430_100077543 3300006846 Bacteria 2785
81 Ga0075430_100077853 3300006846 Bacteria 2779
82 Ga0075430_100138089 3300006846 Bacteria 2030
83 Ga0075430_100187113 3300006846 Bacteria 1722
84 Ga0075430_100268793 3300006846 Unclassified 1411
85 Ga0075431_100056301 3300006847 Bacteria 4056
86 Ga0075431_100112311 3300006847 Unclassified 2812
87 Ga0075431_100143187 3300006847 Bacteria 2464
88 Ga0075431_100381070 3300006847 Bacteria 1414
89 Ga0075431_100540492 3300006847 Bacteria 1153
90 Ga0075433_10003524 3300006852 Bacteria 12089
91 Ga0075433_10003839 3300006852 Bacteria 11632
92 Ga0075433_10071128 3300006852 Bacteria 3058
93 Ga0075433_10246241 3300006852 Unclassified 1586
94 Ga0075434_100020798 3300006871 Bacteria 6370
95 Ga0075434_100036112 3300006871 Bacteria 4887
96 Ga0075434_100224469 3300006871 Unclassified 1898
97 Ga0075434_100328269 3300006871 Unclassified 1550
98 Ga0075429_100053054 3300006880 Unclassified 3528
99 Ga0075429_100137244 3300006880 Bacteria 2140
100 Ga0075429_100220746 3300006880 Unclassified 1660
101 Ga0075429_100228612 3300006880 Bacteria 1629
102 Ga0075429_100282225 3300006880 Bacteria 1454
103 Ga0068865_100015153 3300006881 Bacteria 4912
104 Ga0075436_100207113 3300006914 Bacteria 1390
105 Ga0097620_100128131 3300006931 Bacteria 2609
106 Ga0075435_100169481 3300007076 Bacteria 1842
107 Ga0111539_10021352 3300009094 Bacteria 7970
108 Ga0111539_10048304 3300009094 Bacteria 5082
109 Ga0111539_10118372 3300009094 Bacteria 3105
110 Ga0111539_10146829 3300009094 Bacteria 2761
111 Ga0111539_10572451 3300009094 Bacteria 1316
112 Ga0111539_10641591 3300009094 Bacteria 1236
113 Ga0105247_10114010 3300009101 Bacteria 1743
114 Ga0114129_10139502 3300009147 Bacteria 3324
115 Ga0114129_10162240 3300009147 Bacteria 3052
116 Ga0114129_10213864 3300009147 Bacteria 2605
117 Ga0114129_10303475 3300009147 Bacteria 2127
118 Ga0114129_10313925 3300009147 Unclassified 2086
119 Ga0114129_10390142 3300009147 Bacteria 1837
120 Ga0114129_10565551 3300009147 Bacteria 1477
121 Ga0114129_10629607 3300009147 Bacteria 1387
122 Ga0114129_10775253 3300009147 Unclassified 1225
123 Ga0114129_10858261 3300009147 Bacteria 1153
124 Ga0105243_10042798 3300009148 Bacteria 3547
125 Ga0105242_10147382 3300009176 Bacteria 2049
126 Ga0105248_10207692 3300009177 Bacteria 2206
127 Ga0105237_10020447 3300009545 Bacteria 6822
128 Ga0105238_10378185 3300009551 Bacteria 1407
129 Ga0105249_10320080 3300009553 Bacteria 1562
130 Ga0105239_10031779 3300010375 Bacteria 5801
131 Ga0105239_10381798 3300010375 Bacteria 1593
132 Ga0105246_10058844 3300011119 Bacteria 2663
133 Ga0157374_10250660 3300013296 Bacteria 1742
134 Ga0157378_10343093 3300013297 Bacteria 1457
135 Ga0163162_10247884 3300013306 Bacteria 1913
136 Ga0163162_10273453 3300013306 Bacteria 1821
137 Ga0157375_10137023 3300013308 Bacteria 2573
138 Ga0163163_10094115 3300014325 Bacteria 3013
139 Ga0157380_10070194 3300014326 Bacteria 2830
140 Ga0157377_10007390 3300014745 Bacteria 5303
141 Ga0157379_10183405 3300014968 Bacteria 1891
142 Ga0157376_10123533 3300014969 Bacteria 2298
143 Ga0163161_10026297 3300017792 Bacteria 4122
144 Ga0207692_10057845 3300025898 Bacteria 1995
145 Ga0207710_10114906 3300025900 Bacteria 1281
146 Ga0207688_10019347 3300025901 Bacteria 3708
147 Ga0207680_10066155 3300025903 Bacteria 2222
148 Ga0207685_10080752 3300025905 Bacteria 1345
149 Ga0207699_10271550 3300025906 Bacteria 1175
150 Ga0207645_10015155 3300025907 Bacteria 5133
151 Ga0207645_10068507 3300025907 Bacteria 2269
152 Ga0207643_10008969 3300025908 Bacteria 5369
153 Ga0207643_10073958 3300025908 Bacteria 1965
154 Ga0207684_10068857 3300025910 Bacteria 3008
155 Ga0207671_10002280 3300025914 Bacteria 20756
156 Ga0207693_10170817 3300025915 Bacteria 1712
157 Ga0207663_10041878 3300025916 Bacteria 2794
158 Ga0207663_10290217 3300025916 Bacteria 1218
159 Ga0207662_10035942 3300025918 Bacteria 2895
160 Ga0207657_10081894 3300025919 Bacteria 2710
161 Ga0207649_10075528 3300025920 Bacteria 2166
162 Ga0207646_10153857 3300025922 Bacteria 2074
163 Ga0207650_10099534 3300025925 Bacteria 2235
164 Ga0207659_10124112 3300025926 Bacteria 1983
165 Ga0207644_10068446 3300025931 Bacteria 2590
166 Ga0207706_10122925 3300025933 Bacteria 2283
167 Ga0207706_10295295 3300025933 Bacteria 1412
168 Ga0207686_10083018 3300025934 Bacteria 2096
169 Ga0207670_10099492 3300025936 Bacteria 2074
170 Ga0207670_10186129 3300025936 Bacteria 1567
171 Ga0207669_10050121 3300025937 Bacteria 2493
172 Ga0207704_10159689 3300025938 Bacteria 1602
173 Ga0207665_10260539 3300025939 Bacteria 1284
174 Ga0207711_10128523 3300025941 Bacteria 2269
175 Ga0207689_10127121 3300025942 Bacteria 2097
176 Ga0207679_10104346 3300025945 Bacteria 2224
177 Ga0207651_10043619 3300025960 Bacteria 2995
178 Ga0207712_10009993 3300025961 Bacteria 6016
179 Ga0207668_10344833 3300025972 Bacteria 1243
180 Ga0207658_10188970 3300025986 Bacteria 1710
181 Ga0207677_10102143 3300026023 Bacteria 2113
182 Ga0207703_10022135 3300026035 Bacteria 4982
