F428987

General Info

Members Datasets Scaffolds Average Seq Length
381 203 764 219

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_10258854|Ga0207676_102588542
Length 254
Sequence MRTALYLTNQPSQIIVNCIELEKMEKNKKRIFMKTIWLAAFTGAAALISCAQNNNQNLKMNTTKTSDKTETTFTGKADTATFGTGCFWCTEAVFEELEGVISVTSGYSGGHVANPSYRDVCTGETGHAECVQIVYDTSKISFDELLEVFWQVHDPTTLNRQGADEGTQYRSVIFYHDDEQKQKAEKYKTELDKSGAFNNPIVTTLEPFTKFYKAENYHQEYYELNKNSNPYCSIVIQPKLEKFEKVFKNKLKKH

Samples

Sample ID Description Type Environment
1 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
155 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
183 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
184 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
187 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
188 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
200 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 2738541278 Niastella sp. CF465 Isolate Unclassified
203 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0.79
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.1
Nodule 0
Rhizoplane 0.26
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 13.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207676_10258854 3300026095 Bacteria 1570
2 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
3 MBSR1b_contig_13776808 2162886012 Bacteria 1062
4 JGI24751J29686_10000892 3300002459 Bacteria 6824
5 JGI25154J39366_1013079 3300002738 Bacteria 900
6 JGI25406J46586_10101815 3300003203 Unclassified 856
7 rootH1_10000209 3300003316 Bacteria 12156
8 rootH1_10117206 3300003316 Bacteria 2978
9 rootH2_10128174 3300003320 Bacteria 1338
10 rootL2_10160934 3300003322 Bacteria 4857
11 rootL2_10163958 3300003322 Bacteria 2076
12 rootH1_10006386 3300003316 Bacteria 2019
13 rootH1_10006386 3300003323 Bacteria 30831
14 rootH1_10018716 3300003323 Bacteria 5861
15 rootH1_10038937 3300003316 Bacteria 2014
16 rootH1_10038937 3300003323 Bacteria 5121
17 Ga0065714_10103305 3300005288 Unclassified 1605
18 Ga0065704_10026020 3300005289 Bacteria 1214
19 Ga0065704_10070140 3300005289 Bacteria 482257
20 Ga0065712_10003783 3300005290 Bacteria 4118
21 Ga0065712_10007850 3300005290 Bacteria 2530
22 Ga0065712_10109377 3300005290 Bacteria 1836
23 Ga0065715_10048163 3300005293 Bacteria 1082
24 Ga0065715_10097998 3300005293 Bacteria 3614
25 Ga0065715_10124684 3300005293 Bacteria 2148
26 Ga0065707_10148724 3300005295 Unclassified 1683
27 Ga0065707_10343690 3300005295 Unclassified 929
28 Ga0070676_10001437 3300005328 Bacteria 12029
29 Ga0070676_10247400 3300005328 Bacteria 1188
30 Ga0070683_100000518 3300005329 Bacteria 27144
31 Ga0070690_100311960 3300005330 Bacteria 1131
32 Ga0070670_100014880 3300005331 Bacteria 6674
33 Ga0070670_100018249 3300005331 Bacteria 6019
34 Ga0070670_100029167 3300005331 Bacteria 4748
35 Ga0070670_100089174 3300005331 Bacteria 2651
36 Ga0068869_100014242 3300005334 Bacteria 5308
37 Ga0068869_100015935 3300005334 Bacteria 5057
38 Ga0068869_100020598 3300005334 Unclassified 4524
39 Ga0068869_100153466 3300005334 Bacteria 1788
40 Ga0068868_100067532 3300005338 Bacteria 2846
41 Ga0068868_100103882 3300005338 Bacteria 2302
42 Ga0070660_100352145 3300005339 Bacteria 1213
43 Ga0070660_100428882 3300005339 Unclassified 1095
44 Ga0070689_100019684 3300005340 Bacteria 4993
45 Ga0070689_100023067 3300005340 Unclassified 4655
46 Ga0070689_100055953 3300005340 Bacteria 3058
47 Ga0070687_100097483 3300005343 Bacteria 1639
48 Ga0070661_100006946 3300005344 Bacteria 7814
49 Ga0070661_100030661 3300005344 Bacteria 3885
50 Ga0070668_100202777 3300005347 Unclassified 1629
51 Ga0070669_100002247 3300005353 Bacteria 13997
52 Ga0070669_100041571 3300005353 Bacteria 3343
53 Ga0070669_100591670 3300005353 Unclassified 929
54 Ga0070675_100001165 3300005354 Bacteria 19018
