F428985

General Info

Members Datasets Scaffolds Average Seq Length
381 188 762 248

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10249113|Ga0207640_102491132
Length 276
Sequence MSVNPDHVLAPLARKLSLREELTPADRDAILALPFSRRKLESNQYLVWDGDRPQNTCLLLSGYAYRHKLAGNGGRQILSIHMKGDVLDLQNSLLGIADHNVQMLTAGEVALIPVDSIRELAFNHPSVGLAMWYETLVEGSIFREWVLNIGRRNARTRIAHLLCEFALRLEIVDLGQHTTYELPITQEQLADAVALTSVHVNRTLMKLEQDGLITRTRRVISAVDWKALVKVADFEPRYLHLDRPPAVRSNRRPFPRPRRPTSARASWQGRYGFPGG

Samples

Sample ID Description Type Environment
1 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.1
Nodule 0
Rhizoplane 0.26
Rhizosphere 97.11
Stem 0
Stem Tuber 0
Unclassified 10.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207640_10249113 3300025981 Bacteria 1377
2 JGI24741J21665_1000766 3300001915 Bacteria 9647
3 JGI24740J21852_10038230 3300001979 Bacteria 1474
4 JGI24739J22299_10001954 3300001989 Bacteria 7886
5 JGI24739J22299_10031330 3300001989 Bacteria 1838
6 JGI24739J22299_10055223 3300001989 Bacteria 1270
7 JGI24737J22298_10000419 3300001990 Bacteria 14540
8 JGI24735J21928_10008677 3300002067 Bacteria 3280
9 JGI24735J21928_10015648 3300002067 Bacteria 2363
10 JGI24750J21931_1020053 3300002070 Bacteria 930
11 JGI24738J21930_10000456 3300002075 Bacteria 11594
12 JGI24738J21930_10002661 3300002075 Bacteria 4607
13 JGI24738J21930_10004619 3300002075 Bacteria 3359
14 JGI24744J21845_10021417 3300002077 Bacteria 1271
15 JGI24751J29686_10010950 3300002459 Unclassified 1870
16 JGI24751J29686_10017993 3300002459 Bacteria 1461
17 Ga0065707_10125724 3300005295 Bacteria 2018
18 Ga0070658_10012575 3300005327 Bacteria 6789
19 Ga0070658_10066087 3300005327 Bacteria 2953
20 Ga0070658_10203004 3300005327 Bacteria 1673
21 Ga0070676_10000962 3300005328 Bacteria 14326
22 Ga0070690_100120038 3300005330 Bacteria 1764
23 Ga0070670_100000210 3300005331 Bacteria 54177
24 Ga0070670_100002304 3300005331 Bacteria 15728
25 Ga0068869_100000094 3300005334 Bacteria 41359
26 Ga0070666_10000089 3300005335 Bacteria 64147
27 Ga0070666_10113799 3300005335 Bacteria 1873
28 Ga0070680_100001104 3300005336 Bacteria 19360
29 Ga0070680_100129601 3300005336 Bacteria 2109
30 Ga0070682_100324802 3300005337 Bacteria 1138
31 Ga0068868_100000113 3300005338 Bacteria 50799
32 Ga0070660_100000177 3300005339 Bacteria 42137
33 Ga0070660_100009037 3300005339 Bacteria 6991
34 Ga0070689_100116171 3300005340 Bacteria 2133
35 Ga0070661_100012645 3300005344 Bacteria 5905
36 Ga0070661_100257309 3300005344 Unclassified 1349
37 Ga0070668_100000026 3300005347 Bacteria 92584
38 Ga0070668_100002775 3300005347 Bacteria 12873
39 Ga0070668_100422019 3300005347 Unclassified 1142
40 Ga0070668_100499150 3300005347 Bacteria 1053
41 Ga0070669_100000024 3300005353 Bacteria 173107
42 Ga0070669_100000155 3300005353 Bacteria 61710
43 Ga0070669_100122894 3300005353 Bacteria 1983
44 Ga0070669_100305787 3300005353 Unclassified 1280
45 Ga0070675_100017819 3300005354 Bacteria 5650
46 Ga0070675_100220791 3300005354 Unclassified 1650
47 Ga0070671_100000006 3300005355 Bacteria 250635
48 Ga0070671_100000266 3300005355 Bacteria 35281
49 Ga0070671_100003933 3300005355 Bacteria 11687
50 Ga0070673_100000177 3300005364 Bacteria 31060
51 Ga0070673_100100102 3300005364 Bacteria 2385
52 Ga0070659_100000305 3300005366 Bacteria 38108
53 Ga0070667_100000019 3300005367 Bacteria 224710
54 Ga0070667_100002102 3300005367 Bacteria 17561
55 Ga0070667_100134057 3300005367 Unclassified 2164
56 Ga0070667_100760579 3300005367 Bacteria 898
57 Ga0070714_100141248 3300005435 Unclassified 2162
58 Ga0070713_100123958 3300005436 Bacteria 2270
59 Ga0070705_100038054 3300005440 Bacteria 2718
60 Ga0070705_100152121 3300005440 Bacteria 1536
61 Ga0070663_100139051 3300005455 Bacteria 1852
62 Ga0070678_100101797 3300005456 Bacteria 2228
63 Ga0070662_100000133 3300005457 Bacteria 41884
64 Ga0070662_100020959 3300005457 Bacteria 4458
65 Ga0070662_100078288 3300005457 Bacteria 2455
66 Ga0070662_100128375 3300005457 Bacteria 1952
67 Ga0070662_100185870 3300005457 Bacteria 1641