183 Ga0207678_10014593 3300026067 Bacteria 6914
184 Ga0207708_10040975 3300026075 Bacteria 3532
185 Ga0207641_10051231 3300026088 Bacteria 3496
186 Ga0207648_10157588 3300026089 Bacteria 2004
187 Ga0207676_10162094 3300026095 Bacteria 1938
188 Ga0207674_10049195 3300026116 Bacteria 4313
189 Ga0207675_100026558 3300026118 Bacteria 5390
190 Ga0207683_10065141 3300026121 Bacteria 3212
191 Ga0207698_10043623 3300026142 Bacteria 3362
192 Ga0209966_1002856 3300027695 Bacteria 2896
193 Ga0209998_10003408 3300027717 Bacteria 3479
194 Ga0209974_10038605 3300027876 Bacteria 1587
195 Ga0207428_10001522 3300027907 Bacteria 24210
196 Ga0207428_10005922 3300027907 Bacteria 11320
197 Ga0207428_10007370 3300027907 Bacteria 10036
198 Ga0207428_10046456 3300027907 Bacteria 3492
199 Ga0207428_10052353 3300027907 Bacteria 3260
200 Ga0207428_10090306 3300027907 Unclassified 2380
201 Ga0207428_10117674 3300027907 Bacteria 2040
202 Ga0268265_10020129 3300028380 Bacteria 4653
203 Ga0268264_10054100 3300028381 Bacteria 3351
204 Ga0265763_1000062 3300030763 Bacteria 4422
205 Ga0373930_0009385 3300034816 Bacteria 1730
206 Ga0373958_0003188 3300034819 Bacteria 2352
207 Ga0373928_0000134 3300035084 Bacteria 14013
208 Ga0373949_0006133 3300035090 Bacteria 2657
209 Ga0373951_0005808 3300035091 Bacteria 2851
210 Ga0373932_0007269 3300035112 Bacteria 2634
211 Ga0373939_0043105 3300035114 Bacteria 1367
212 Ga0373941_0011508 3300035115 Bacteria 2287
213 Ga0373954_0112617 3300035118 Bacteria 1317
214 Ga0373960_0022741 3300035121 Bacteria 1682
215 Ga0373942_0001883 3300035207 Bacteria 5269
216 Ga0373961_0006229 3300035241 Bacteria 2868
217 Ga0373962_0001989 3300035242 Bacteria 4876
218 Ga0373931_0001007 3300035691 Bacteria 11924
219 Ga0373935_0081717 3300035692 Bacteria 2101
220 Ga0373927_0250326 3300035695 Bacteria 1165
221 Ga0373933_0071551 3300035724 Bacteria 2112
222 Ga0373947_0127604 3300035725 Bacteria 1621
223 Ga0373947_0151507 3300035725 Bacteria 1494
224 Ga0373937_0147832 3300036401 Bacteria 2200
225 Ga0373937_0353180 3300036401 Bacteria 1393
226 Ga0395900_0385504 3300037418 Bacteria 1369
227 Ga0451576_0130723 3300045051 Bacteria 2617
228 Ga0495592_0142193 3300046454 Bacteria 1668
229 Ga0495603_0079744 3300046455 Bacteria 1919
230 Ga0495629_0007226 3300046459 Bacteria 8178
231 Ga0495629_0045252 3300046459 Bacteria 3088
232 Ga0495651_0019983 3300046462 Bacteria 5196
233 Ga0495653_0092562 3300046463 Unclassified 2207
234 Ga0495582_0016943 3300046473 Bacteria 3990
235 Ga0495639_0014882 3300046475 Bacteria 3371
236 Ga0495664_0013537 3300046477 Bacteria 4627
237 Ga0495585_0138281 3300046492 Bacteria 1277
238 Ga0495594_0215536 3300046499 Bacteria 1095
239 Ga0495607_0146520 3300046501 Bacteria 1213
240 Ga0495618_0018411 3300046514 Bacteria 4288
241 Ga0495618_0145801 3300046514 Bacteria 1513
242 Ga0495630_0091464 3300046517 Bacteria 2299
243 Ga0495652_0066138 3300046529 Bacteria 3035
244 Ga0495665_0031556 3300046531 Unclassified 2835
245 Ga0495640_0013938 3300046533 Bacteria 6099
246 Ga0495633_0088619 3300046558 Bacteria 1439
247 Ga0495667_0157799 3300046559 Bacteria 1459
248 Ga0495656_0133288 3300046615 Bacteria 1184
249 Ga0495634_0006407 3300046642 Bacteria 8945
250 Ga0495634_0017662 3300046642 Bacteria 5088
251 Ga0495634_0076134 3300046642 Unclassified 2203
252 Ga0495611_0091174 3300046648 Bacteria 1409
253 Ga0495635_0035774 3300046663 Bacteria 3443
254 Ga0495635_0229309 3300046663 Unclassified 1255
255 Ga0495635_0256947 3300046663 Unclassified 1177
256 Ga0495659_0075861 3300046664 Bacteria 1267
257 Ga0495661_0177104 3300046665 Unclassified 1133
258 Ga0495647_0091700 3300046681 Bacteria 1247
259 Ga0495658_0032619 3300046683 Bacteria 2845
260 Ga0495658_0137474 3300046683 Bacteria 1492
261 Ga0495613_0206698 3300046689 Bacteria 1382
262 Ga0495600_0035839 3300046809 Bacteria 3224
263 Ga0495581_0016686 3300047315 Bacteria 4269
264 Ga0495674_0008061 3300047319 Bacteria 10055
265 Ga0495674_0083598 3300047319 Unclassified 2736
266 Ga0495674_0248967 3300047319 Bacteria 1463
267 Ga0495676_0105817 3300047321 Unclassified 2074
268 Ga0495680_0046197 3300047322 Bacteria 3435
269 Ga0495680_0122684 3300047322 Bacteria 1917
270 Ga0495684_0019698 3300047471 Bacteria 5198
271 Ga0495684_0061408 3300047471 Bacteria 2859
272 Ga0495593_0131258 3300047673 Bacteria 1271
273 Ga0496100_0050524 3300048903 Bacteria 2694
274 Ga0496100_0242010 3300048903 Bacteria 1332
275 Ga0496100_0320686 3300048903 Bacteria 1164
276 Ga0496101_0153673 3300048904 Bacteria 1761
277 Ga0496101_0352885 3300048904 Bacteria 1156
278 Ga0496101_0422990 3300048904 Bacteria 1050
279 Ga0496102_0041807 3300048905 Bacteria 4152
280 Ga0496102_0311225 3300048905 Bacteria 1484
281 Ga0496102_0402831 3300048905 Bacteria 1286
282 Ga0496103_0017326 3300048906 Bacteria 4311
283 Ga0496104_0000696 3300048907 Bacteria 28932
284 Ga0496104_0003907 3300048907 Bacteria 12904
285 Ga0496104_0019415 3300048907 Bacteria 6218
286 Ga0496104_0030199 3300048907 Bacteria 5035
287 Ga0496104_0042608 3300048907 Bacteria 4260
