F428989

General Info

Members Datasets Scaffolds Average Seq Length
381 137 762 232

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10624459|Ga0207698_106244591
Length 266
Sequence MDATVFKKNLKTIDTSSLVDRVEKKLVETLQKKKLKTGDSIPKEIELAETLGVSRTVIREALLRLRMMGLIESKKKKGAVITSPDLFGILSKSMNPHILDQETLKEIFEIRLALEIGMADFLFKRKTDENIEELKKIVSKEPEITDQHLFNISHEIAFHGKLYEITGNDTMKKFQKMLLPVFDYVHHSGLLGKPITFKKFVSHKELVDILDKGTPELFRNAMRHHLENHFARIFDXNMQIGKFENVKIGIGFICSFTISKIFFSGI

Samples

Sample ID Description Type Environment
1 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
99 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
102 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
103 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
104 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
105 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
106 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
112 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
113 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
114 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
115 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
116 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
117 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
122 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
123 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
124 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
125 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
126 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
127 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
128 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
129 2738541283 Pedobacter sp. OK701 Isolate Unclassified
130 2738541284 Pedobacter sp. YR016 Isolate Unclassified
131 2739367651 Pedobacter sp. OK291 Isolate Unclassified
132 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
133 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
134 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
135 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
136 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
137 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.33
Metatranscriptomes 0
Isolates 3.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 0
Rhizoplane 0
Rhizosphere 90.55
Stem 0
Stem Tuber 0
Unclassified 8.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207698_10624459 3300026142 Bacteria 1065
2 SwRhRL2b_contig_2963908 2162886007 Bacteria 27528
3 SwRhRL2b_contig_3952261 2162886007 Bacteria 34047
4 SwRhRL2b_contig_406873 2162886007 Bacteria 3042
5 JGI24736J21556_1004776 3300001904 Bacteria 2301
6 rootH2_10038132 3300003320 Bacteria 2438
7 rootL2_10276438 3300003322 Bacteria 5763
8 rootH1_10370031 3300003323 Bacteria 1072
9 Ga0055536_1000049 3300003781 Bacteria 113328
10 Ga0055536_1014867 3300003781 Bacteria 2701
11 Ga0055530_10002255 3300003791 Bacteria 12695
12 Ga0065165_1000043 3300005262 Bacteria 203850
13 Ga0065714_10002765 3300005288 Bacteria 65513
14 Ga0065714_10003280 3300005288 Bacteria 26984
15 Ga0065714_10003574 3300005288 Bacteria 7566
16 Ga0065714_10064461 3300005288 Bacteria 66149
17 Ga0065714_10177409 3300005288 Bacteria 974
18 Ga0065704_10070251 3300005289 Bacteria 48366
19 Ga0065704_10070264 3300005289 Bacteria 44804
20 Ga0065704_10074701 3300005289 Bacteria 6076
21 Ga0065704_10083829 3300005289 Bacteria 3412
22 Ga0070658_10040432 3300005327 Bacteria 3762
23 Ga0070658_10137981 3300005327 Bacteria 2036
24 Ga0070658_10152781 3300005327 Bacteria 1933
25 Ga0070658_10236031 3300005327 Bacteria 1549
26 Ga0070658_10249902 3300005327 Unclassified 1504