68 Ga0070662_100413613 3300005457 Bacteria 1114
69 Ga0070681_10141090 3300005458 Bacteria 2339
70 Ga0068867_100001645 3300005459 Bacteria 15522
71 Ga0070685_10287229 3300005466 Bacteria 1103
72 Ga0070679_100245473 3300005530 Bacteria 1747
73 Ga0068853_100041895 3300005539 Bacteria 3913
74 Ga0068853_100263066 3300005539 Unclassified 1586
75 Ga0070672_100000437 3300005543 Bacteria 24334
76 Ga0070672_100182258 3300005543 Unclassified 1750
77 Ga0070693_100187640 3300005547 Bacteria 1335
78 Ga0070665_100003647 3300005548 Bacteria 16312
79 Ga0068855_100000753 3300005563 Bacteria 39796
80 Ga0070664_100006460 3300005564 Bacteria 9449
81 Ga0070664_100255673 3300005564 Bacteria 1575
82 Ga0068857_100001206 3300005577 Bacteria 20155
83 Ga0068857_100004566 3300005577 Bacteria 11718
84 Ga0068854_100000206 3300005578 Bacteria 39747
85 Ga0068854_100011929 3300005578 Bacteria 5679
86 Ga0068854_100081448 3300005578 Bacteria 2391
87 Ga0068856_100190016 3300005614 Bacteria 2067
88 Ga0068852_100004481 3300005616 Bacteria 9869
89 Ga0068852_100030980 3300005616 Unclassified 4408
90 Ga0068852_100114392 3300005616 Bacteria 2458
91 Ga0068859_100000256 3300005617 Bacteria 52870
92 Ga0068859_100001723 3300005617 Bacteria 22290
93 Ga0068864_100000428 3300005618 Bacteria 36392
94 Ga0068861_100001329 3300005719 Bacteria 15509
95 Ga0068861_100004223 3300005719 Bacteria 9640
96 Ga0068861_100038987 3300005719 Bacteria 3544
97 Ga0068861_100547849 3300005719 Unclassified 1054
98 Ga0068851_10005689 3300005834 Bacteria 5665
99 Ga0068851_10075883 3300005834 Bacteria 1747
100 Ga0068870_10019597 3300005840 Bacteria 3283
101 Ga0068863_100000634 3300005841 Bacteria 35566
102 Ga0068863_100000719 3300005841 Bacteria 33262
103 Ga0068863_100043601 3300005841 Bacteria 4258
104 Ga0068863_100048775 3300005841 Bacteria 4015
105 Ga0068858_100000447 3300005842 Bacteria 43262
106 Ga0068858_100002895 3300005842 Bacteria 17259
107 Ga0068858_100018709 3300005842 Bacteria 6483
108 Ga0068858_100086890 3300005842 Bacteria 2908
109 Ga0068860_100000042 3300005843 Bacteria 227404
110 Ga0068860_100001698 3300005843 Bacteria 23527
111 Ga0068860_100003691 3300005843 Bacteria 15765
112 Ga0068862_100000310 3300005844 Bacteria 53315
113 Ga0068862_100001429 3300005844 Bacteria 22064
114 Ga0068862_100032302 3300005844 Bacteria 4422
115 Ga0097621_100047844 3300006237 Bacteria 3467
116 Ga0097621_100096023 3300006237 Bacteria 2487
117 Ga0075370_10014277 3300006353 Bacteria 4236
118 Ga0068871_100149946 3300006358 Bacteria 1988
119 Ga0068865_100118539 3300006881 Bacteria 1964
120 Ga0097620_100000256 3300006931 Bacteria 52870
121 Ga0097620_100001723 3300006931 Bacteria 22290
122 Ga0105251_10011406 3300009011 Bacteria 5079
123 Ga0105245_10021654 3300009098 Bacteria 5642
124 Ga0105247_10000644 3300009101 Bacteria 27956
125 Ga0105243_10020936 3300009148 Bacteria 4963
126 Ga0105241_10021755 3300009174 Bacteria 4744
127 Ga0105241_10125140 3300009174 Bacteria 2075
128 Ga0105248_10001472 3300009177 Bacteria 26219
129 Ga0105248_10014792 3300009177 Bacteria 8593
130 Ga0105248_10141220 3300009177 Bacteria 2717
131 Ga0105238_10006717 3300009551 Bacteria 11481
132 Ga0105238_10177501 3300009551 Bacteria 2107
133 Ga0105238_10217201 3300009551 Unclassified 1888
134 Ga0105249_10010588 3300009553 Bacteria 8102
135 Ga0105249_10134582 3300009553 Bacteria 2364
136 Ga0105246_10002628 3300011119 Bacteria 10869
137 Ga0157373_10010790 3300013100 Bacteria 6725
138 Ga0157373_10046797 3300013100 Bacteria 3086
139 Ga0157373_10262532 3300013100 Bacteria 1222
140 Ga0157371_10012549 3300013102 Bacteria 6471
141 Ga0157371_10058629 3300013102 Bacteria 2731
142 Ga0157369_10146115 3300013105 Bacteria 2500
143 Ga0157378_10703116 3300013297 Unclassified 1030
144 Ga0163162_10003527 3300013306 Bacteria 14967
145 Ga0163162_10818715 3300013306 Bacteria 1048
146 Ga0157372_10080088 3300013307 Bacteria 3695
147 Ga0157372_10250495 3300013307 Bacteria 2056
148 Ga0157372_10261333 3300013307 Bacteria 2010
149 Ga0157372_10735218 3300013307 Bacteria 1147
150 Ga0157375_10139932 3300013308 Bacteria 2547