288 Ga0496105_0047091 3300048908 Bacteria 3558
289 Ga0496105_0164775 3300048908 Bacteria 1819
290 Ga0496105_0172000 3300048908 Bacteria 1775
291 Ga0496106_0026424 3300048909 Bacteria 4323
292 Ga0496106_0242499 3300048909 Bacteria 1440
293 Ga0496107_0222114 3300048910 Bacteria 1405
294 Ga0496107_0226056 3300048910 Bacteria 1392
295 Ga0496107_0426965 3300048910 Unclassified 985
296 Ga0496108_0022418 3300048911 Bacteria 5190
297 Ga0496108_0126392 3300048911 Bacteria 2195
298 Ga0496109_0011660 3300048912 Bacteria 7558
299 Ga0496109_0061077 3300048912 Bacteria 3445
300 Ga0496109_0226219 3300048912 Unclassified 1760
301 Ga0496109_0466669 3300048912 Bacteria 1192
302 Ga0496110_0088666 3300048913 Bacteria 2763
303 Ga0496110_0157479 3300048913 Unclassified 2058
304 Ga0496110_0532312 3300048913 Bacteria 1068
305 Ga0496111_0158580 3300048914 Bacteria 1679
306 Ga0496111_0226929 3300048914 Bacteria 1387
307 Ga0496112_0092556 3300048915 Bacteria 2993
308 Ga0496112_0118732 3300048915 Bacteria 2614
309 Ga0496113_0013217 3300048916 Bacteria 5582
310 Ga0496113_0221726 3300048916 Bacteria 1507
311 Ga0496113_0284768 3300048916 Bacteria 1322
312 Ga0496113_0348840 3300048916 Bacteria 1187
313 Ga0496114_0128621 3300048917 Bacteria 2185
314 Ga0496115_0029026 3300048918 Bacteria 4341
315 Ga0496115_0035568 3300048918 Bacteria 3941
316 Ga0496115_0105687 3300048918 Bacteria 2311
317 Ga0501076_0140086 3300049592 Unclassified 1965
318 Ga0501045_0322872 3300049824 Bacteria 1149
319 nmdc:mga00v17_161778_c1 3300050491 Bacteria 1441
320 nmdc:mga05p37_134135_c1 3300050507 Bacteria 3037
321 nmdc:mga05p37_151539_c1 3300050507 Bacteria 2836
322 nmdc:mga05p37_171851_c1 3300050507 Bacteria 2643
323 nmdc:mga05p37_233177_c1 3300050507 Unclassified 2217
324 nmdc:mga05p37_42568_c1 3300050507 Bacteria 5367
325 nmdc:mga05p37_42709_c1 3300050507 Bacteria 5573
326 nmdc:mga05p37_453906_c1 3300050507 Bacteria 1483
327 nmdc:mga09592_114802_c1 3300050508 Bacteria 2311
328 nmdc:mga09592_232719_c1 3300050508 Unclassified 1597
329 nmdc:mga09592_37912_c1 3300050508 Bacteria 4045
330 nmdc:mga09592_45682_c1 3300050508 Bacteria 3690
331 nmdc:mga09592_67285_c1 3300050508 Bacteria 3038
332 nmdc:mga09592_83084_c1 3300050508 Bacteria 2730
333 nmdc:mga0qj67_14931_c1 3300050509 Bacteria 5874
334 nmdc:mga0qj67_19922_c1 3300050509 Bacteria 5133
335 nmdc:mga0qj67_27616_c1 3300050509 Unclassified 4401
336 nmdc:mga0qj67_72060_c1 3300050509 Bacteria 2758
337 nmdc:mga06r32_14686_c2 3300050510 Bacteria 4706
338 nmdc:mga06r32_306459_c1 3300050510 Unclassified 1574
339 nmdc:mga06r32_341793_c1 3300050510 Bacteria 1481
340 nmdc:mga06r32_342391_c1 3300050510 Bacteria 1480
341 nmdc:mga06r32_441981_c1 3300050510 Bacteria 1281
342 nmdc:mga06r32_47450_c1 3300050510 Bacteria 4102
343 nmdc:mga06r32_61320_c1 3300050510 Bacteria 3620
344 nmdc:mga06r32_66247_c1 3300050510 Bacteria 3485
345 nmdc:mga08y16_124513_c1 3300050511 Unclassified 2682
346 nmdc:mga08y16_155721_c1 3300050511 Unclassified 2375
347 nmdc:mga08y16_158597_c1 3300050511 Bacteria 2351
348 nmdc:mga08y16_171558_c1 3300050511 Bacteria 2253
349 nmdc:mga08y16_248998_c1 3300050511 Bacteria 1836
350 nmdc:mga08y16_2619_c1 3300050511 Bacteria 18484
351 nmdc:mga08y16_86871_c1 3300050511 Bacteria 3259
352 nmdc:mga08y16_97979_c1 3300050511 Bacteria 3054
353 nmdc:mga0n895_143691_c1 3300050512 Bacteria 2415
354 nmdc:mga0n895_144835_c1 3300050512 Bacteria 2405
355 nmdc:mga0n895_189583_c1 3300050512 Bacteria 2087
356 nmdc:mga0n895_3513_c1 3300050512 Bacteria 12665
357 nmdc:mga0n895_35224_c1 3300050512 Bacteria 4824
358 nmdc:mga0n895_479162_c1 3300050512 Bacteria 1255
359 nmdc:mga0n895_709750_c1 3300050512 Bacteria 1001
360 nmdc:mga0n895_93596_c1 3300050512 Bacteria 3009
361 nmdc:mga0rr50_144916_c1 3300050513 Bacteria 1914
362 nmdc:mga0rr50_387717_c1 3300050513 Bacteria 1179
363 nmdc:mga0rr50_62890_c1 3300050513 Bacteria 2802
364 nmdc:mga08x19_312469_c1 3300050514 Bacteria 1093
365 nmdc:mga08x19_39684_c1 3300050514 Unclassified 2993
366 nmdc:mga0a205_17111_c1 3300050515 Bacteria 6789
367 nmdc:mga0a205_180170_c1 3300050515 Bacteria 2007
368 nmdc:mga0a205_235312_c1 3300050515 Bacteria 1714
369 nmdc:mga0a205_314001_c1 3300050515 Bacteria 1439
370 nmdc:mga0a205_342289_c1 3300050515 Bacteria 1364
371 nmdc:mga0a205_65410_c1 3300050515 Bacteria 3513
372 nmdc:mga0a205_923_c1 3300050515 Bacteria 24235
373 Ga0495601_0005065 3300053077 Bacteria 7647
374 Ga0495601_0005870 3300053077 Bacteria 7157
375 Ga0495601_0162801 3300053077 Bacteria 1458
376 Ga0495612_0013162 3300053078 Bacteria 3332
377 Ga0495595_0005759 3300053084 Bacteria 5017
378 Ga0495595_0011558 3300053084 Bacteria 3693
379 Ga0495619_0009119 3300053085 Bacteria 6263
380 Ga0495619_0013623 3300053085 Bacteria 5125
381 Ga0495619_0233490 3300053085 Unclassified 1274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005365 Ga0070688_100124445 Ga0070688_1001244452 274
2 3300005536 Ga0070697_100132138 Ga0070697_1001321382 282
3 3300006028 Ga0070717_10404625 Ga0070717_104046252 282