55 Ga0070675_100052653 3300005354 Bacteria 3347
56 Ga0070671_100497011 3300005355 Unclassified 1049
57 Ga0070673_100031779 3300005364 Bacteria 3966
58 Ga0070673_100035985 3300005364 Bacteria 3759
59 Ga0070673_100907977 3300005364 Bacteria 817
60 Ga0070688_100002600 3300005365 Bacteria 9153
61 Ga0070688_100020184 3300005365 Bacteria 3870
62 Ga0070659_100064609 3300005366 Unclassified 2897
63 Ga0070659_100594293 3300005366 Bacteria 950
64 Ga0070667_100109984 3300005367 Bacteria 2388
65 Ga0070667_100121264 3300005367 Bacteria 2274
66 Ga0070667_100492619 3300005367 Bacteria 1123
67 Ga0070701_10043541 3300005438 Bacteria 2297
68 Ga0070701_10301998 3300005438 Bacteria 984
69 Ga0070700_100023179 3300005441 Bacteria 3629
70 Ga0070700_100177762 3300005441 Bacteria 1479
71 Ga0070694_100638813 3300005444 Unclassified 860
72 Ga0070685_10020713 3300005466 Bacteria 3562
73 Ga0070685_10185121 3300005466 Unclassified 1343
74 Ga0070698_100000935 3300005471 Bacteria 31956
75 Ga0070698_100002037 3300005471 Bacteria 22463
76 Ga0070699_100177720 3300005518 Bacteria 1888
77 Ga0070684_100003230 3300005535 Bacteria 12189
78 Ga0070684_100003714 3300005535 Bacteria 11518
79 Ga0068853_100001484 3300005539 Bacteria 17035
80 Ga0068853_100041920 3300005539 Unclassified 3912
81 Ga0068853_100217074 3300005539 Bacteria 1745
82 Ga0070672_100019599 3300005543 Bacteria 4913
83 Ga0070672_100067883 3300005543 Bacteria 2827
84 Ga0070672_100079199 3300005543 Unclassified 2629
85 Ga0070665_100062158 3300005548 Unclassified 3744
86 Ga0070704_100058335 3300005549 Bacteria 2749
87 Ga0068855_100007516 3300005563 Bacteria 13191
88 Ga0070664_100005498 3300005564 Bacteria 10174
89 Ga0070664_100009129 3300005564 Bacteria 8048
90 Ga0068857_100000263 3300005577 Bacteria 35592
91 Ga0068857_100006137 3300005577 Bacteria 10269
92 Ga0068857_100007022 3300005577 Bacteria 9693
93 Ga0068857_100009671 3300005577 Bacteria 8377
94 Ga0068854_100094697 3300005578 Bacteria 2228
95 Ga0068854_100218971 3300005578 Unclassified 1505
96 Ga0068856_100016946 3300005614 Bacteria 7061
97 Ga0068856_100027347 3300005614 Bacteria 5565
98 Ga0068856_100374350 3300005614 Bacteria 1443
99 Ga0068852_100016155 3300005616 Bacteria 5812
100 Ga0068852_100427013 3300005616 Bacteria 1308
101 Ga0068859_100008557 3300005617 Bacteria 10346
102 Ga0068859_100022323 3300005617 Bacteria 6346
103 Ga0068859_100064961 3300005617 Bacteria 3683
104 Ga0068859_100106843 3300005617 Bacteria 2858
105 Ga0068859_100205796 3300005617 Bacteria 2053
106 Ga0068859_100260773 3300005617 Unclassified 1824
107 Ga0068859_100270175 3300005617 Unclassified 1792
108 Ga0068859_100426172 3300005617 Bacteria 1423
109 Ga0068859_100513144 3300005617 Bacteria 1294
110 Ga0068864_100015026 3300005618 Bacteria 6434
111 Ga0068864_100116819 3300005618 Bacteria 2381
112 Ga0068864_100309822 3300005618 Unclassified 1480
113 Ga0068864_100640645 3300005618 Bacteria 1034
114 Ga0068861_100001036 3300005719 Bacteria 17040
115 Ga0068861_100013108 3300005719 Bacteria 5797
116 Ga0068861_100036532 3300005719 Bacteria 3646
117 Ga0068861_100700822 3300005719 Unclassified 941
118 Ga0068861_100701013 3300005719 Bacteria 941
119 Ga0068851_10161300 3300005834 Bacteria 1232
120 Ga0068870_10003855 3300005840 Bacteria 6393
121 Ga0068870_10138796 3300005840 Bacteria 1420
122 Ga0068863_100025013 3300005841 Bacteria 5694
123 Ga0068863_100364347 3300005841 Bacteria 1409
124 Ga0068858_100560308 3300005842 Bacteria 1107
125 Ga0068858_100622095 3300005842 Unclassified 1048
126 Ga0068860_100140994 3300005843 Bacteria 2317
127 Ga0068860_100166892 3300005843 Unclassified 2126
128 Ga0068860_100174700 3300005843 Unclassified 2076
129 Ga0068860_100453422 3300005843 Bacteria 1275
130 Ga0068860_100614606 3300005843 Bacteria 1093