151 Ga0157375_10144495 3300013308 Bacteria 2509
152 Ga0163163_10094260 3300014325 Bacteria 3012
153 Ga0163163_10379045 3300014325 Unclassified 1472
154 Ga0157380_10100279 3300014326 Bacteria 2410
155 Ga0157377_10026127 3300014745 Bacteria 3121
156 Ga0157379_10028961 3300014968 Bacteria 4924
157 Ga0163161_10046326 3300017792 Bacteria 3137
158 Ga0213873_10000010 3300021358 Bacteria 223024
159 Ga0213876_10000027 3300021384 Bacteria 223024
160 Ga0207697_10000109 3300025315 Bacteria 38398
161 Ga0207697_10001163 3300025315 Bacteria 14444
162 Ga0207656_10055184 3300025321 Bacteria 1729
163 Ga0207656_10059574 3300025321 Bacteria 1671
164 Ga0207656_10170850 3300025321 Bacteria 1039
165 Ga0207710_10002631 3300025900 Bacteria 8285
166 Ga0207688_10000437 3300025901 Bacteria 19709
167 Ga0207680_10000517 3300025903 Bacteria 18430
168 Ga0207680_10013518 3300025903 Bacteria 4196
169 Ga0207647_10000446 3300025904 Bacteria 33539
170 Ga0207647_10004181 3300025904 Bacteria 10703
171 Ga0207647_10007048 3300025904 Bacteria 8149
172 Ga0207647_10058114 3300025904 Bacteria 2369
173 Ga0207645_10001179 3300025907 Bacteria 21601
174 Ga0207705_10000002 3300025909 Bacteria 2046852
175 Ga0207705_10059264 3300025909 Bacteria 2763
176 Ga0207705_10111546 3300025909 Bacteria 2021
177 Ga0207705_10176784 3300025909 Bacteria 1609
178 Ga0207705_10194405 3300025909 Bacteria 1535
179 Ga0207684_10325769 3300025910 Bacteria 1324
180 Ga0207654_10011331 3300025911 Bacteria 4550
181 Ga0207695_10478198 3300025913 Bacteria 1128
182 Ga0207671_10013629 3300025914 Bacteria 6466
183 Ga0207660_10089837 3300025917 Bacteria 2275
184 Ga0207657_10000082 3300025919 Bacteria 89667
185 Ga0207657_10002553 3300025919 Bacteria 19693
186 Ga0207657_10054847 3300025919 Bacteria 3445
187 Ga0207657_10366677 3300025919 Bacteria 1135
188 Ga0207657_10379585 3300025919 Bacteria 1113
189 Ga0207649_10061842 3300025920 Unclassified 2358
190 Ga0207649_10152086 3300025920 Bacteria 1595
191 Ga0207652_10404784 3300025921 Bacteria 1231
192 Ga0207681_10000004 3300025923 Bacteria 559005
193 Ga0207681_10001626 3300025923 Bacteria 14490
194 Ga0207681_10054146 3300025923 Bacteria 2727
195 Ga0207694_10022711 3300025924 Bacteria 4758
196 Ga0207694_10226734 3300025924 Bacteria 1525
197 Ga0207650_10003615 3300025925 Bacteria 10600
198 Ga0207650_10024887 3300025925 Bacteria 4261
199 Ga0207650_10324651 3300025925 Unclassified 1261
200 Ga0207659_10048062 3300025926 Bacteria 3021
201 Ga0207687_10018368 3300025927 Bacteria 4614
202 Ga0207644_10000009 3300025931 Bacteria 251643
203 Ga0207644_10008744 3300025931 Bacteria 6629
204 Ga0207690_10052701 3300025932 Bacteria 2726
205 Ga0207690_10088237 3300025932 Bacteria 2184
206 Ga0207690_10151594 3300025932 Bacteria 1719
207 Ga0207706_10000300 3300025933 Bacteria 53727
208 Ga0207706_10007400 3300025933 Bacteria 10151
209 Ga0207706_10026310 3300025933 Bacteria 5207
210 Ga0207706_10035866 3300025933 Bacteria 4406
211 Ga0207706_10257737 3300025933 Bacteria 1523
212 Ga0207706_10439813 3300025933 Bacteria 1129
213 Ga0207709_10043923 3300025935 Bacteria 2697
214 Ga0207670_10022346 3300025936 Bacteria 3919
215 Ga0207704_10203839 3300025938 Bacteria 1450
216 Ga0207691_10000294 3300025940 Bacteria 49457
217 Ga0207691_10035241 3300025940 Plasmid 4647
218 Ga0207691_10107730 3300025940 Bacteria 2480
219 Ga0207711_10042579 3300025941 Bacteria 3869
220 Ga0207711_10049716 3300025941 Bacteria 3589
221 Ga0207689_10000064 3300025942 Bacteria 84222
222 Ga0207661_10337282 3300025944 Bacteria 1358
223 Ga0207661_10433831 3300025944 Bacteria 1195
224 Ga0207679_10203237 3300025945 Unclassified 1656
225 Ga0207679_10211445 3300025945 Bacteria 1627
226 Ga0207679_10501393 3300025945 Bacteria 1083
227 Ga0207667_10015519 3300025949 Bacteria 8645
228 Ga0207667_10452052 3300025949 Bacteria 1305
229 Ga0207651_10000355 3300025960 Bacteria 19400
230 Ga0207651_10066472 3300025960 Bacteria 2533
231 Ga0207712_10024323 3300025961 Bacteria 4009
232 Ga0207712_10242912 3300025961 Bacteria 1451