27 Ga0070683_100010899 3300005329 Bacteria 7827
28 Ga0070680_100034152 3300005336 Bacteria 4101
29 Ga0070680_100041219 3300005336 Bacteria 3743
30 Ga0070680_100044817 3300005336 Bacteria 3594
31 Ga0070682_100489838 3300005337 Unclassified 950
32 Ga0068868_100428913 3300005338 Bacteria 1146
33 Ga0070660_100000248 3300005339 Bacteria 35592
34 Ga0070660_100031428 3300005339 Unclassified 3987
35 Ga0070660_100032917 3300005339 Bacteria 3904
36 Ga0070660_100075330 3300005339 Bacteria 2642
37 Ga0070660_100121747 3300005339 Bacteria 2082
38 Ga0070660_100386844 3300005339 Unclassified 1155
39 Ga0070660_100685691 3300005339 Bacteria 859
40 Ga0070692_10075166 3300005345 Bacteria 1809
41 Ga0070692_10294762 3300005345 Bacteria 988
42 Ga0070659_100016252 3300005366 Bacteria 5585
43 Ga0070659_100074092 3300005366 Bacteria 2711
44 Ga0070659_100191689 3300005366 Bacteria 1680
45 Ga0070659_100193038 3300005366 Bacteria 1674
46 Ga0070659_100214917 3300005366 Unclassified 1585
47 Ga0070659_100456738 3300005366 Bacteria 1084
48 Ga0070714_100241043 3300005435 Bacteria 1669
49 Ga0070711_100842296 3300005439 Unclassified 780
50 Ga0070663_100056455 3300005455 Bacteria 2813
51 Ga0070663_100256692 3300005455 Bacteria 1385
52 Ga0070663_100488379 3300005455 Bacteria 1021
53 Ga0070662_100000658 3300005457 Bacteria 20955
54 Ga0070681_10038735 3300005458 Bacteria 4779
55 Ga0070681_10090849 3300005458 Bacteria 3004
56 Ga0070681_10095446 3300005458 Bacteria 2922
57 Ga0070681_10127416 3300005458 Bacteria 2479
58 Ga0070681_10292575 3300005458 Bacteria 1538
59 Ga0070679_100005261 3300005530 Bacteria 11978
60 Ga0070679_100007047 3300005530 Bacteria 10484
61 Ga0070679_100041922 3300005530 Bacteria 4557
62 Ga0070679_100172794 3300005530 Unclassified 2133
63 Ga0070679_100483233 3300005530 Bacteria 1183
64 Ga0070684_100003827 3300005535 Bacteria 11381
65 Ga0070684_100112308 3300005535 Bacteria 2445
66 Ga0070684_100662108 3300005535 Unclassified 972
67 Ga0068853_100035054 3300005539 Bacteria 4261
68 Ga0068853_100036668 3300005539 Bacteria 4171
69 Ga0068855_100000133 3300005563 Bacteria 94906
70 Ga0068855_100010946 3300005563 Bacteria 10948
71 Ga0068855_100013163 3300005563 Bacteria 9978
72 Ga0068855_100015792 3300005563 Bacteria 9084
73 Ga0068855_100034910 3300005563 Bacteria 5993
74 Ga0068855_100050773 3300005563 Bacteria 4886
75 Ga0068855_100084165 3300005563 Bacteria 3684
76 Ga0068855_100177928 3300005563 Bacteria 2406
77 Ga0068855_100293363 3300005563 Bacteria 1802
78 Ga0068855_100332762 3300005563 Bacteria 1676
79 Ga0068855_100504063 3300005563 Unclassified 1315
80 Ga0068857_100005425 3300005577 Bacteria 10872
81 Ga0068857_100308106 3300005577 Bacteria 1461
82 Ga0068857_100333316 3300005577 Bacteria 1403
83 Ga0068857_100756013 3300005577 Bacteria 926
84 Ga0068854_100052660 3300005578 Unclassified 2920
85 Ga0068854_100601720 3300005578 Bacteria 939
86 Ga0068856_100012482 3300005614 Bacteria 8223
87 Ga0068856_100026443 3300005614 Bacteria 5659
88 Ga0068856_100056937 3300005614 Bacteria 3859
89 Ga0068856_100160544 3300005614 Bacteria 2258
90 Ga0068852_100000379 3300005616 Bacteria 29959
91 Ga0068852_100009701 3300005616 Bacteria 7154
92 Ga0068852_100010691 3300005616 Bacteria 6871
93 Ga0068852_100138890 3300005616 Unclassified 2247
94 Ga0068852_100160428 3300005616 Bacteria 2099
95 Ga0068852_100162089 3300005616 Bacteria 2089
96 Ga0068852_100514355 3300005616 Bacteria 1194
97 Ga0068859_100797462 3300005617 Bacteria 1032
98 Ga0097620_100797493 3300006931 Bacteria 1032
99 Ga0105240_10000398 3300009093 Bacteria 81045
100 Ga0105240_10003613 3300009093 Bacteria 23948