131 Ga0068862_100002110 3300005844 Bacteria 17923
132 Ga0068862_100638879 3300005844 Bacteria 1025
133 Ga0081539_10023821 3300005985 Bacteria 3995
134 Ga0068871_100321349 3300006358 Bacteria 1363
135 Ga0075428_100007930 3300006844 Bacteria 11776
136 Ga0075428_100037948 3300006844 Bacteria 5301
137 Ga0075428_100053438 3300006844 Bacteria 4425
138 Ga0075428_100443771 3300006844 Bacteria 1390
139 Ga0075430_100004828 3300006846 Bacteria 11345
140 Ga0075431_100034852 3300006847 Bacteria 5185
141 Ga0075431_100070884 3300006847 Bacteria 3596
142 Ga0075429_100229917 3300006880 Bacteria 1624
143 Ga0068865_100007213 3300006881 Bacteria 6829
144 Ga0097620_100008558 3300006931 Bacteria 10346
145 Ga0097620_100022320 3300006931 Bacteria 6346
146 Ga0097620_100064957 3300006931 Bacteria 3683
147 Ga0097620_100106842 3300006931 Bacteria 2858
148 Ga0097620_100205801 3300006931 Bacteria 2053
149 Ga0097620_100260791 3300006931 Unclassified 1824
150 Ga0097620_100270166 3300006931 Unclassified 1792
151 Ga0097620_100426162 3300006931 Bacteria 1423
152 Ga0097620_100513181 3300006931 Bacteria 1294
153 Ga0075435_100706899 3300007076 Bacteria 876
154 Ga0111539_10001072 3300009094 Bacteria 36092
155 Ga0111539_10225430 3300009094 Bacteria 2183
156 Ga0111539_10411030 3300009094 Bacteria 1576
157 Ga0111539_10504227 3300009094 Bacteria 1409
158 Ga0105247_10001402 3300009101 Bacteria 17485
159 Ga0105247_10007645 3300009101 Bacteria 6617
160 Ga0105247_10250362 3300009101 Bacteria 1211
161 Ga0105243_10622165 3300009148 Bacteria 1042
162 Ga0105242_10047575 3300009176 Bacteria 3483
163 Ga0105242_10209284 3300009176 Bacteria 1737
164 Ga0105248_11347610 3300009177 Bacteria 807
165 Ga0105249_10012406 3300009553 Bacteria 7511
166 Ga0105249_10037846 3300009553 Bacteria 4378
167 Ga0105249_10062092 3300009553 Bacteria 3430
168 Ga0105249_10115506 3300009553 Unclassified 2543
169 Ga0105249_10160625 3300009553 Bacteria 2171
170 Ga0105249_10197956 3300009553 Unclassified 1965
171 Ga0105249_10396124 3300009553 Bacteria 1410
172 Ga0105249_10457598 3300009553 Unclassified 1316
173 Ga0105239_10002397 3300010375 Bacteria 23901
174 Ga0105246_10062364 3300011119 Bacteria 2597
175 Ga0157373_10128736 3300013100 Unclassified 1780
176 Ga0157371_10063896 3300013102 Unclassified 2609
177 Ga0157374_10001139 3300013296 Bacteria 22716
178 Ga0157378_10152442 3300013297 Bacteria 2154
179 Ga0157378_10262614 3300013297 Bacteria 1657
180 Ga0163162_10043401 3300013306 Bacteria 4502
181 Ga0163162_10206439 3300013306 Bacteria 2094
182 Ga0163162_10371026 3300013306 Bacteria 1564
183 Ga0157372_10034327 3300013307 Bacteria 5576
184 Ga0157372_10130450 3300013307 Unclassified 2892
185 Ga0157375_10007363 3300013308 Bacteria 9636
186 Ga0157375_10065051 3300013308 Bacteria 3633
187 Ga0157375_10385409 3300013308 Bacteria 1568
188 Ga0157375_10657602 3300013308 Bacteria 1204
189 Ga0163163_10001333 3300014325 Bacteria 20824
190 Ga0163163_10096375 3300014325 Bacteria 2978
191 Ga0163163_10236618 3300014325 Unclassified 1875
192 Ga0157380_10046053 3300014326 Bacteria 3424
193 Ga0157380_10122110 3300014326 Bacteria 2208
194 Ga0157377_10000790 3300014745 Bacteria 13078
195 Ga0157377_10008110 3300014745 Bacteria 5108
196 Ga0157377_10020164 3300014745 Bacteria 3490
197 Ga0157379_10305687 3300014968 Bacteria 1450
198 Ga0157379_10775452 3300014968 Bacteria 904
199 Ga0157379_10784872 3300014968 Bacteria 898
200 Ga0157376_10312706 3300014969 Bacteria 1491
201 Ga0163161_10079087 3300017792 Bacteria 2417
202 Ga0163161_10287595 3300017792 Bacteria 1291
203 Ga0209258_107858 3300025242 Bacteria 1547
204 Ga0209646_1001662 3300025246 Bacteria 5680
205 Ga0207697_10004402 3300025315 Bacteria 6733
206 Ga0207656_10131333 3300025321 Bacteria 1173
207 Ga0207682_10042720 3300025893 Bacteria 1853