233 Ga0207668_10000081 3300025972 Bacteria 72145
234 Ga0207668_10005224 3300025972 Bacteria 7642
235 Ga0207668_10087276 3300025972 Bacteria 2281
236 Ga0207668_10130866 3300025972 Bacteria 1916
237 Ga0207668_10288466 3300025972 Bacteria 1349
238 Ga0207668_10414601 3300025972 Unclassified 1142
239 Ga0207640_10000884 3300025981 Bacteria 16999
240 Ga0207640_10321138 3300025981 Bacteria 1233
241 Ga0207640_10366808 3300025981 Unclassified 1162
242 Ga0207658_10000002 3300025986 Bacteria 1364188
243 Ga0207658_10004839 3300025986 Bacteria 9310
244 Ga0207658_10134203 3300025986 Bacteria 1993
245 Ga0207658_10775096 3300025986 Unclassified 870
246 Ga0207677_10001730 3300026023 Bacteria 11572
247 Ga0207703_10000473 3300026035 Bacteria 42016
248 Ga0207703_10019317 3300026035 Bacteria 5323
249 Ga0207703_10020869 3300026035 Bacteria 5125
250 Ga0207703_10299076 3300026035 Bacteria 1467
251 Ga0207639_10038079 3300026041 Bacteria 3575
252 Ga0207678_10015166 3300026067 Bacteria 6778
253 Ga0207678_10130997 3300026067 Bacteria 2139
254 Ga0207678_10169560 3300026067 Bacteria 1864
255 Ga0207702_10007789 3300026078 Bacteria 9091
256 Ga0207702_10090961 3300026078 Bacteria 2671
257 Ga0207702_10203842 3300026078 Bacteria 1835
258 Ga0207641_10006899 3300026088 Bacteria 9501
259 Ga0207641_10014292 3300026088 Bacteria 6505
260 Ga0207641_10100808 3300026088 Bacteria 2543
261 Ga0207648_10001537 3300026089 Bacteria 25401
262 Ga0207648_10017901 3300026089 Bacteria 6428
263 Ga0207648_10018877 3300026089 Bacteria 6229
264 Ga0207676_10003427 3300026095 Bacteria 11217
265 Ga0207674_10001709 3300026116 Bacteria 28102
266 Ga0207674_10013688 3300026116 Bacteria 8986
267 Ga0207674_10018388 3300026116 Bacteria 7598
268 Ga0207674_10067491 3300026116 Bacteria 3600
269 Ga0207675_100000740 3300026118 Bacteria 32427
270 Ga0207675_100011298 3300026118 Bacteria 8360
271 Ga0207675_100059074 3300026118 Bacteria 3579
272 Ga0207698_10002519 3300026142 Bacteria 10867
273 Ga0207698_10200938 3300026142 Bacteria 1785
274 Ga0207698_10269734 3300026142 Bacteria 1568
275 Ga0268266_10031824 3300028379 Bacteria 4481
276 Ga0268265_10002264 3300028380 Bacteria 14694
277 Ga0268265_10018263 3300028380 Bacteria 4857
278 Ga0268265_10071694 3300028380 Bacteria 2699
279 Ga0268265_10104830 3300028380 Bacteria 2293
280 Ga0268264_10000001 3300028381 Bacteria 1221000
281 Ga0268264_10000069 3300028381 Bacteria 270492
282 Ga0268264_10073518 3300028381 Bacteria 2902
283 Ga0307408_100322026 3300031548 Bacteria 1302
284 Ga0307413_10101568 3300031824 Bacteria 1902
285 Ga0307410_10073155 3300031852 Archaea 2382
286 Ga0307410_10079546 3300031852 Bacteria 2297
287 Ga0307406_10162479 3300031901 Bacteria 1607
288 Ga0307406_10320001 3300031901 Bacteria 1199
289 Ga0307407_10020079 3300031903 Bacteria 3415
290 Ga0307407_10089245 3300031903 Bacteria 1885
291 Ga0307407_10331592 3300031903 Unclassified 1071
292 Ga0307412_10011156 3300031911 Bacteria 5197
293 Ga0307412_10019921 3300031911 Bacteria 4072
294 Ga0307412_10134987 3300031911 Bacteria 1799
295 Ga0307409_100036493 3300031995 Bacteria 3614
296 Ga0307409_100149576 3300031995 Bacteria 2025
297 Ga0307409_100300440 3300031995 Bacteria 1493
298 Ga0307416_100068574 3300032002 Bacteria 2931
299 Ga0307416_100079266 3300032002 Bacteria 2767
300 Ga0307416_100617125 3300032002 Bacteria 1166
301 Ga0307414_10008639 3300032004 Bacteria 5794
302 Ga0307414_10030645 3300032004 Bacteria 3517
303 Ga0307414_10037334 3300032004 Bacteria 3252
304 Ga0307414_10058494 3300032004 Bacteria 2716
305 Ga0307414_10137682 3300032004 Bacteria 1906
306 Ga0307414_10202707 3300032004 Bacteria 1615
307 Ga0307414_10495603 3300032004 Bacteria 1080
308 Ga0307411_10202012 3300032005 Bacteria 1527
309 Ga0307415_100125058 3300032126 Bacteria 1936
310 Ga0307415_100138043 3300032126 Bacteria 1857
311 Ga0307415_100149993 3300032126 Bacteria 1793
312 Ga0307415_100208057 3300032126 Unclassified 1558
313 Ga0307415_100394971 3300032126 Bacteria 1179
314 Ga0373930_0060684 3300034816 Bacteria 843
315 Ga0373954_0192183 3300035118 Unclassified 1002