101 Ga0105240_10018469 3300009093 Bacteria 9362
102 Ga0105240_10225646 3300009093 Unclassified 2180
103 Ga0105240_10688948 3300009093 Bacteria 1117
104 Ga0111539_10173129 3300009094 Unclassified 2522
105 Ga0105241_10003058 3300009174 Bacteria 12475
106 Ga0105241_10004032 3300009174 Bacteria 10869
107 Ga0105241_10430544 3300009174 Bacteria 1163
108 Ga0105241_10510836 3300009174 Bacteria 1073
109 Ga0105237_10002634 3300009545 Bacteria 22084
110 Ga0105237_10043874 3300009545 Unclassified 4502
111 Ga0105237_10527315 3300009545 Unclassified 1188
112 Ga0105239_10107396 3300010375 Bacteria 3092
113 Ga0105239_10451983 3300010375 Bacteria 1458
114 Ga0105239_10549740 3300010375 Unclassified 1315
115 Ga0105246_10106657 3300011119 Bacteria 2050
116 Ga0157373_10000043 3300013100 Bacteria 113422
117 Ga0157373_10000601 3300013100 Bacteria 27966
118 Ga0157373_10001097 3300013100 Bacteria 20827
119 Ga0157373_10030373 3300013100 Bacteria 3888
120 Ga0157373_10036689 3300013100 Bacteria 3516
121 Ga0157373_10071380 3300013100 Bacteria 2453
122 Ga0157373_10082703 3300013100 Bacteria 2263
123 Ga0157373_10144127 3300013100 Bacteria 1675
124 Ga0157373_10264921 3300013100 Bacteria 1216
125 Ga0157371_10000416 3300013102 Bacteria 52659
126 Ga0157371_10000486 3300013102 Bacteria 48340
127 Ga0157371_10000669 3300013102 Bacteria 40629
128 Ga0157371_10002197 3300013102 Bacteria 18937
129 Ga0157371_10006268 3300013102 Bacteria 9853
130 Ga0157371_10006997 3300013102 Bacteria 9180
131 Ga0157371_10008009 3300013102 Bacteria 8467
132 Ga0157371_10044900 3300013102 Bacteria 3145
133 Ga0157371_10045424 3300013102 Bacteria 3126
134 Ga0157371_10049727 3300013102 Bacteria 2978
135 Ga0157371_10054230 3300013102 Bacteria 2848
136 Ga0157371_10063488 3300013102 Bacteria 2617
137 Ga0157371_10080996 3300013102 Bacteria 2299
138 Ga0157371_10105100 3300013102 Bacteria 2003
139 Ga0157371_10115699 3300013102 Bacteria 1905
140 Ga0157370_10001110 3300013104 Bacteria 33701
141 Ga0157370_10003868 3300013104 Bacteria 17439
142 Ga0157370_10009399 3300013104 Bacteria 10451
143 Ga0157370_10021571 3300013104 Bacteria 6418
144 Ga0157370_10026295 3300013104 Bacteria 5748
145 Ga0157370_10027947 3300013104 Bacteria 5556
146 Ga0157370_10033765 3300013104 Unclassified 4986
147 Ga0157370_10039979 3300013104 Bacteria 4530
148 Ga0157370_10076917 3300013104 Bacteria 3144
149 Ga0157370_10077212 3300013104 Bacteria 3138
150 Ga0157370_10082501 3300013104 Bacteria 3024
151 Ga0157370_10096371 3300013104 Bacteria 2776
152 Ga0157370_10128511 3300013104 Bacteria 2364
153 Ga0157370_10264738 3300013104 Bacteria 1588
154 Ga0157370_10497078 3300013104 Bacteria 1120
155 Ga0157369_10002425 3300013105 Bacteria 22409
156 Ga0157369_10012447 3300013105 Bacteria 9656
157 Ga0157369_10029992 3300013105 Bacteria 6002
158 Ga0157369_10031013 3300013105 Bacteria 5891
159 Ga0157369_10051400 3300013105 Unclassified 4460
160 Ga0157369_10059136 3300013105 Bacteria 4134
161 Ga0157369_10119325 3300013105 Unclassified 2799
162 Ga0157369_10232885 3300013105 Bacteria 1925
163 Ga0157369_10374131 3300013105 Unclassified 1479
164 Ga0157369_10578149 3300013105 Bacteria 1160
165 Ga0157374_10002365 3300013296 Bacteria 15890
166 Ga0163162_10025960 3300013306 Bacteria 5790
167 Ga0157372_10000001 3300013307 Bacteria 791349
168 Ga0157372_10000231 3300013307 Bacteria 62248
169 Ga0157372_10006539 3300013307 Bacteria 12401
170 Ga0157372_10024950 3300013307 Bacteria 6498
171 Ga0157372_10030816 3300013307 Bacteria 5868
172 Ga0157372_10041576 3300013307 Bacteria 5084
173 Ga0157372_10050249 3300013307 Bacteria 4638
174 Ga0157372_10051149 3300013307 Bacteria 4597