208 Ga0207710_10000772 3300025900 Bacteria 17434
209 Ga0207688_10028819 3300025901 Bacteria 3054
210 Ga0207647_10000587 3300025904 Bacteria 28282
211 Ga0207647_10018454 3300025904 Bacteria 4716
212 Ga0207699_10326972 3300025906 Bacteria 1077
213 Ga0207645_10000524 3300025907 Bacteria 31862
214 Ga0207643_10023444 3300025908 Bacteria 3402
215 Ga0207643_10086686 3300025908 Bacteria 1820
216 Ga0207662_10053416 3300025918 Unclassified 2407
217 Ga0207662_10252313 3300025918 Bacteria 1158
218 Ga0207657_10126533 3300025919 Bacteria 2098
219 Ga0207681_10002639 3300025923 Bacteria 11370
220 Ga0207650_10027505 3300025925 Bacteria 4072
221 Ga0207650_10059462 3300025925 Bacteria 2849
222 Ga0207659_10020482 3300025926 Bacteria 4373
223 Ga0207659_10029822 3300025926 Bacteria 3721
224 Ga0207644_10096131 3300025931 Bacteria 2217
225 Ga0207690_10082414 3300025932 Unclassified 2250
226 Ga0207706_10019098 3300025933 Bacteria 6165
227 Ga0207706_10269882 3300025933 Bacteria 1485
228 Ga0207686_10000842 3300025934 Bacteria 18628
229 Ga0207686_10319448 3300025934 Bacteria 1159
230 Ga0207670_10002326 3300025936 Bacteria 9953
231 Ga0207670_10036699 3300025936 Bacteria 3189
232 Ga0207670_10055181 3300025936 Bacteria 2684
233 Ga0207670_10081296 3300025936 Bacteria 2267
234 Ga0207670_10354282 3300025936 Bacteria 1163
235 Ga0207669_10707771 3300025937 Bacteria 828
236 Ga0207704_10099136 3300025938 Bacteria 1937
237 Ga0207704_10547605 3300025938 Unclassified 940
238 Ga0207691_10011436 3300025940 Bacteria 8516
239 Ga0207691_10039311 3300025940 Bacteria 4376
240 Ga0207691_10048768 3300025940 Bacteria 3881
241 Ga0207691_10127966 3300025940 Bacteria 2246
242 Ga0207711_10588451 3300025941 Bacteria 1038
243 Ga0207689_10001885 3300025942 Bacteria 19841
244 Ga0207689_10007227 3300025942 Bacteria 9753
245 Ga0207689_10030085 3300025942 Bacteria 4526
246 Ga0207689_10220167 3300025942 Bacteria 1568
247 Ga0207689_10485283 3300025942 Bacteria 1035
248 Ga0207661_10004300 3300025944 Bacteria 9972
249 Ga0207661_10007659 3300025944 Bacteria 7682
250 Ga0207679_10003671 3300025945 Bacteria 9512
251 Ga0207651_10036957 3300025960 Unclassified 3194
252 Ga0207651_10112012 3300025960 Bacteria 2050
253 Ga0207651_10141441 3300025960 Bacteria 1859
254 Ga0207651_10148744 3300025960 Bacteria 1820
255 Ga0207651_10804943 3300025960 Bacteria 833
256 Ga0207712_10030065 3300025961 Unclassified 3650
257 Ga0207712_10067234 3300025961 Bacteria 2564
258 Ga0207712_10103405 3300025961 Unclassified 2122
259 Ga0207712_10205836 3300025961 Bacteria 1564
260 Ga0207712_10339238 3300025961 Unclassified 1246
261 Ga0207712_10680334 3300025961 Unclassified 896
262 Ga0207668_10032487 3300025972 Bacteria 3449
263 Ga0207668_10866141 3300025972 Bacteria 803
264 Ga0207640_10121508 3300025981 Bacteria 1872
265 Ga0207640_10220029 3300025981 Bacteria 1453
266 Ga0207658_10531590 3300025986 Bacteria 1050
267 Ga0207658_10614724 3300025986 Bacteria 977
268 Ga0207677_10080485 3300026023 Bacteria 2334
269 Ga0207677_10207112 3300026023 Bacteria 1563
270 Ga0207639_10002295 3300026041 Bacteria 12836
271 Ga0207639_10108781 3300026041 Bacteria 2254
272 Ga0207708_10206336 3300026075 Bacteria 1569
273 Ga0207702_10085750 3300026078 Bacteria 2745
274 Ga0207641_10001343 3300026088 Bacteria 24358
275 Ga0207641_10040932 3300026088 Bacteria 3882
276 Ga0207648_10009876 3300026089 Bacteria 9097
277 Ga0207676_10002581 3300026095 Bacteria 12925
278 Ga0207676_10035883 3300026095 Unclassified 3768
279 Ga0207676_10101453 3300026095 Bacteria 2386
280 Ga0207674_10002077 3300026116 Bacteria 25390
281 Ga0207674_10004688 3300026116 Bacteria 16408
282 Ga0207674_10020691 3300026116 Bacteria 7101
283 Ga0207674_10033626 3300026116 Bacteria 5366
284 Ga0207674_10085733 3300026116 Unclassified 3144
285 Ga0207675_100002316 3300026118 Bacteria 18907