4 3300050491 nmdc:mga00v17_161778_c1 nmdc:mga00v17_161778_c1_396_1280 292
5 3300048904 Ga0496101_0352885 Ga0496101_0352885_102_986 293
6 3300053085 Ga0495619_0013623 Ga0495619_0013623_4157_5044 293
7 3300006847 Ga0075431_100381070 Ga0075431_1003810701 299
8 3300025926 Ga0207659_10124112 Ga0207659_101241122 299
9 3300050510 nmdc:mga06r32_66247_c1 nmdc:mga06r32_66247_c1_2281_3210 299
10 3300053078 Ga0495612_0013162 Ga0495612_0013162_2413_3318 299
11 3300025908 Ga0207643_10073958 Ga0207643_100739582 300
12 3300027876 Ga0209974_10038605 Ga0209974_100386052 300
13 3300046665 Ga0495661_0177104 Ga0495661_0177104_16_927 300
14 3300048910 Ga0496107_0426965 Ga0496107_0426965_53_961 300
15 3300048916 Ga0496113_0284768 Ga0496113_0284768_41_949 300
16 3300050512 nmdc:mga0n895_709750_c1 nmdc:mga0n895_709750_c1_27_938 300
17 3300050513 nmdc:mga0rr50_387717_c1 nmdc:mga0rr50_387717_c1_173_1081 300
18 3300050514 nmdc:mga08x19_39684_c1 nmdc:mga08x19_39684_c1_1197_2102 300
19 3300005983 Ga0081540_1093281 Ga0081540_10932811 301
20 3300006852 Ga0075433_10003524 Ga0075433_100035247 301
21 3300006871 Ga0075434_100036112 Ga0075434_1000361122 301
22 3300027907 Ga0207428_10005922 Ga0207428_1000592215 301
23 3300050512 nmdc:mga0n895_3513_c1 nmdc:mga0n895_3513_c1_8496_9506 301
24 3300050515 nmdc:mga0a205_923_c1 nmdc:mga0a205_923_c1_16338_17348 301
25 3300048912 Ga0496109_0466669 Ga0496109_0466669_11_1012 307
26 3300048913 Ga0496110_0157479 Ga0496110_0157479_791_1723 308
27 3300037418 Ga0395900_0385504 Ga0395900_0385504_80_1018 311
28 3300036401 Ga0373937_0353180 Ga0373937_0353180_329_1273 313
29 3300048904 Ga0496101_0422990 Ga0496101_0422990_54_1013 313
30 3300030763 Ga0265763_1000062 Ga0265763_10000626 314
31 3300035695 Ga0373927_0250326 Ga0373927_0250326_122_1075 314
32 3300053077 Ga0495601_0162801 Ga0495601_0162801_345_1331 314
33 3300048907 Ga0496104_0003907 Ga0496104_0003907_564_1565 315
34 3300048912 Ga0496109_0061077 Ga0496109_0061077_376_1377 315
35 3300046499 Ga0495594_0215536 Ga0495594_0215536_126_1085 316
36 3300005983 Ga0081540_1024662 Ga0081540_10246623 320
37 3300005543 Ga0070672_100123579 Ga0070672_1001235792 321
38 3300006844 Ga0075428_100226429 Ga0075428_1002264292 321
39 3300009147 Ga0114129_10139502 Ga0114129_101395024 321
40 3300009147 Ga0114129_10565551 Ga0114129_105655511 321
41 3300046455 Ga0495603_0079744 Ga0495603_0079744_403_1401 321
42 3300046463 Ga0495653_0092562 Ga0495653_0092562_293_1291 321
43 3300046663 Ga0495635_0256947 Ga0495635_0256947_93_1091 321
44 3300047321 Ga0495676_0105817 Ga0495676_0105817_853_1851 321
45 3300047322 Ga0495680_0122684 Ga0495680_0122684_314_1312 321
46 3300050507 nmdc:mga05p37_171851_c1 nmdc:mga05p37_171851_c1_1606_2604 321
47 3300050507 nmdc:mga05p37_453906_c1 nmdc:mga05p37_453906_c1_192_1190 321
48 3300050508 nmdc:mga09592_114802_c1 nmdc:mga09592_114802_c1_476_1474 321
49 3300050511 nmdc:mga08y16_171558_c1 nmdc:mga08y16_171558_c1_687_1685 321
50 3300005437 Ga0070710_10016809 Ga0070710_100168091 323
51 3300005439 Ga0070711_100132104 Ga0070711_1001321041 323
52 3300006163 Ga0070715_10033637 Ga0070715_100336372 323
53 3300025905 Ga0207685_10080752 Ga0207685_100807522 323
54 3300025915 Ga0207693_10170817 Ga0207693_101708173 323
55 3300025916 Ga0207663_10041878 Ga0207663_100418782 323
56 3300048915 Ga0496112_0092556 Ga0496112_0092556_391_1395 323
57 3300048916 Ga0496113_0348840 Ga0496113_0348840_96_1100 323
58 3300009147 Ga0114129_10213864 Ga0114129_102138642 324
59 3300036401 Ga0373937_0147832 Ga0373937_0147832_889_1872 325
60 3300046559 Ga0495667_0157799 Ga0495667_0157799_21_1004 325
61 3300046642 Ga0495634_0076134 Ga0495634_0076134_617_1615 325
62 3300053084 Ga0495595_0011558 Ga0495595_0011558_1362_2345 325
63 3300005445 Ga0070708_100535784 Ga0070708_1005357841 326
64 3300005467 Ga0070706_100191954 Ga0070706_1001919542 326
65 3300005468 Ga0070707_100130269 Ga0070707_1001302693 326
66 3300005518 Ga0070699_100414684 Ga0070699_1004146842 326
67 3300005536 Ga0070697_100327780 Ga0070697_1003277801 326
68 3300006844 Ga0075428_100071733 Ga0075428_1000717334 326
69 3300006847 Ga0075431_100056301 Ga0075431_1000563014 326
70 3300025910 Ga0207684_10068857 Ga0207684_100688572 326
71 3300035725 Ga0373947_0151507 Ga0373947_0151507_88_1074 326
72 3300046501 Ga0495607_0146520 Ga0495607_0146520_215_1201 326
73 3300047319 Ga0495674_0248967 Ga0495674_0248967_398_1381 326
74 3300048913 Ga0496110_0532312 Ga0496110_0532312_59_1048 326
75 3300050510 nmdc:mga06r32_47450_c1 nmdc:mga06r32_47450_c1_1781_2767 326
76 3300001977 JGI24746J21847_1001737 JGI24746J21847_10017373 327
77 3300001991 JGI24743J22301_10006619 JGI24743J22301_100066192 327
78 3300002070 JGI24750J21931_1001012 JGI24750J21931_10010123 327
79 3300002073 JGI24745J21846_1000511 JGI24745J21846_10005113 327
80 3300002077 JGI24744J21845_10001310 JGI24744J21845_100013105 327
81 3300002239 JGI24034J26672_10004194 JGI24034J26672_100041941 327
82 3300003659 JGI25404J52841_10006041 JGI25404J52841_100060412 327
83 3300005328 Ga0070676_10049990 Ga0070676_100499902 327