175 Ga0157372_10052906 3300013307 Bacteria 4524
176 Ga0157372_10064620 3300013307 Bacteria 4106
177 Ga0157372_10097277 3300013307 Bacteria 3356
178 Ga0157372_10159511 3300013307 Bacteria 2606
179 Ga0157372_10230547 3300013307 Bacteria 2147
180 Ga0157372_10469587 3300013307 Bacteria 1466
181 Ga0157372_10605419 3300013307 Bacteria 1277
182 Ga0157372_10662927 3300013307 Bacteria 1215
183 Ga0157372_10664324 3300013307 Bacteria 1213
184 Ga0157372_11176072 3300013307 Bacteria 886
185 Ga0157372_11527631 3300013307 Bacteria 769
186 Ga0157375_10041762 3300013308 Bacteria 4431
187 Ga0157375_10132484 3300013308 Bacteria 2613
188 Ga0157380_10201496 3300014326 Bacteria 1766
189 Ga0157380_10297560 3300014326 Bacteria 1485
190 Ga0182008_10000001 3300014497 Bacteria 540790
191 Ga0182008_10020046 3300014497 Bacteria 3446
192 Ga0182008_10053850 3300014497 Bacteria 1992
193 Ga0182008_10164783 3300014497 Unclassified 1117
194 Ga0182006_1001890 3300015261 Bacteria 11951
195 Ga0182007_10002417 3300015262 Bacteria 9327
196 Ga0182007_10006207 3300015262 Bacteria 5153
197 Ga0182007_10010010 3300015262 Bacteria 3776
198 Ga0182007_10033678 3300015262 Bacteria 1735
199 Ga0163161_10000391 3300017792 Bacteria 36781
200 Ga0209233_1026482 3300025261 Bacteria 1417
201 Ga0209676_1000001 3300025292 Bacteria 1852142
202 Ga0209676_1000584 3300025292 Bacteria 54694
203 Ga0209050_1000258 3300025298 Bacteria 113741
204 Ga0209050_1021200 3300025298 Bacteria 2379
205 Ga0207647_10001256 3300025904 Bacteria 19506
206 Ga0207647_10001340 3300025904 Bacteria 18926
207 Ga0207647_10001627 3300025904 Bacteria 17271
208 Ga0207647_10015743 3300025904 Bacteria 5177
209 Ga0207705_10023834 3300025909 Bacteria 4367
210 Ga0207705_10055498 3300025909 Unclassified 2856
211 Ga0207705_10184471 3300025909 Bacteria 1576
212 Ga0207705_10214811 3300025909 Bacteria 1459
213 Ga0207654_10022968 3300025911 Bacteria 3335
214 Ga0207654_10036694 3300025911 Bacteria 2740
215 Ga0207707_10010112 3300025912 Bacteria 8188
216 Ga0207707_10044580 3300025912 Bacteria 3867
217 Ga0207707_10077699 3300025912 Bacteria 2898
218 Ga0207707_10235031 3300025912 Bacteria 1594
219 Ga0207707_10250489 3300025912 Bacteria 1539
220 Ga0207695_10000076 3300025913 Bacteria 307969
221 Ga0207695_10000090 3300025913 Bacteria 272143
222 Ga0207695_10022607 3300025913 Bacteria 7132
223 Ga0207695_10049043 3300025913 Bacteria 4454
224 Ga0207695_10217409 3300025913 Bacteria 1819
225 Ga0207671_10003364 3300025914 Bacteria 16041
226 Ga0207671_10269179 3300025914 Unclassified 1342
227 Ga0207671_10366505 3300025914 Bacteria 1144
228 Ga0207660_10024530 3300025917 Bacteria 4084
229 Ga0207660_10102087 3300025917 Bacteria 2144
230 Ga0207657_10005835 3300025919 Bacteria 12829
231 Ga0207657_10012918 3300025919 Bacteria 8210
232 Ga0207657_10039289 3300025919 Bacteria 4207
233 Ga0207657_10056361 3300025919 Bacteria 3391
234 Ga0207657_10091241 3300025919 Unclassified 2541
235 Ga0207657_10110544 3300025919 Bacteria 2270
236 Ga0207657_10350445 3300025919 Bacteria 1164
237 Ga0207657_10594048 3300025919 Bacteria 864
238 Ga0207652_10000013 3300025921 Bacteria 222247
239 Ga0207652_10000074 3300025921 Bacteria 108397
240 Ga0207652_10001161 3300025921 Bacteria 23656
241 Ga0207652_10006665 3300025921 Bacteria 9303
242 Ga0207652_10058952 3300025921 Bacteria 3308
243 Ga0207690_10039609 3300025932 Bacteria 3075
244 Ga0207690_10071519 3300025932 Unclassified 2393
245 Ga0207690_10399516 3300025932 Bacteria 1096
246 Ga0207706_10002012 3300025933 Bacteria 19898
247 Ga0207667_10000100 3300025949 Bacteria 138482
248 Ga0207667_10000453 3300025949 Bacteria 54929