286 Ga0207675_100055139 3300026118 Bacteria 3708
287 Ga0207675_100586327 3300026118 Bacteria 1117
288 Ga0207675_100689397 3300026118 Bacteria 1030
289 Ga0207675_100700282 3300026118 Bacteria 1022
290 Ga0207683_10017834 3300026121 Bacteria 6054
291 Ga0207698_10064131 3300026142 Unclassified 2878
292 Ga0207698_10104075 3300026142 Bacteria 2361
293 Ga0207698_10139522 3300026142 Bacteria 2086
294 Ga0207698_10931439 3300026142 Bacteria 877
295 Ga0207428_10231974 3300027907 Bacteria 1381
296 Ga0268266_10162825 3300028379 Bacteria 2019
297 Ga0268265_10003389 3300028380 Bacteria 11474
298 Ga0268265_10416831 3300028380 Bacteria 1246
299 Ga0268265_10508359 3300028380 Bacteria 1137
300 Ga0268264_10100655 3300028381 Bacteria 2510
301 Ga0268264_10174678 3300028381 Bacteria 1946
302 Ga0268264_10232817 3300028381 Bacteria 1702
303 Ga0265328_10068251 3300031239 Bacteria 1306
304 Ga0265320_10153009 3300031240 Bacteria 1041
305 Ga0307513_10111699 3300031456 Bacteria 2725
306 Ga0316579_10144711 3300031691 Unclassified 1146
307 Ga0265314_10006060 3300031711 Bacteria 10752
308 Ga0307516_10164763 3300031730 Bacteria 1963
309 Ga0307412_10303281 3300031911 Bacteria 1263
310 Ga0316593_10049649 3300032168 Bacteria 1415
311 Ga0373926_0096603 3300035083 Bacteria 1102
312 Ga0373923_0112134 3300035111 Bacteria 1212
313 Ga0373943_0028267 3300035170 Bacteria 2642
314 Ga0373947_0372288 3300035725 Bacteria 961
315 Ga0316582_0081034 3300036647 Unclassified 2120
316 Ga0373925_0221952 3300037068 Bacteria 1509
317 Ga0373925_0407805 3300037068 Bacteria 1109
318 Ga0451853_1821009 3300041512 Bacteria 4552
319 Ga0439441_003682 3300042001 Bacteria 2277
320 Ga0439448_0199028 3300042005 Bacteria 702
321 Ga0439449_0143128 3300042007 Unclassified 890
322 Ga0439457_002097 3300042014 Bacteria 5819
323 Ga0439435_0043094 3300042436 Bacteria 1268
324 Ga0466969_0008873 3300044656 Bacteria 5333
325 Ga0466972_0132261 3300044658 Bacteria 1175
326 Ga0466966_0000028 3300044684 Bacteria 105667
327 Ga0466961_0200687 3300044693 Bacteria 1234
328 Ga0466961_0246798 3300044693 Bacteria 1097
329 Ga0466968_0184968 3300044735 Bacteria 970
330 Ga0466957_0000082 3300044842 Bacteria 38374
331 Ga0466957_0031772 3300044842 Bacteria 3157
332 Ga0466959_0000047 3300045049 Bacteria 86901
333 Ga0495650_0056788 3300046471 Bacteria 1587
334 Ga0495598_0096963 3300046537 Unclassified 970
335 Ga0495621_0054031 3300046539 Bacteria 1443
336 Ga0495625_0218547 3300046660 Bacteria 1250
337 Ga0496110_0628907 3300048913 Bacteria 972
338 Ga0501312_054823 3300049528 Bacteria 680
339 Ga0501315_043641 3300049531 Bacteria 686
340 Ga0501032_0013756 3300049569 Bacteria 5742
341 Ga0501032_0051964 3300049569 Bacteria 2762
342 Ga0501033_0051948 3300049570 Bacteria 3038
343 Ga0501036_0143721 3300049572 Bacteria 2012
344 Ga0501037_0026219 3300049573 Bacteria 4307
345 Ga0501037_0094531 3300049573 Bacteria 2161
346 Ga0501038_0025941 3300049574 Bacteria 5220
347 Ga0501039_0014071 3300049575 Bacteria 6124
348 Ga0501043_0013976 3300049579 Bacteria 6282
349 Ga0501043_0021486 3300049579 Bacteria 5061
350 Ga0501043_0145407 3300049579 Bacteria 1857
351 Ga0501046_0360996 3300049580 Bacteria 1053
352 Ga0501047_0021674 3300049581 Bacteria 6170
353 Ga0501047_0042343 3300049581 Bacteria 4401
354 Ga0501048_0108081 3300049582 Bacteria 1964
355 Ga0501075_0348420 3300049591 Bacteria 1129
356 Ga0501223_002176 3300049663 Bacteria 4395
357 Ga0501257_002509 3300049686 Bacteria 3875
358 Ga0501259_013345 3300049688 Bacteria 1379
359 Ga0501225_0007990 3300049705 Bacteria 3047
360 Ga0501245_004044 3300049708 Unclassified 2007
361 Ga0501266_003660 3300049763 Unclassified 1904
362 Ga0501275_012456 3300049772 Bacteria 938
363 Ga0501035_0026449 3300049822 Bacteria 5308
364 Ga0501035_0439534 3300049822 Bacteria 1081