84 3300005331 Ga0070670_100006844 Ga0070670_1000068448 327
85 3300005334 Ga0068869_100008278 Ga0068869_1000082783 327
86 3300005334 Ga0068869_100039849 Ga0068869_1000398492 327
87 3300005337 Ga0070682_100209450 Ga0070682_1002094502 327
88 3300005338 Ga0068868_100011030 Ga0068868_1000110303 327
89 3300005340 Ga0070689_100109416 Ga0070689_1001094162 327
90 3300005343 Ga0070687_100006758 Ga0070687_1000067584 327
91 3300005347 Ga0070668_100280907 Ga0070668_1002809072 327
92 3300005355 Ga0070671_100045484 Ga0070671_1000454842 327
93 3300005356 Ga0070674_100267547 Ga0070674_1002675471 327
94 3300005364 Ga0070673_100050098 Ga0070673_1000500983 327
95 3300005367 Ga0070667_100145429 Ga0070667_1001454292 327
96 3300005436 Ga0070713_100364369 Ga0070713_1003643692 327
97 3300005440 Ga0070705_100007601 Ga0070705_1000076015 327
98 3300005455 Ga0070663_100078286 Ga0070663_1000782862 327
99 3300005456 Ga0070678_100038416 Ga0070678_1000384163 327
100 3300005457 Ga0070662_100026553 Ga0070662_1000265532 327
101 3300005459 Ga0068867_100113305 Ga0068867_1001133052 327
102 3300005539 Ga0068853_100021037 Ga0068853_1000210374 327
103 3300005544 Ga0070686_100029319 Ga0070686_1000293192 327
104 3300005577 Ga0068857_100074223 Ga0068857_1000742233 327
105 3300005615 Ga0070702_100183690 Ga0070702_1001836902 327
106 3300005616 Ga0068852_100079987 Ga0068852_1000799872 327
107 3300005617 Ga0068859_100128135 Ga0068859_1001281353 327
108 3300005618 Ga0068864_100040061 Ga0068864_1000400613 327
109 3300005718 Ga0068866_10016734 Ga0068866_100167343 327
110 3300005719 Ga0068861_100045929 Ga0068861_1000459292 327
111 3300005842 Ga0068858_100011172 Ga0068858_1000111726 327
112 3300005843 Ga0068860_100133790 Ga0068860_1001337903 327
113 3300005937 Ga0081455_10213335 Ga0081455_102133352 327
114 3300005983 Ga0081540_1000005 Ga0081540_100000557 327
115 3300006028 Ga0070717_10410336 Ga0070717_104103361 327
116 3300006237 Ga0097621_100159784 Ga0097621_1001597843 327
117 3300006358 Ga0068871_100236055 Ga0068871_1002360552 327
118 3300006844 Ga0075428_100115838 Ga0075428_1001158382 327
119 3300006846 Ga0075430_100077853 Ga0075430_1000778532 327
120 3300006871 Ga0075434_100224469 Ga0075434_1002244693 327
121 3300006880 Ga0075429_100228612 Ga0075429_1002286121 327
122 3300006881 Ga0068865_100015153 Ga0068865_1000151532 327
123 3300006914 Ga0075436_100207113 Ga0075436_1002071131 327
124 3300006931 Ga0097620_100128131 Ga0097620_1001281313 327
125 3300009094 Ga0111539_10118372 Ga0111539_101183722 327
126 3300009094 Ga0111539_10146829 Ga0111539_101468292 327
127 3300009101 Ga0105247_10114010 Ga0105247_101140102 327
128 3300009147 Ga0114129_10313925 Ga0114129_103139252 327
129 3300009147 Ga0114129_10629607 Ga0114129_106296071 327
130 3300009148 Ga0105243_10042798 Ga0105243_100427983 327
131 3300009176 Ga0105242_10147382 Ga0105242_101473821 327
132 3300009177 Ga0105248_10207692 Ga0105248_102076921 327
133 3300009545 Ga0105237_10020447 Ga0105237_100204473 327
134 3300009553 Ga0105249_10320080 Ga0105249_103200802 327
135 3300010375 Ga0105239_10381798 Ga0105239_103817982 327
136 3300011119 Ga0105246_10058844 Ga0105246_100588442 327
137 3300013296 Ga0157374_10250660 Ga0157374_102506602 327
138 3300013297 Ga0157378_10343093 Ga0157378_103430932 327
139 3300013306 Ga0163162_10247884 Ga0163162_102478842 327
140 3300013308 Ga0157375_10137023 Ga0157375_101370232 327
141 3300014325 Ga0163163_10094115 Ga0163163_100941152 327
142 3300014326 Ga0157380_10070194 Ga0157380_100701943 327
143 3300014745 Ga0157377_10007390 Ga0157377_100073906 327
144 3300014968 Ga0157379_10183405 Ga0157379_101834052 327
145 3300014969 Ga0157376_10123533 Ga0157376_101235332 327
146 3300017792 Ga0163161_10026297 Ga0163161_100262974 327
147 3300025898 Ga0207692_10057845 Ga0207692_100578452 327
148 3300025900 Ga0207710_10114906 Ga0207710_101149062 327
149 3300025901 Ga0207688_10019347 Ga0207688_100193472 327
150 3300025903 Ga0207680_10066155 Ga0207680_100661551 327
151 3300025906 Ga0207699_10271550 Ga0207699_102715501 327
152 3300025907 Ga0207645_10015155 Ga0207645_100151554 327
153 3300025908 Ga0207643_10008969 Ga0207643_100089694 327
154 3300025914 Ga0207671_10002280 Ga0207671_100022803 327
155 3300025918 Ga0207662_10035942 Ga0207662_100359425 327
156 3300025920 Ga0207649_10075528 Ga0207649_100755281 327
157 3300025925 Ga0207650_10099534 Ga0207650_100995342 327
158 3300025931 Ga0207644_10068446 Ga0207644_100684463 327
159 3300025933 Ga0207706_10122925 Ga0207706_101229253 327
160 3300025934 Ga0207686_10083018 Ga0207686_100830182 327
161 3300025936 Ga0207670_10099492 Ga0207670_100994922 327
162 3300025937 Ga0207669_10050121 Ga0207669_100501213 327
163 3300025938 Ga0207704_10159689 Ga0207704_101596892 327
164 3300025939 Ga0207665_10260539 Ga0207665_102605392 327
165 3300025941 Ga0207711_10128523 Ga0207711_101285233 327
166 3300025942 Ga0207689_10127121 Ga0207689_101271212 327
167 3300025945 Ga0207679_10104346 Ga0207679_101043461 327
168 3300025960 Ga0207651_10043619 Ga0207651_100436193 327
169 3300025961 Ga0207712_10009993 Ga0207712_100099932 327