316 Ga0373943_0011126 3300035170 Bacteria 4044
317 Ga0373955_0081262 3300035172 Unclassified 1832
318 Ga0373927_0142506 3300035695 Bacteria 1568
319 Ga0373933_0073759 3300035724 Unclassified 2080
320 Ga0373937_0068648 3300036401 Bacteria 3268
321 Ga0373925_0003873 3300037068 Bacteria 11445
322 Ga0395899_0064823 3300037312 Unclassified 2685
323 Ga0395899_0304700 3300037312 Bacteria 1077
324 Ga0395900_0012828 3300037418 Bacteria 8564
325 Ga0395900_0042000 3300037418 Bacteria 4711
326 Ga0395900_0079014 3300037418 Plasmid 3380
327 Ga0395900_0086947 3300037418 Bacteria 3213
328 Ga0395900_0270881 3300037418 Bacteria 1692
329 Ga0395898_0023942 3300037466 Bacteria 6162
330 Ga0395898_0053631 3300037466 Bacteria 3938
331 Ga0395898_0133493 3300037466 Bacteria 2377
332 Ga0395898_0322521 3300037466 Bacteria 1473
333 Ga0395898_0364773 3300037466 Bacteria 1377
334 Ga0395898_0406453 3300037466 Unclassified 1298
335 Ga0395905_0024932 3300037471 Bacteria 5642
336 Ga0395905_0026232 3300037471 Bacteria 5494
337 Ga0395905_0047740 3300037471 Bacteria 4011
338 Ga0395905_0051877 3300037471 Bacteria 3842
339 Ga0395905_0084061 3300037471 Bacteria 2982
340 Ga0395905_0092107 3300037471 Bacteria 2842
341 Ga0395905_0095323 3300037471 Bacteria 2793
342 Ga0395905_0245111 3300037471 Unclassified 1674
343 Ga0395905_0302061 3300037471 Bacteria 1488
344 Ga0395905_0530899 3300037471 Bacteria 1077
345 Ga0395905_0642286 3300037471 Bacteria 963
346 Ga0395901_0023006 3300038443 Bacteria 6388
347 Ga0395901_0031513 3300038443 Bacteria 5467
348 Ga0395901_0056916 3300038443 Bacteria 4067
349 Ga0395901_0116109 3300038443 Bacteria 2811
350 Ga0395901_0198638 3300038443 Unclassified 2102
351 Ga0395901_0260151 3300038443 Bacteria 1806
352 Ga0436365_0431660 3300039437 Bacteria 34094
353 Ga0436362_0592983 3300039453 Bacteria 296966
354 Ga0439433_0034658 3300041999 Unclassified 1163
355 Ga0466967_0039842 3300045976 Bacteria 4042
356 Ga0495607_0026712 3300046501 Bacteria 3580
357 Ga0495606_0043143 3300046507 Unclassified 3011
358 Ga0495643_0013769 3300046522 Bacteria 4828
359 Ga0495598_0018564 3300046537 Bacteria 1810
360 Ga0495598_0091396 3300046537 Unclassified 993
361 Ga0495621_0002726 3300046539 Bacteria 4789
362 Ga0495621_0016633 3300046539 Bacteria 2363
363 Ga0495633_0106308 3300046558 Bacteria 1302
364 Ga0495659_0003737 3300046664 Bacteria 4842
365 Ga0495659_0091714 3300046664 Bacteria 1167
366 Ga0495669_0026319 3300046684 Bacteria 2542
367 Ga0495670_0212832 3300046691 Unclassified 1025
368 Ga0495677_0006558 3300047445 Bacteria 4396
369 Ga0495602_0270273 3300048088 Unclassified 1257
370 Ga0495615_0033623 3300048090 Unclassified 1243
371 Ga0496109_0214575 3300048912 Bacteria 1810
372 Ga0501257_020500 3300049686 Bacteria 1553
373 Ga0501225_0063432 3300049705 Unclassified 1042
374 Ga0501268_014883 3300049765 Bacteria 1272
375 nmdc:mga07m45_142511_c1 3300050496 Bacteria 1388
376 Ga0500595_038187 3300053119 Unclassified 1562
377 Ga0500568_0009050 3300053139 Unclassified 4751
378 Ga0500616_0000124 3300053153 Bacteria 135532
379 Ga0500622_0001153 3300053156 Bacteria 21998
380 Ga0500622_0020844 3300053156 Bacteria 3478
381 Ga0500634_0190284 3300053161 Unclassified 913
382 Ga0207640_10249113
383 JGI24741J21665_1000766
384 JGI24740J21852_10038230
385 JGI24739J22299_10001954
386 JGI24739J22299_10031330
387 JGI24739J22299_10055223
388 JGI24737J22298_10000419
389 JGI24735J21928_10008677
390 JGI24735J21928_10015648
391 JGI24750J21931_1020053
392 JGI24738J21930_10000456
393 JGI24738J21930_10002661
394 JGI24738J21930_10004619
395 JGI24744J21845_10021417
396 JGI24751J29686_10010950
397 JGI24751J29686_10017993
398 Ga0065707_10125724
399 Ga0070658_10012575
400 Ga0070658_10066087
401 Ga0070658_10203004
402 Ga0070676_10000962
403 Ga0070690_100120038
404 Ga0070670_100000210
405 Ga0070670_100002304
406 Ga0068869_100000094
407 Ga0070666_10000089
408 Ga0070666_10113799
409 Ga0070680_100001104
410 Ga0070680_100129601
411 Ga0070682_100324802
412 Ga0068868_100000113
413 Ga0070660_100000177
414 Ga0070660_100009037