365 Ga0501044_0003566 3300049823 Bacteria 17507
366 Ga0501044_0009342 3300049823 Bacteria 10696
367 Ga0501044_0080803 3300049823 Bacteria 3292
368 nmdc:mga09592_23145_c1 3300050508 Bacteria 5129
369 nmdc:mga09592_480519_c1 3300050508 Bacteria 1071
370 nmdc:mga0qj67_38941_c1 3300050509 Bacteria 3731
371 nmdc:mga06r32_115883_c1 3300050510 Bacteria 2639
372 nmdc:mga06r32_197178_c1 3300050510 Bacteria 2001
373 nmdc:mga08y16_13513_c1 3300050511 Bacteria 8590
374 nmdc:mga0rr50_640758_c1 3300050513 Bacteria 906
375 Ga0500578_0000144 3300053086 Bacteria 85335
376 Ga0500578_0025973 3300053086 Bacteria 3759
377 Ga0500642_0122722 3300053130 Bacteria 1216
378 Ga0500573_0054276 3300053140 Unclassified 2301
379 Ga0500603_017305 3300053150 Bacteria 1721
380 Ga0500619_049265 3300053154 Bacteria 1359
381 Ga0500622_0271574 3300053156 Bacteria 735
382 2738727710 2738541278 Bacteria 9755573
383 2883070431 2883068021 Bacteria 6192739
384 Ga0207676_10258854
385 SwRhRL2b_contig_1663050
386 MBSR1b_contig_13776808
387 JGI24751J29686_10000892
388 JGI25154J39366_1013079
389 JGI25406J46586_10101815
390 rootH1_10000209
391 rootH1_10117206
392 rootH2_10128174
393 rootL2_10160934
394 rootL2_10163958
395 rootH1_10006386
396 rootH1_10018716
397 rootH1_10038937
398 Ga0065714_10103305
399 Ga0065704_10026020
400 Ga0065704_10070140
401 Ga0065712_10003783
402 Ga0065712_10007850
403 Ga0065712_10109377
404 Ga0065715_10048163
405 Ga0065715_10097998
406 Ga0065715_10124684
407 Ga0065707_10148724
408 Ga0065707_10343690
409 Ga0070676_10001437
410 Ga0070676_10247400
411 Ga0070683_100000518
412 Ga0070690_100311960
413 Ga0070670_100014880
414 Ga0070670_100018249
415 Ga0070670_100029167
416 Ga0070670_100089174
417 Ga0068869_100014242
418 Ga0068869_100015935
419 Ga0068869_100020598
420 Ga0068869_100153466
421 Ga0068868_100067532
422 Ga0068868_100103882
423 Ga0070660_100352145
424 Ga0070660_100428882
425 Ga0070689_100019684
426 Ga0070689_100023067
427 Ga0070689_100055953
428 Ga0070687_100097483
429 Ga0070661_100006946
430 Ga0070661_100030661
431 Ga0070668_100202777
432 Ga0070669_100002247
433 Ga0070669_100041571
434 Ga0070669_100591670
435 Ga0070675_100001165
436 Ga0070675_100052653
437 Ga0070671_100497011
438 Ga0070673_100031779
439 Ga0070673_100035985
440 Ga0070673_100907977
441 Ga0070688_100002600
442 Ga0070688_100020184
443 Ga0070659_100064609
444 Ga0070659_100594293
445 Ga0070667_100109984
446 Ga0070667_100121264
447 Ga0070667_100492619
448 Ga0070701_10043541
449 Ga0070701_10301998
450 Ga0070700_100023179
451 Ga0070700_100177762
452 Ga0070694_100638813
453 Ga0070685_10020713
454 Ga0070685_10185121
455 Ga0070698_100000935
456 Ga0070698_100002037
457 Ga0070699_100177720
458 Ga0070684_100003230
459 Ga0070684_100003714
460 Ga0068853_100001484
461 Ga0068853_100041920
462 Ga0068853_100217074
463 Ga0070672_100019599
464 Ga0070672_100067883
465 Ga0070672_100079199
466 Ga0070665_100062158
467 Ga0070704_100058335
468 Ga0068855_100007516
469 Ga0070664_100005498
470 Ga0070664_100009129
471 Ga0068857_100000263
472 Ga0068857_100006137
473 Ga0068857_100007022
474 Ga0068857_100009671
475 Ga0068854_100094697
476 Ga0068854_100218971
477 Ga0068856_100016946
478 Ga0068856_100027347
479 Ga0068856_100374350
480 Ga0068852_100016155
481 Ga0068852_100427013
482 Ga0068859_100008557
483 Ga0068859_100022323
484 Ga0068859_100064961
485 Ga0068859_100106843
486 Ga0068859_100205796
487 Ga0068859_100260773
488 Ga0068859_100270175
489 Ga0068859_100426172
490 Ga0068859_100513144
491 Ga0068864_100015026
492 Ga0068864_100116819
493 Ga0068864_100309822
494 Ga0068864_100640645
495 Ga0068861_100001036
496 Ga0068861_100013108
497 Ga0068861_100036532
498 Ga0068861_100700822
499 Ga0068861_100701013
500 Ga0068851_10161300
501 Ga0068870_10003855
502 Ga0068870_10138796
503 Ga0068863_100025013