249 Ga0207667_10007036 3300025949 Bacteria 13591
250 Ga0207667_10031568 3300025949 Bacteria 5716
251 Ga0207667_10053465 3300025949 Bacteria 4249
252 Ga0207667_10078643 3300025949 Bacteria 3418
253 Ga0207667_10085652 3300025949 Bacteria 3262
254 Ga0207667_10202045 3300025949 Bacteria 2039
255 Ga0207667_10393940 3300025949 Bacteria 1410
256 Ga0207640_10002604 3300025981 Bacteria 9665
257 Ga0207640_10036485 3300025981 Bacteria 3087
258 Ga0207640_10070442 3300025981 Unclassified 2352
259 Ga0207640_10110572 3300025981 Bacteria 1947
260 Ga0207677_10241174 3300026023 Unclassified 1462
261 Ga0207639_10071515 3300026041 Bacteria 2713
262 Ga0207639_10074848 3300026041 Bacteria 2661
263 Ga0207678_10010312 3300026067 Bacteria 8201
264 Ga0207678_10275828 3300026067 Bacteria 1442
265 Ga0207678_10508729 3300026067 Bacteria 1050
266 Ga0207702_10158511 3300026078 Bacteria 2065
267 Ga0207702_10309263 3300026078 Bacteria 1502
268 Ga0207702_10389866 3300026078 Bacteria 1341
269 Ga0207702_10675196 3300026078 Bacteria 1017
270 Ga0207674_10009127 3300026116 Bacteria 11378
271 Ga0207674_10272568 3300026116 Bacteria 1640
272 Ga0207698_10002846 3300026142 Bacteria 10348
273 Ga0207698_10076191 3300026142 Bacteria 2684
274 Ga0207698_10086925 3300026142 Bacteria 2544
275 Ga0207698_10098785 3300026142 Bacteria 2413
276 Ga0207698_10424064 3300026142 Bacteria 1277
277 Ga0307515_10000493 3300028794 Bacteria 94441
278 Ga0265327_10000207 3300031251 Bacteria 123193
279 Ga0307513_10638751 3300031456 Unclassified 772
280 Ga0307407_10480984 3300031903 Bacteria 907
281 Ga0307412_10000043 3300031911 Bacteria 166562
282 Ga0307412_10000075 3300031911 Bacteria 97612
283 Ga0307414_10002997 3300032004 Bacteria 8946
284 Ga0307414_10007108 3300032004 Bacteria 6281
285 Ga0307414_10007853 3300032004 Bacteria 6016
286 Ga0307414_10037368 3300032004 Bacteria 3251
287 Ga0307414_10068899 3300032004 Bacteria 2541
288 Ga0307414_10087685 3300032004 Bacteria 2301
289 Ga0307414_10807555 3300032004 Bacteria 856
290 Ga0395899_0000011 3300037312 Bacteria 521331
291 Ga0395899_0002810 3300037312 Bacteria 14026
292 Ga0395899_0006589 3300037312 Bacteria 8997
293 Ga0395899_0011557 3300037312 Bacteria 6759
294 Ga0395899_0033699 3300037312 Bacteria 3846
295 Ga0395899_0061352 3300037312 Bacteria 2769
296 Ga0395899_0299052 3300037312 Bacteria 1089
297 Ga0395900_0007472 3300037418 Bacteria 11297
298 Ga0395900_0007567 3300037418 Bacteria 11217
299 Ga0395900_0010663 3300037418 Bacteria 9398
300 Ga0395900_0125592 3300037418 Bacteria 2631
301 Ga0395900_0276504 3300037418 Bacteria 1672
302 Ga0395900_0287442 3300037418 Unclassified 1634
303 Ga0395898_0001381 3300037466 Bacteria 34756
304 Ga0395898_0016533 3300037466 Bacteria 7545
305 Ga0395898_0032678 3300037466 Bacteria 5194
306 Ga0395898_0076094 3300037466 Bacteria 3241
307 Ga0395898_0211978 3300037466 Bacteria 1847
308 Ga0395905_0004093 3300037471 Bacteria 15278
309 Ga0395905_0288055 3300037471 Bacteria 1529
310 Ga0395905_0372563 3300037471 Bacteria 1321
311 Ga0395901_0143402 3300038443 Bacteria 2510
312 Ga0395901_0205181 3300038443 Bacteria 2065
313 Ga0395901_0437233 3300038443 Bacteria 1339
314 Ga0395901_0437876 3300038443 Bacteria 1338
315 Ga0395901_0461149 3300038443 Bacteria 1298
316 Ga0451577_0000061 3300042876 Bacteria 268366
317 Ga0466969_0217937 3300044656 Unclassified 868
318 Ga0466966_0189565 3300044684 Unclassified 1246
319 Ga0453684_0000084 3300044712 Bacteria 398306
320 Ga0453684_0462049 3300044712 Bacteria 1411
321 Ga0451576_0000179 3300045051 Bacteria 159850
322 Ga0495650_0000110 3300046471 Bacteria 198355