415 Ga0070689_100116171
416 Ga0070661_100012645
417 Ga0070661_100257309
418 Ga0070668_100000026
419 Ga0070668_100002775
420 Ga0070668_100422019
421 Ga0070668_100499150
422 Ga0070669_100000024
423 Ga0070669_100000155
424 Ga0070669_100122894
425 Ga0070669_100305787
426 Ga0070675_100017819
427 Ga0070675_100220791
428 Ga0070671_100000006
429 Ga0070671_100000266
430 Ga0070671_100003933
431 Ga0070673_100000177
432 Ga0070673_100100102
433 Ga0070659_100000305
434 Ga0070667_100000019
435 Ga0070667_100002102
436 Ga0070667_100134057
437 Ga0070667_100760579
438 Ga0070714_100141248
439 Ga0070713_100123958
440 Ga0070705_100038054
441 Ga0070705_100152121
442 Ga0070663_100139051
443 Ga0070678_100101797
444 Ga0070662_100000133
445 Ga0070662_100020959
446 Ga0070662_100078288
447 Ga0070662_100128375
448 Ga0070662_100185870
449 Ga0070662_100413613
450 Ga0070681_10141090
451 Ga0068867_100001645
452 Ga0070685_10287229
453 Ga0070679_100245473
454 Ga0068853_100041895
455 Ga0068853_100263066
456 Ga0070672_100000437
457 Ga0070672_100182258
458 Ga0070693_100187640
459 Ga0070665_100003647
460 Ga0068855_100000753
461 Ga0070664_100006460
462 Ga0070664_100255673
463 Ga0068857_100001206
464 Ga0068857_100004566
465 Ga0068854_100000206
466 Ga0068854_100011929
467 Ga0068854_100081448
468 Ga0068856_100190016
469 Ga0068852_100004481
470 Ga0068852_100030980
471 Ga0068852_100114392
472 Ga0068859_100000256
473 Ga0068859_100001723
474 Ga0068864_100000428
475 Ga0068861_100001329
476 Ga0068861_100004223
477 Ga0068861_100038987
478 Ga0068861_100547849
479 Ga0068851_10005689
480 Ga0068851_10075883
481 Ga0068870_10019597
482 Ga0068863_100000634
483 Ga0068863_100000719
484 Ga0068863_100043601
485 Ga0068863_100048775
486 Ga0068858_100000447
487 Ga0068858_100002895
488 Ga0068858_100018709
489 Ga0068858_100086890
490 Ga0068860_100000042
491 Ga0068860_100001698
492 Ga0068860_100003691
493 Ga0068862_100000310
494 Ga0068862_100001429
495 Ga0068862_100032302
496 Ga0097621_100047844
497 Ga0097621_100096023
498 Ga0075370_10014277
499 Ga0068871_100149946
500 Ga0068865_100118539
501 Ga0097620_100000256
502 Ga0097620_100001723
503 Ga0105251_10011406
504 Ga0105245_10021654
505 Ga0105247_10000644
506 Ga0105243_10020936
507 Ga0105241_10021755
508 Ga0105241_10125140
509 Ga0105248_10001472
510 Ga0105248_10014792
511 Ga0105248_10141220
512 Ga0105238_10006717
513 Ga0105238_10177501
514 Ga0105238_10217201
515 Ga0105249_10010588
516 Ga0105249_10134582
517 Ga0105246_10002628
518 Ga0157373_10010790
519 Ga0157373_10046797
520 Ga0157373_10262532
521 Ga0157371_10012549
522 Ga0157371_10058629
523 Ga0157369_10146115
524 Ga0157378_10703116
525 Ga0163162_10003527
526 Ga0163162_10818715
527 Ga0157372_10080088
528 Ga0157372_10250495
529 Ga0157372_10261333
530 Ga0157372_10735218
531 Ga0157375_10139932
532 Ga0157375_10144495
533 Ga0163163_10094260
534 Ga0163163_10379045
535 Ga0157380_10100279
536 Ga0157377_10026127
537 Ga0157379_10028961
538 Ga0163161_10046326
539 Ga0213873_10000010
540 Ga0213876_10000027
541 Ga0207697_10000109
542 Ga0207697_10001163
543 Ga0207656_10055184
544 Ga0207656_10059574
545 Ga0207656_10170850
546 Ga0207710_10002631
547 Ga0207688_10000437
548 Ga0207680_10000517
549 Ga0207680_10013518
550 Ga0207647_10000446
551 Ga0207647_10004181
552 Ga0207647_10007048
553 Ga0207647_10058114
554 Ga0207645_10001179
555 Ga0207705_10000002
556 Ga0207705_10059264
557 Ga0207705_10111546
558 Ga0207705_10176784
559 Ga0207705_10194405
560 Ga0207684_10325769
561 Ga0207654_10011331
562 Ga0207695_10478198
563 Ga0207671_10013629
564 Ga0207660_10089837
565 Ga0207657_10000082
566 Ga0207657_10002553
567 Ga0207657_10054847
568 Ga0207657_10366677
569 Ga0207657_10379585
570 Ga0207649_10061842
571 Ga0207649_10152086
572 Ga0207652_10404784
573 Ga0207681_10000004
574 Ga0207681_10001626
575 Ga0207681_10054146
576 Ga0207694_10022711
577 Ga0207694_10226734
578 Ga0207650_10003615
579 Ga0207650_10024887
580 Ga0207650_10324651
581 Ga0207659_10048062
582 Ga0207687_10018368
583 Ga0207644_10000009
584 Ga0207644_10008744
585 Ga0207690_10052701