504 Ga0068863_100364347
505 Ga0068858_100560308
506 Ga0068858_100622095
507 Ga0068860_100140994
508 Ga0068860_100166892
509 Ga0068860_100174700
510 Ga0068860_100453422
511 Ga0068860_100614606
512 Ga0068862_100002110
513 Ga0068862_100638879
514 Ga0081539_10023821
515 Ga0068871_100321349
516 Ga0075428_100007930
517 Ga0075428_100037948
518 Ga0075428_100053438
519 Ga0075428_100443771
520 Ga0075430_100004828
521 Ga0075431_100034852
522 Ga0075431_100070884
523 Ga0075429_100229917
524 Ga0068865_100007213
525 Ga0097620_100008558
526 Ga0097620_100022320
527 Ga0097620_100064957
528 Ga0097620_100106842
529 Ga0097620_100205801
530 Ga0097620_100260791
531 Ga0097620_100270166
532 Ga0097620_100426162
533 Ga0097620_100513181
534 Ga0075435_100706899
535 Ga0111539_10001072
536 Ga0111539_10225430
537 Ga0111539_10411030
538 Ga0111539_10504227
539 Ga0105247_10001402
540 Ga0105247_10007645
541 Ga0105247_10250362
542 Ga0105243_10622165
543 Ga0105242_10047575
544 Ga0105242_10209284
545 Ga0105248_11347610
546 Ga0105249_10012406
547 Ga0105249_10037846
548 Ga0105249_10062092
549 Ga0105249_10115506
550 Ga0105249_10160625
551 Ga0105249_10197956
552 Ga0105249_10396124
553 Ga0105249_10457598
554 Ga0105239_10002397
555 Ga0105246_10062364
556 Ga0157373_10128736
557 Ga0157371_10063896
558 Ga0157374_10001139
559 Ga0157378_10152442
560 Ga0157378_10262614
561 Ga0163162_10043401
562 Ga0163162_10206439
563 Ga0163162_10371026
564 Ga0157372_10034327
565 Ga0157372_10130450
566 Ga0157375_10007363
567 Ga0157375_10065051
568 Ga0157375_10385409
569 Ga0157375_10657602
570 Ga0163163_10001333
571 Ga0163163_10096375
572 Ga0163163_10236618
573 Ga0157380_10046053
574 Ga0157380_10122110
575 Ga0157377_10000790
576 Ga0157377_10008110
577 Ga0157377_10020164
578 Ga0157379_10305687
579 Ga0157379_10775452
580 Ga0157379_10784872
581 Ga0157376_10312706
582 Ga0163161_10079087
583 Ga0163161_10287595
584 Ga0209258_107858
585 Ga0209646_1001662
586 Ga0207697_10004402
587 Ga0207656_10131333
588 Ga0207682_10042720
589 Ga0207710_10000772
590 Ga0207688_10028819
591 Ga0207647_10000587
592 Ga0207647_10018454
593 Ga0207699_10326972
594 Ga0207645_10000524
595 Ga0207643_10023444
596 Ga0207643_10086686
597 Ga0207662_10053416
598 Ga0207662_10252313
599 Ga0207657_10126533
600 Ga0207681_10002639
601 Ga0207650_10027505
602 Ga0207650_10059462
603 Ga0207659_10020482
604 Ga0207659_10029822
605 Ga0207644_10096131
606 Ga0207690_10082414
607 Ga0207706_10019098
608 Ga0207706_10269882
609 Ga0207686_10000842
610 Ga0207686_10319448
611 Ga0207670_10002326
612 Ga0207670_10036699
613 Ga0207670_10055181
614 Ga0207670_10081296
615 Ga0207670_10354282
616 Ga0207669_10707771
617 Ga0207704_10099136
618 Ga0207704_10547605
619 Ga0207691_10011436
620 Ga0207691_10039311
621 Ga0207691_10048768
622 Ga0207691_10127966
623 Ga0207711_10588451
624 Ga0207689_10001885
625 Ga0207689_10007227
626 Ga0207689_10030085
627 Ga0207689_10220167
628 Ga0207689_10485283
629 Ga0207661_10004300
630 Ga0207661_10007659
631 Ga0207679_10003671
632 Ga0207651_10036957
633 Ga0207651_10112012
634 Ga0207651_10141441
635 Ga0207651_10148744
636 Ga0207651_10804943
637 Ga0207712_10030065
638 Ga0207712_10067234
639 Ga0207712_10103405
640 Ga0207712_10205836
641 Ga0207712_10339238
642 Ga0207712_10680334
643 Ga0207668_10032487
644 Ga0207668_10866141
645 Ga0207640_10121508
646 Ga0207640_10220029
647 Ga0207658_10531590
648 Ga0207658_10614724
649 Ga0207677_10080485
650 Ga0207677_10207112
651 Ga0207639_10002295
652 Ga0207639_10108781
653 Ga0207708_10206336
654 Ga0207702_10085750
655 Ga0207641_10001343
656 Ga0207641_10040932
657 Ga0207648_10009876
658 Ga0207676_10002581
659 Ga0207676_10035883
660 Ga0207676_10101453
661 Ga0207674_10002077
662 Ga0207674_10004688
663 Ga0207674_10020691
664 Ga0207674_10033626
665 Ga0207674_10085733