323 Ga0495606_0000003 3300046507 Bacteria 449402
324 Ga0495610_0000160 3300046512 Bacteria 74776
325 Ga0495610_0000273 3300046512 Bacteria 53916
326 Ga0495610_0000986 3300046512 Bacteria 26264
327 Ga0495637_0037407 3300046520 Bacteria 2107
328 Ga0495633_0003146 3300046558 Bacteria 11175
329 Ga0495668_0044968 3300046616 Bacteria 2454
330 Ga0495625_0000013 3300046660 Bacteria 345151
331 Ga0495661_0005878 3300046665 Bacteria 8672
332 Ga0495671_0062239 3300046692 Bacteria 1839
333 Ga0495649_0000010 3300046694 Bacteria 430552
334 Ga0495679_041808 3300047446 Bacteria 1417
335 Ga0496116_0015738 3300048919 Bacteria 5963
336 Ga0496117_0006685 3300048920 Bacteria 11535
337 Ga0496122_0012107 3300048925 Bacteria 8639
338 Ga0496123_0027164 3300048926 Bacteria 4269
339 Ga0501298_044117 3300049521 Bacteria 910
340 Ga0501032_0242806 3300049569 Bacteria 1170
341 Ga0501033_0429251 3300049570 Bacteria 920
342 Ga0501034_0022633 3300049571 Bacteria 6402
343 Ga0501034_0125138 3300049571 Bacteria 2556
344 Ga0501034_0420785 3300049571 Bacteria 1257
345 Ga0501070_0194112 3300049586 Unclassified 1668
346 Ga0501070_0251565 3300049586 Bacteria 1445
347 Ga0501207_038244 3300049654 Bacteria 827
348 Ga0501209_104595 3300049656 Bacteria 832
349 Ga0501217_012400 3300049661 Bacteria 1898
350 Ga0501217_016078 3300049661 Bacteria 1710
351 Ga0501223_024888 3300049663 Unclassified 1164
352 Ga0501242_002652 3300049674 Bacteria 1894
353 Ga0501257_021900 3300049686 Bacteria 1510
354 Ga0501257_043610 3300049686 Bacteria 1106
355 Ga0501241_016232 3300049758 Bacteria 1357
356 Ga0501241_029228 3300049758 Bacteria 1037
357 Ga0501035_0172033 3300049822 Bacteria 1871
358 Ga0501044_0315007 3300049823 Bacteria 1490
359 Ga0500651_0000625 3300053093 Bacteria 17617
360 Ga0500651_0006546 3300053093 Bacteria 6725
361 Ga0500566_0202241 3300053094 Bacteria 1002
362 Ga0500608_097577 3300053122 Unclassified 1365
363 Ga0500568_0048983 3300053139 Bacteria 1669
364 Ga0500624_000108 3300053157 Bacteria 39257
365 Ga0500624_000475 3300053157 Bacteria 11939
366 Ga0500634_0075274 3300053161 Bacteria 1756
367 Ga0500634_0171196 3300053161 Bacteria 989
368 2522550541 2522125168 Bacteria 7376607
369 2586210541 2585427687 Bacteria 5544917
370 2722726718 2721755487 Bacteria 6357185
371 2738758029 2738541283 Bacteria 7222293
372 2738761122 2738541284 Bacteria 5199923
373 2738764218 2738541284 Bacteria 5199923
374 2739590438 2739367651 Bacteria 6359826
375 2776611961 2775506987 Bacteria 5373360
376 2776613335 2775506987 Bacteria 5373360
377 2840678376 2840677318 Bacteria 2664183
378 2883071020 2883068021 Bacteria 6192739
379 2890739285 2890737413 Bacteria 4269751
380 2896086193 2896085136 Bacteria 6129793
381 3003235630 3003233435 Bacteria 4458031
382 Ga0207698_10624459
383 SwRhRL2b_contig_2963908
384 SwRhRL2b_contig_3952261
385 SwRhRL2b_contig_406873
386 JGI24736J21556_1004776
387 rootH2_10038132
388 rootL2_10276438
389 rootH1_10370031
390 Ga0055536_1000049
391 Ga0055536_1014867
392 Ga0055530_10002255
393 Ga0065165_1000043
394 Ga0065714_10002765
395 Ga0065714_10003280
396 Ga0065714_10003574
397 Ga0065714_10064461
398 Ga0065714_10177409
399 Ga0065704_10070251
400 Ga0065704_10070264
401 Ga0065704_10074701
402 Ga0065704_10083829
403 Ga0070658_10040432
404 Ga0070658_10137981
405 Ga0070658_10152781
406 Ga0070658_10236031
407 Ga0070658_10249902
408 Ga0070683_100010899
409 Ga0070680_100034152
410 Ga0070680_100041219
411 Ga0070680_100044817
412 Ga0070682_100489838
413 Ga0068868_100428913
414 Ga0070660_100000248
415 Ga0070660_100031428
416 Ga0070660_100032917
417 Ga0070660_100075330
418 Ga0070660_100121747
419 Ga0070660_100386844