170 3300025972 Ga0207668_10344833 Ga0207668_103448332 327
171 3300025986 Ga0207658_10188970 Ga0207658_101889702 327
172 3300026023 Ga0207677_10102143 Ga0207677_101021432 327
173 3300026035 Ga0207703_10022135 Ga0207703_100221354 327
174 3300026067 Ga0207678_10014593 Ga0207678_1001459310 327
175 3300026075 Ga0207708_10040975 Ga0207708_100409752 327
176 3300026088 Ga0207641_10051231 Ga0207641_100512314 327
177 3300026089 Ga0207648_10157588 Ga0207648_101575882 327
178 3300026095 Ga0207676_10162094 Ga0207676_101620942 327
179 3300026116 Ga0207674_10049195 Ga0207674_100491954 327
180 3300026118 Ga0207675_100026558 Ga0207675_1000265581 327
181 3300026121 Ga0207683_10065141 Ga0207683_100651413 327
182 3300026142 Ga0207698_10043623 Ga0207698_100436233 327
183 3300027695 Ga0209966_1002856 Ga0209966_10028562 327
184 3300027717 Ga0209998_10003408 Ga0209998_100034084 327
185 3300027907 Ga0207428_10046456 Ga0207428_100464564 327
186 3300028381 Ga0268264_10054100 Ga0268264_100541004 327
187 3300035692 Ga0373935_0081717 Ga0373935_0081717_94_1077 327
188 3300035725 Ga0373947_0127604 Ga0373947_0127604_164_1147 327
189 3300046454 Ga0495592_0142193 Ga0495592_0142193_173_1156 327
190 3300046459 Ga0495629_0007226 Ga0495629_0007226_6576_7559 327
191 3300046459 Ga0495629_0045252 Ga0495629_0045252_1790_2773 327
192 3300046462 Ga0495651_0019983 Ga0495651_0019983_4138_5121 327
193 3300046473 Ga0495582_0016943 Ga0495582_0016943_2799_3782 327
194 3300046475 Ga0495639_0014882 Ga0495639_0014882_317_1300 327
195 3300046477 Ga0495664_0013537 Ga0495664_0013537_3011_4015 327
196 3300046514 Ga0495618_0018411 Ga0495618_0018411_79_1083 327
197 3300046514 Ga0495618_0145801 Ga0495618_0145801_406_1389 327
198 3300046517 Ga0495630_0091464 Ga0495630_0091464_598_1587 327
199 3300046529 Ga0495652_0066138 Ga0495652_0066138_35_1018 327
200 3300046531 Ga0495665_0031556 Ga0495665_0031556_1698_2687 327
201 3300046533 Ga0495640_0013938 Ga0495640_0013938_317_1300 327
202 3300046642 Ga0495634_0006407 Ga0495634_0006407_247_1236 327
203 3300046642 Ga0495634_0017662 Ga0495634_0017662_3643_4626 327
204 3300046663 Ga0495635_0035774 Ga0495635_0035774_1872_2855 327
205 3300046663 Ga0495635_0229309 Ga0495635_0229309_88_1077 327
206 3300046683 Ga0495658_0032619 Ga0495658_0032619_1293_2276 327
207 3300046683 Ga0495658_0137474 Ga0495658_0137474_175_1158 327
208 3300046689 Ga0495613_0206698 Ga0495613_0206698_184_1167 327
209 3300046809 Ga0495600_0035839 Ga0495600_0035839_1591_2574 327
210 3300047315 Ga0495581_0016686 Ga0495581_0016686_617_1600 327
211 3300047319 Ga0495674_0008061 Ga0495674_0008061_4593_5576 327
212 3300047319 Ga0495674_0083598 Ga0495674_0083598_377_1381 327
213 3300047322 Ga0495680_0046197 Ga0495680_0046197_2091_3074 327
214 3300047471 Ga0495684_0019698 Ga0495684_0019698_3829_4812 327
215 3300047471 Ga0495684_0061408 Ga0495684_0061408_352_1341 327
216 3300047673 Ga0495593_0131258 Ga0495593_0131258_230_1213 327
217 3300048903 Ga0496100_0050524 Ga0496100_0050524_726_1715 327
218 3300048903 Ga0496100_0242010 Ga0496100_0242010_97_1089 327
219 3300048903 Ga0496100_0320686 Ga0496100_0320686_86_1078 327
220 3300048904 Ga0496101_0153673 Ga0496101_0153673_217_1206 327
221 3300048905 Ga0496102_0041807 Ga0496102_0041807_2966_3955 327
222 3300048905 Ga0496102_0311225 Ga0496102_0311225_56_1048 327
223 3300048905 Ga0496102_0402831 Ga0496102_0402831_158_1150 327
224 3300048906 Ga0496103_0017326 Ga0496103_0017326_257_1246 327
225 3300048907 Ga0496104_0000696 Ga0496104_0000696_2212_3213 327
226 3300048907 Ga0496104_0019415 Ga0496104_0019415_3719_4717 327
227 3300048907 Ga0496104_0030199 Ga0496104_0030199_2012_3004 327
228 3300048907 Ga0496104_0042608 Ga0496104_0042608_434_1423 327
229 3300048908 Ga0496105_0047091 Ga0496105_0047091_552_1544 327
230 3300048908 Ga0496105_0164775 Ga0496105_0164775_276_1277 327
231 3300048908 Ga0496105_0172000 Ga0496105_0172000_556_1545 327
232 3300048909 Ga0496106_0026424 Ga0496106_0026424_3095_4084 327
233 3300048909 Ga0496106_0242499 Ga0496106_0242499_251_1243 327
234 3300048910 Ga0496107_0222114 Ga0496107_0222114_171_1160 327
235 3300048911 Ga0496108_0022418 Ga0496108_0022418_3091_4080 327
236 3300048911 Ga0496108_0126392 Ga0496108_0126392_358_1350 327
237 3300048912 Ga0496109_0011660 Ga0496109_0011660_2121_3110 327
238 3300048912 Ga0496109_0226219 Ga0496109_0226219_343_1344 327
239 3300048913 Ga0496110_0088666 Ga0496110_0088666_180_1169 327
240 3300048914 Ga0496111_0158580 Ga0496111_0158580_459_1448 327
241 3300048914 Ga0496111_0226929 Ga0496111_0226929_255_1265 327
242 3300048915 Ga0496112_0118732 Ga0496112_0118732_1070_2059 327
243 3300048916 Ga0496113_0013217 Ga0496113_0013217_4337_5326 327
244 3300048916 Ga0496113_0221726 Ga0496113_0221726_157_1158 327
245 3300048917 Ga0496114_0128621 Ga0496114_0128621_229_1218 327
246 3300048918 Ga0496115_0029026 Ga0496115_0029026_257_1246 327
247 3300048918 Ga0496115_0035568 Ga0496115_0035568_2606_3607 327
248 3300048918 Ga0496115_0105687 Ga0496115_0105687_870_1862 327