666 Ga0207675_100002316
667 Ga0207675_100055139
668 Ga0207675_100586327
669 Ga0207675_100689397
670 Ga0207675_100700282
671 Ga0207683_10017834
672 Ga0207698_10064131
673 Ga0207698_10104075
674 Ga0207698_10139522
675 Ga0207698_10931439
676 Ga0207428_10231974
677 Ga0268266_10162825
678 Ga0268265_10003389
679 Ga0268265_10416831
680 Ga0268265_10508359
681 Ga0268264_10100655
682 Ga0268264_10174678
683 Ga0268264_10232817
684 Ga0265328_10068251
685 Ga0265320_10153009
686 Ga0307513_10111699
687 Ga0316579_10144711
688 Ga0265314_10006060
689 Ga0307516_10164763
690 Ga0307412_10303281
691 Ga0316593_10049649
692 Ga0373926_0096603
693 Ga0373923_0112134
694 Ga0373943_0028267
695 Ga0373947_0372288
696 Ga0316582_0081034
697 Ga0373925_0221952
698 Ga0373925_0407805
699 Ga0451853_1821009
700 Ga0439441_003682
701 Ga0439448_0199028
702 Ga0439449_0143128
703 Ga0439457_002097
704 Ga0439435_0043094
705 Ga0466969_0008873
706 Ga0466972_0132261
707 Ga0466966_0000028
708 Ga0466961_0200687
709 Ga0466961_0246798
710 Ga0466968_0184968
711 Ga0466957_0000082
712 Ga0466957_0031772
713 Ga0466959_0000047
714 Ga0495650_0056788
715 Ga0495598_0096963
716 Ga0495621_0054031
717 Ga0495625_0218547
718 Ga0496110_0628907
719 Ga0501312_054823
720 Ga0501315_043641
721 Ga0501032_0013756
722 Ga0501032_0051964
723 Ga0501033_0051948
724 Ga0501036_0143721
725 Ga0501037_0026219
726 Ga0501037_0094531
727 Ga0501038_0025941
728 Ga0501039_0014071
729 Ga0501043_0013976
730 Ga0501043_0021486
731 Ga0501043_0145407
732 Ga0501046_0360996
733 Ga0501047_0021674
734 Ga0501047_0042343
735 Ga0501048_0108081
736 Ga0501075_0348420
737 Ga0501223_002176
738 Ga0501257_002509
739 Ga0501259_013345
740 Ga0501225_0007990
741 Ga0501245_004044
742 Ga0501266_003660
743 Ga0501275_012456
744 Ga0501035_0026449
745 Ga0501035_0439534
746 Ga0501044_0003566
747 Ga0501044_0009342
748 Ga0501044_0080803
749 nmdc:mga09592_23145_c1
750 nmdc:mga09592_480519_c1
751 nmdc:mga0qj67_38941_c1
752 nmdc:mga06r32_115883_c1
753 nmdc:mga06r32_197178_c1
754 nmdc:mga08y16_13513_c1
755 nmdc:mga0rr50_640758_c1
756 Ga0500578_0000144
757 Ga0500578_0025973
758 Ga0500642_0122722
759 Ga0500573_0054276
760 Ga0500603_017305
761 Ga0500619_049265
762 Ga0500622_0271574
763 2738727710
764 2883070431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

79

233

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9665 48 201
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.94 42 198
4lwl-assembly1.cif.gz_A crystal structure of methionine sulfoxide reductase u16c/e55a from clostridium oremlandii 0.9299 47 198
3pil-assembly2.cif.gz_B crystal structure of mxr1 from saccharomyces cerevisiae in reduced form 0.9296 47 201
4lwm-assembly1.cif.gz_A crystal structure of methionine sulfoxide reductase u16c/e55d from clostridium oremlandii with methionie sulfoxide 0.9296 47 198
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9841 48 194 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9644 48 194 3.30.1060.10
af_Q09859_1_167_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.945 48 201 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.944 47 201 3.30.1060.10
af_A4HTE0_2_175_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9357 47 198 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A383CBU7-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9986 48 145 GO:0008113
AF-A0A7J3V0V1-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9979 48 195 GO:0008113
GO:0036211
AF-A0A359BCQ3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9976 48 141 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A832Y0D1-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9973 48 154 GO:0008113
AF-A0A2V5ZNZ8-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9964 47 161 GO:0005737
GO:0008113
GO:0034599
GO:0036456

Map