420 Ga0070660_100685691
421 Ga0070692_10075166
422 Ga0070692_10294762
423 Ga0070659_100016252
424 Ga0070659_100074092
425 Ga0070659_100191689
426 Ga0070659_100193038
427 Ga0070659_100214917
428 Ga0070659_100456738
429 Ga0070714_100241043
430 Ga0070711_100842296
431 Ga0070663_100056455
432 Ga0070663_100256692
433 Ga0070663_100488379
434 Ga0070662_100000658
435 Ga0070681_10038735
436 Ga0070681_10090849
437 Ga0070681_10095446
438 Ga0070681_10127416
439 Ga0070681_10292575
440 Ga0070679_100005261
441 Ga0070679_100007047
442 Ga0070679_100041922
443 Ga0070679_100172794
444 Ga0070679_100483233
445 Ga0070684_100003827
446 Ga0070684_100112308
447 Ga0070684_100662108
448 Ga0068853_100035054
449 Ga0068853_100036668
450 Ga0068855_100000133
451 Ga0068855_100010946
452 Ga0068855_100013163
453 Ga0068855_100015792
454 Ga0068855_100034910
455 Ga0068855_100050773
456 Ga0068855_100084165
457 Ga0068855_100177928
458 Ga0068855_100293363
459 Ga0068855_100332762
460 Ga0068855_100504063
461 Ga0068857_100005425
462 Ga0068857_100308106
463 Ga0068857_100333316
464 Ga0068857_100756013
465 Ga0068854_100052660
466 Ga0068854_100601720
467 Ga0068856_100012482
468 Ga0068856_100026443
469 Ga0068856_100056937
470 Ga0068856_100160544
471 Ga0068852_100000379
472 Ga0068852_100009701
473 Ga0068852_100010691
474 Ga0068852_100138890
475 Ga0068852_100160428
476 Ga0068852_100162089
477 Ga0068852_100514355
478 Ga0068859_100797462
479 Ga0097620_100797493
480 Ga0105240_10000398
481 Ga0105240_10003613
482 Ga0105240_10018469
483 Ga0105240_10225646
484 Ga0105240_10688948
485 Ga0111539_10173129
486 Ga0105241_10003058
487 Ga0105241_10004032
488 Ga0105241_10430544
489 Ga0105241_10510836
490 Ga0105237_10002634
491 Ga0105237_10043874
492 Ga0105237_10527315
493 Ga0105239_10107396
494 Ga0105239_10451983
495 Ga0105239_10549740
496 Ga0105246_10106657
497 Ga0157373_10000043
498 Ga0157373_10000601
499 Ga0157373_10001097
500 Ga0157373_10030373
501 Ga0157373_10036689
502 Ga0157373_10071380
503 Ga0157373_10082703
504 Ga0157373_10144127
505 Ga0157373_10264921
506 Ga0157371_10000416
507 Ga0157371_10000486
508 Ga0157371_10000669
509 Ga0157371_10002197
510 Ga0157371_10006268
511 Ga0157371_10006997
512 Ga0157371_10008009
513 Ga0157371_10044900
514 Ga0157371_10045424
515 Ga0157371_10049727
516 Ga0157371_10054230
517 Ga0157371_10063488
518 Ga0157371_10080996
519 Ga0157371_10105100
520 Ga0157371_10115699
521 Ga0157370_10001110
522 Ga0157370_10003868
523 Ga0157370_10009399
524 Ga0157370_10021571
525 Ga0157370_10026295
526 Ga0157370_10027947
527 Ga0157370_10033765
528 Ga0157370_10039979
529 Ga0157370_10076917
530 Ga0157370_10077212
531 Ga0157370_10082501
532 Ga0157370_10096371
533 Ga0157370_10128511
534 Ga0157370_10264738
535 Ga0157370_10497078
536 Ga0157369_10002425
537 Ga0157369_10012447
538 Ga0157369_10029992
539 Ga0157369_10031013
540 Ga0157369_10051400
541 Ga0157369_10059136
542 Ga0157369_10119325
543 Ga0157369_10232885
544 Ga0157369_10374131
545 Ga0157369_10578149
546 Ga0157374_10002365
547 Ga0163162_10025960
548 Ga0157372_10000001
549 Ga0157372_10000231
550 Ga0157372_10006539
551 Ga0157372_10024950
552 Ga0157372_10030816
553 Ga0157372_10041576
554 Ga0157372_10050249
555 Ga0157372_10051149
556 Ga0157372_10052906
557 Ga0157372_10064620
558 Ga0157372_10097277
559 Ga0157372_10159511
560 Ga0157372_10230547
561 Ga0157372_10469587
562 Ga0157372_10605419
563 Ga0157372_10662927
564 Ga0157372_10664324
565 Ga0157372_11176072
566 Ga0157372_11527631
567 Ga0157375_10041762
568 Ga0157375_10132484
569 Ga0157380_10201496
570 Ga0157380_10297560
571 Ga0182008_10000001
572 Ga0182008_10020046
573 Ga0182008_10053850