249 3300049592 Ga0501076_0140086 Ga0501076_0140086_881_1870 327
250 3300049824 Ga0501045_0322872 Ga0501045_0322872_60_1052 327
251 3300050507 nmdc:mga05p37_233177_c1 nmdc:mga05p37_233177_c1_801_1814 327
252 3300050508 nmdc:mga09592_45682_c1 nmdc:mga09592_45682_c1_304_1317 327
253 3300050509 nmdc:mga0qj67_72060_c1 nmdc:mga0qj67_72060_c1_1394_2407 327
254 3300050511 nmdc:mga08y16_155721_c1 nmdc:mga08y16_155721_c1_959_1972 327
255 3300050511 nmdc:mga08y16_158597_c1 nmdc:mga08y16_158597_c1_340_1329 327
256 3300050511 nmdc:mga08y16_248998_c1 nmdc:mga08y16_248998_c1_732_1721 327
257 3300050512 nmdc:mga0n895_189583_c1 nmdc:mga0n895_189583_c1_411_1397 327
258 3300050512 nmdc:mga0n895_35224_c1 nmdc:mga0n895_35224_c1_3554_4567 327
259 3300050514 nmdc:mga08x19_312469_c1 nmdc:mga08x19_312469_c1_63_1055 327
260 3300050515 nmdc:mga0a205_314001_c1 nmdc:mga0a205_314001_c1_108_1094 327
261 3300050515 nmdc:mga0a205_342289_c1 nmdc:mga0a205_342289_c1_132_1121 327
262 3300053077 Ga0495601_0005065 Ga0495601_0005065_478_1461 327
263 3300053077 Ga0495601_0005870 Ga0495601_0005870_5903_6907 327
264 3300053084 Ga0495595_0005759 Ga0495595_0005759_3384_4367 327
265 3300053085 Ga0495619_0009119 Ga0495619_0009119_478_1461 327
266 3300053085 Ga0495619_0233490 Ga0495619_0233490_163_1152 327
267 3300000041 ARcpr5oldR_c000405 ARcpr5oldR_0004053 328
268 3300005445 Ga0070708_100201635 Ga0070708_1002016352 328
269 3300005455 Ga0070663_100136430 Ga0070663_1001364301 328
270 3300005468 Ga0070707_100111237 Ga0070707_1001112371 328
271 3300005937 Ga0081455_10176929 Ga0081455_101769292 328
272 3300005937 Ga0081455_10237341 Ga0081455_102373412 328
273 3300006058 Ga0075432_10047834 Ga0075432_100478341 328
274 3300006844 Ga0075428_100211206 Ga0075428_1002112062 328
275 3300006844 Ga0075428_100650135 Ga0075428_1006501351 328
276 3300006846 Ga0075430_100025621 Ga0075430_1000256215 328
277 3300006846 Ga0075430_100077543 Ga0075430_1000775432 328
278 3300006846 Ga0075430_100138089 Ga0075430_1001380891 328
279 3300006846 Ga0075430_100187113 Ga0075430_1001871132 328
280 3300006846 Ga0075430_100268793 Ga0075430_1002687932 328
281 3300006847 Ga0075431_100112311 Ga0075431_1001123112 328
282 3300006847 Ga0075431_100143187 Ga0075431_1001431873 328
283 3300006847 Ga0075431_100540492 Ga0075431_1005404921 328
284 3300006852 Ga0075433_10003839 Ga0075433_100038399 328
285 3300006852 Ga0075433_10071128 Ga0075433_100711282 328
286 3300006852 Ga0075433_10246241 Ga0075433_102462412 328
287 3300006871 Ga0075434_100020798 Ga0075434_1000207988 328
288 3300006871 Ga0075434_100328269 Ga0075434_1003282691 328
289 3300006880 Ga0075429_100053054 Ga0075429_1000530543 328
290 3300006880 Ga0075429_100137244 Ga0075429_1001372442 328
291 3300006880 Ga0075429_100220746 Ga0075429_1002207461 328
292 3300006880 Ga0075429_100282225 Ga0075429_1002822251 328
293 3300007076 Ga0075435_100169481 Ga0075435_1001694812 328
294 3300009094 Ga0111539_10021352 Ga0111539_100213525 328
295 3300009094 Ga0111539_10572451 Ga0111539_105724512 328
296 3300009094 Ga0111539_10641591 Ga0111539_106415911 328
297 3300009147 Ga0114129_10162240 Ga0114129_101622404 328
298 3300009147 Ga0114129_10303475 Ga0114129_103034753 328
299 3300009147 Ga0114129_10390142 Ga0114129_103901422 328
300 3300009147 Ga0114129_10775253 Ga0114129_107752532 328
301 3300009147 Ga0114129_10858261 Ga0114129_108582611 328
302 3300009551 Ga0105238_10378185 Ga0105238_103781852 328
303 3300025916 Ga0207663_10290217 Ga0207663_102902171 328
304 3300025922 Ga0207646_10153857 Ga0207646_101538571 328
305 3300027907 Ga0207428_10001522 Ga0207428_1000152219 328
306 3300027907 Ga0207428_10052353 Ga0207428_100523532 328
307 3300027907 Ga0207428_10090306 Ga0207428_100903061 328
308 3300027907 Ga0207428_10117674 Ga0207428_101176742 328
309 3300035118 Ga0373954_0112617 Ga0373954_0112617_116_1105 328
310 3300035724 Ga0373933_0071551 Ga0373933_0071551_74_1063 328
311 3300046492 Ga0495585_0138281 Ga0495585_0138281_103_1095 328
312 3300046558 Ga0495633_0088619 Ga0495633_0088619_118_1113 328
313 3300046615 Ga0495656_0133288 Ga0495656_0133288_88_1083 328
314 3300046648 Ga0495611_0091174 Ga0495611_0091174_101_1096 328
315 3300046664 Ga0495659_0075861 Ga0495659_0075861_193_1188 328
316 3300046681 Ga0495647_0091700 Ga0495647_0091700_78_1073 328
317 3300050507 nmdc:mga05p37_134135_c1 nmdc:mga05p37_134135_c1_295_1287 328
318 3300050507 nmdc:mga05p37_151539_c1 nmdc:mga05p37_151539_c1_472_1467 328
319 3300050507 nmdc:mga05p37_42568_c1 nmdc:mga05p37_42568_c1_1764_2756 328
320 3300050507 nmdc:mga05p37_42709_c1 nmdc:mga05p37_42709_c1_3646_4641 328
321 3300050508 nmdc:mga09592_232719_c1 nmdc:mga09592_232719_c1_159_1154 328
322 3300050508 nmdc:mga09592_37912_c1 nmdc:mga09592_37912_c1_1184_2176 328
323 3300050508 nmdc:mga09592_67285_c1 nmdc:mga09592_67285_c1_1394_2389 328
324 3300050508 nmdc:mga09592_83084_c1 nmdc:mga09592_83084_c1_1264_2259 328
325 3300050509 nmdc:mga0qj67_14931_c1 nmdc:mga0qj67_14931_c1_275_1270 328
326 3300050509 nmdc:mga0qj67_19922_c1 nmdc:mga0qj67_19922_c1_2010_3005 328