586 Ga0207690_10088237
587 Ga0207690_10151594
588 Ga0207706_10000300
589 Ga0207706_10007400
590 Ga0207706_10026310
591 Ga0207706_10035866
592 Ga0207706_10257737
593 Ga0207706_10439813
594 Ga0207709_10043923
595 Ga0207670_10022346
596 Ga0207704_10203839
597 Ga0207691_10000294
598 Ga0207691_10035241
599 Ga0207691_10107730
600 Ga0207711_10042579
601 Ga0207711_10049716
602 Ga0207689_10000064
603 Ga0207661_10337282
604 Ga0207661_10433831
605 Ga0207679_10203237
606 Ga0207679_10211445
607 Ga0207679_10501393
608 Ga0207667_10015519
609 Ga0207667_10452052
610 Ga0207651_10000355
611 Ga0207651_10066472
612 Ga0207712_10024323
613 Ga0207712_10242912
614 Ga0207668_10000081
615 Ga0207668_10005224
616 Ga0207668_10087276
617 Ga0207668_10130866
618 Ga0207668_10288466
619 Ga0207668_10414601
620 Ga0207640_10000884
621 Ga0207640_10321138
622 Ga0207640_10366808
623 Ga0207658_10000002
624 Ga0207658_10004839
625 Ga0207658_10134203
626 Ga0207658_10775096
627 Ga0207677_10001730
628 Ga0207703_10000473
629 Ga0207703_10019317
630 Ga0207703_10020869
631 Ga0207703_10299076
632 Ga0207639_10038079
633 Ga0207678_10015166
634 Ga0207678_10130997
635 Ga0207678_10169560
636 Ga0207702_10007789
637 Ga0207702_10090961
638 Ga0207702_10203842
639 Ga0207641_10006899
640 Ga0207641_10014292
641 Ga0207641_10100808
642 Ga0207648_10001537
643 Ga0207648_10017901
644 Ga0207648_10018877
645 Ga0207676_10003427
646 Ga0207674_10001709
647 Ga0207674_10013688
648 Ga0207674_10018388
649 Ga0207674_10067491
650 Ga0207675_100000740
651 Ga0207675_100011298
652 Ga0207675_100059074
653 Ga0207698_10002519
654 Ga0207698_10200938
655 Ga0207698_10269734
656 Ga0268266_10031824
657 Ga0268265_10002264
658 Ga0268265_10018263
659 Ga0268265_10071694
660 Ga0268265_10104830
661 Ga0268264_10000001
662 Ga0268264_10000069
663 Ga0268264_10073518
664 Ga0307408_100322026
665 Ga0307413_10101568
666 Ga0307410_10073155
667 Ga0307410_10079546
668 Ga0307406_10162479
669 Ga0307406_10320001
670 Ga0307407_10020079
671 Ga0307407_10089245
672 Ga0307407_10331592
673 Ga0307412_10011156
674 Ga0307412_10019921
675 Ga0307412_10134987
676 Ga0307409_100036493
677 Ga0307409_100149576
678 Ga0307409_100300440
679 Ga0307416_100068574
680 Ga0307416_100079266
681 Ga0307416_100617125
682 Ga0307414_10008639
683 Ga0307414_10030645
684 Ga0307414_10037334
685 Ga0307414_10058494
686 Ga0307414_10137682
687 Ga0307414_10202707
688 Ga0307414_10495603
689 Ga0307411_10202012
690 Ga0307415_100125058
691 Ga0307415_100138043
692 Ga0307415_100149993
693 Ga0307415_100208057
694 Ga0307415_100394971
695 Ga0373930_0060684
696 Ga0373954_0192183
697 Ga0373943_0011126
698 Ga0373955_0081262
699 Ga0373927_0142506
700 Ga0373933_0073759
701 Ga0373937_0068648
702 Ga0373925_0003873
703 Ga0395899_0064823
704 Ga0395899_0304700
705 Ga0395900_0012828
706 Ga0395900_0042000
707 Ga0395900_0079014
708 Ga0395900_0086947
709 Ga0395900_0270881
710 Ga0395898_0023942
711 Ga0395898_0053631
712 Ga0395898_0133493
713 Ga0395898_0322521
714 Ga0395898_0364773
715 Ga0395898_0406453
716 Ga0395905_0024932
717 Ga0395905_0026232
718 Ga0395905_0047740
719 Ga0395905_0051877
720 Ga0395905_0084061
721 Ga0395905_0092107
722 Ga0395905_0095323
723 Ga0395905_0245111
724 Ga0395905_0302061
725 Ga0395905_0530899
726 Ga0395905_0642286
727 Ga0395901_0023006
728 Ga0395901_0031513
729 Ga0395901_0056916
730 Ga0395901_0116109
731 Ga0395901_0198638
732 Ga0395901_0260151
733 Ga0436365_0431660
734 Ga0436362_0592983
735 Ga0439433_0034658
736 Ga0466967_0039842
737 Ga0495607_0026712
738 Ga0495606_0043143
739 Ga0495643_0013769
740 Ga0495598_0018564
741 Ga0495598_0091396
742 Ga0495621_0002726
743 Ga0495621_0016633
744 Ga0495633_0106308
745 Ga0495659_0003737
746 Ga0495659_0091714
747 Ga0495669_0026319
748 Ga0495670_0212832
749 Ga0495677_0006558
750 Ga0495602_0270273
751 Ga0495615_0033623
752 Ga0496109_0214575
753 Ga0501257_020500
754 Ga0501225_0063432
755 Ga0501268_014883
756 nmdc:mga07m45_142511_c1
757 Ga0500595_038187
758 Ga0500568_0009050
759 Ga0500616_0000124
760 Ga0500622_0001153
761 Ga0500622_0020844
762 Ga0500634_0190284