327 3300050509 nmdc:mga0qj67_27616_c1 nmdc:mga0qj67_27616_c1_549_1544 328
328 3300050510 nmdc:mga06r32_14686_c2 nmdc:mga06r32_14686_c2_3158_4153 328
329 3300050510 nmdc:mga06r32_306459_c1 nmdc:mga06r32_306459_c1_398_1393 328
330 3300050510 nmdc:mga06r32_341793_c1 nmdc:mga06r32_341793_c1_278_1267 328
331 3300050510 nmdc:mga06r32_342391_c1 nmdc:mga06r32_342391_c1_402_1394 328
332 3300050510 nmdc:mga06r32_441981_c1 nmdc:mga06r32_441981_c1_30_1025 328
333 3300050510 nmdc:mga06r32_61320_c1 nmdc:mga06r32_61320_c1_588_1580 328
334 3300050511 nmdc:mga08y16_124513_c1 nmdc:mga08y16_124513_c1_974_1969 328
335 3300050511 nmdc:mga08y16_86871_c1 nmdc:mga08y16_86871_c1_350_1342 328
336 3300050511 nmdc:mga08y16_97979_c1 nmdc:mga08y16_97979_c1_1535_2530 328
337 3300050512 nmdc:mga0n895_143691_c1 nmdc:mga0n895_143691_c1_1020_2042 328
338 3300050512 nmdc:mga0n895_144835_c1 nmdc:mga0n895_144835_c1_896_1882 328
339 3300050512 nmdc:mga0n895_93596_c1 nmdc:mga0n895_93596_c1_1587_2582 328
340 3300050513 nmdc:mga0rr50_144916_c1 nmdc:mga0rr50_144916_c1_736_1731 328
341 3300050513 nmdc:mga0rr50_62890_c1 nmdc:mga0rr50_62890_c1_1320_2315 328
342 3300050515 nmdc:mga0a205_17111_c1 nmdc:mga0a205_17111_c1_3957_4952 328
343 3300050515 nmdc:mga0a205_180170_c1 nmdc:mga0a205_180170_c1_790_1776 328
344 3300050515 nmdc:mga0a205_235312_c1 nmdc:mga0a205_235312_c1_548_1543 328
345 3300050515 nmdc:mga0a205_65410_c1 nmdc:mga0a205_65410_c1_933_1928 328
346 2209111006 2214736892 2213743051 330
347 3300000041 ARcpr5oldR_c000596 ARcpr5oldR_0005963 330
348 3300000042 ARSoilYngRDRAFT_c00585 ARSoilYngRDRAFT_005854 330
349 3300000043 ARcpr5yngRDRAFT_c000599 ARcpr5yngRDRAFT_0005993 330
350 3300000044 ARSoilOldRDRAFT_c000515 ARSoilOldRDRAFT_0005154 330
351 3300000652 ARCol0yngRDRAFT_1000486 ARCol0yngRDRAFT_10004863 330
352 3300001990 JGI24737J22298_10026115 JGI24737J22298_100261152 330
353 3300005293 Ga0065715_10128869 Ga0065715_101288692 330
354 3300005457 Ga0070662_100206344 Ga0070662_1002063442 330
355 3300005844 Ga0068862_100042405 Ga0068862_1000424053 330
356 3300009094 Ga0111539_10048304 Ga0111539_100483045 330
357 3300010375 Ga0105239_10031779 Ga0105239_100317793 330
358 3300013306 Ga0163162_10273453 Ga0163162_102734532 330
359 3300025907 Ga0207645_10068507 Ga0207645_100685072 330
360 3300025919 Ga0207657_10081894 Ga0207657_100818941 330
361 3300025933 Ga0207706_10295295 Ga0207706_102952952 330
362 3300025936 Ga0207670_10186129 Ga0207670_101861291 330
363 3300027907 Ga0207428_10007370 Ga0207428_100073703 330
364 3300028380 Ga0268265_10020129 Ga0268265_100201294 330
365 3300034816 Ga0373930_0009385 Ga0373930_0009385_256_1248 330
366 3300034819 Ga0373958_0003188 Ga0373958_0003188_240_1232 330
367 3300035084 Ga0373928_0000134 Ga0373928_0000134_2065_3057 330
368 3300035090 Ga0373949_0006133 Ga0373949_0006133_177_1169 330
369 3300035091 Ga0373951_0005808 Ga0373951_0005808_364_1356 330
370 3300035112 Ga0373932_0007269 Ga0373932_0007269_224_1216 330
371 3300035114 Ga0373939_0043105 Ga0373939_0043105_260_1252 330
372 3300035115 Ga0373941_0011508 Ga0373941_0011508_1046_2038 330
373 3300035121 Ga0373960_0022741 Ga0373960_0022741_104_1096 330
374 3300035207 Ga0373942_0001883 Ga0373942_0001883_2019_3011 330
375 3300035241 Ga0373961_0006229 Ga0373961_0006229_479_1471 330
376 3300035242 Ga0373962_0001989 Ga0373962_0001989_2620_3612 330
377 3300035691 Ga0373931_0001007 Ga0373931_0001007_9188_10180 330
378 3300045051 Ga0451576_0130723 Ga0451576_0130723_1453_2445 330
379 3300048910 Ga0496107_0226056 Ga0496107_0226056_282_1274 330
380 3300050511 nmdc:mga08y16_2619_c1 nmdc:mga08y16_2619_c1_10087_11079 330
381 3300050512 nmdc:mga0n895_479162_c1 nmdc:mga0n895_479162_c1_80_1072 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

48

345

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9046 30 329
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.896 30 329
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.888 28 328
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8825 28 328
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8732 32 329
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8825 151 329 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8653 151 329 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8391 151 328 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8179 151 328 3.40.50.2300
6i3gA03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.8081 165 203 3.10.105.10
ID Description Score Start End GO Terms
AF-A0A537H7S6-F1-model_v4 ABC transporter substrate-binding protein 0.9675 224 330
AF-A0A534TVN5-F1-model_v4 ABC transporter substrate-binding protein 0.96 235 330
AF-A0A536Z3T8-F1-model_v4 ABC transporter substrate-binding protein 0.9595 232 330
AF-A0A0X8CID4-F1-model_v4 ABC transporter substrate-binding protein 0.9561 33 330
AF-A0A4V1KUC4-F1-model_v4 ABC transporter substrate-binding protein 0.9549 226 330

Feature Viewer

pLDDT pTM Quality
88.54 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map