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00325

Crp

Bacterial regulatory proteins, crp family

182

213

0.96

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

37

124

0.94

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

156

231

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i2o-assembly1.cif.gz_B the structure of fixk2 from bradyrhizobium japonicum 0.9418 35 234
4i2o-assembly1.cif.gz_B the structure of fixk2 from bradyrhizobium japonicum 0.9142 35 234
5cvr-assembly1.cif.gz_A-2 crystal structure of fnr of a. fischeri in a partially degraded form 0.9114 38 234
3i54-assembly2.cif.gz_C crystal structure of mtbcrp in complex with camp 0.9103 37 234
5e44-assembly1.cif.gz_A-2 crystal structure of holo-fnr of a. fischeri 0.9099 15 236
ID Description Score Start End Superfamily
5e44A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9626 155 236 1.10.10.10
4i2oB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9565 155 234 1.10.10.10
3i54C01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9167 37 141 2.60.120.10
5e44A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9078 155 236 1.10.10.10
4i2oB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9069 35 154 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q3LTC8-F1-model_v4 deleted 0.949 6 248
AF-A0A2W5RD86-F1-model_v4 deleted 0.9449 13 246
AF-A0A2T4YTW6-F1-model_v4 CRP-like cAMP-binding protein 0.94 11 244 GO:0003677
GO:0006355
AF-A0A7Y8MQH3-F1-model_v4 Helix-turn-helix domain-containing protein 0.939 35 235 GO:0003677
GO:0003700
GO:0005829
AF-A0A4R6FJW9-F1-model_v4 CRP-like cAMP-binding protein 0.9368 17 236 GO:0003677
GO:0003700
GO:0005829

Map