574 Ga0182008_10164783
575 Ga0182006_1001890
576 Ga0182007_10002417
577 Ga0182007_10006207
578 Ga0182007_10010010
579 Ga0182007_10033678
580 Ga0163161_10000391
581 Ga0209233_1026482
582 Ga0209676_1000001
583 Ga0209676_1000584
584 Ga0209050_1000258
585 Ga0209050_1021200
586 Ga0207647_10001256
587 Ga0207647_10001340
588 Ga0207647_10001627
589 Ga0207647_10015743
590 Ga0207705_10023834
591 Ga0207705_10055498
592 Ga0207705_10184471
593 Ga0207705_10214811
594 Ga0207654_10022968
595 Ga0207654_10036694
596 Ga0207707_10010112
597 Ga0207707_10044580
598 Ga0207707_10077699
599 Ga0207707_10235031
600 Ga0207707_10250489
601 Ga0207695_10000076
602 Ga0207695_10000090
603 Ga0207695_10022607
604 Ga0207695_10049043
605 Ga0207695_10217409
606 Ga0207671_10003364
607 Ga0207671_10269179
608 Ga0207671_10366505
609 Ga0207660_10024530
610 Ga0207660_10102087
611 Ga0207657_10005835
612 Ga0207657_10012918
613 Ga0207657_10039289
614 Ga0207657_10056361
615 Ga0207657_10091241
616 Ga0207657_10110544
617 Ga0207657_10350445
618 Ga0207657_10594048
619 Ga0207652_10000013
620 Ga0207652_10000074
621 Ga0207652_10001161
622 Ga0207652_10006665
623 Ga0207652_10058952
624 Ga0207690_10039609
625 Ga0207690_10071519
626 Ga0207690_10399516
627 Ga0207706_10002012
628 Ga0207667_10000100
629 Ga0207667_10000453
630 Ga0207667_10007036
631 Ga0207667_10031568
632 Ga0207667_10053465
633 Ga0207667_10078643
634 Ga0207667_10085652
635 Ga0207667_10202045
636 Ga0207667_10393940
637 Ga0207640_10002604
638 Ga0207640_10036485
639 Ga0207640_10070442
640 Ga0207640_10110572
641 Ga0207677_10241174
642 Ga0207639_10071515
643 Ga0207639_10074848
644 Ga0207678_10010312
645 Ga0207678_10275828
646 Ga0207678_10508729
647 Ga0207702_10158511
648 Ga0207702_10309263
649 Ga0207702_10389866
650 Ga0207702_10675196
651 Ga0207674_10009127
652 Ga0207674_10272568
653 Ga0207698_10002846
654 Ga0207698_10076191
655 Ga0207698_10086925
656 Ga0207698_10098785
657 Ga0207698_10424064
658 Ga0307515_10000493
659 Ga0265327_10000207
660 Ga0307513_10638751
661 Ga0307407_10480984
662 Ga0307412_10000043
663 Ga0307412_10000075
664 Ga0307414_10002997
665 Ga0307414_10007108
666 Ga0307414_10007853
667 Ga0307414_10037368
668 Ga0307414_10068899
669 Ga0307414_10087685
670 Ga0307414_10807555
671 Ga0395899_0000011
672 Ga0395899_0002810
673 Ga0395899_0006589
674 Ga0395899_0011557
675 Ga0395899_0033699
676 Ga0395899_0061352
677 Ga0395899_0299052
678 Ga0395900_0007472
679 Ga0395900_0007567
680 Ga0395900_0010663
681 Ga0395900_0125592
682 Ga0395900_0276504
683 Ga0395900_0287442
684 Ga0395898_0001381
685 Ga0395898_0016533
686 Ga0395898_0032678
687 Ga0395898_0076094
688 Ga0395898_0211978
689 Ga0395905_0004093
690 Ga0395905_0288055
691 Ga0395905_0372563
692 Ga0395901_0143402
693 Ga0395901_0205181
694 Ga0395901_0437233
695 Ga0395901_0437876
696 Ga0395901_0461149
697 Ga0451577_0000061
698 Ga0466969_0217937
699 Ga0466966_0189565
700 Ga0453684_0000084
701 Ga0453684_0462049
702 Ga0451576_0000179
703 Ga0495650_0000110
704 Ga0495606_0000003
705 Ga0495610_0000160
706 Ga0495610_0000273
707 Ga0495610_0000986
708 Ga0495637_0037407
709 Ga0495633_0003146
710 Ga0495668_0044968
711 Ga0495625_0000013
712 Ga0495661_0005878
713 Ga0495671_0062239
714 Ga0495649_0000010
715 Ga0495679_041808
716 Ga0496116_0015738
717 Ga0496117_0006685
718 Ga0496122_0012107
719 Ga0496123_0027164
720 Ga0501298_044117
721 Ga0501032_0242806
722 Ga0501033_0429251
723 Ga0501034_0022633
724 Ga0501034_0125138
725 Ga0501034_0420785
726 Ga0501070_0194112
727 Ga0501070_0251565
728 Ga0501207_038244
729 Ga0501209_104595
730 Ga0501217_012400
731 Ga0501217_016078
732 Ga0501223_024888
733 Ga0501242_002652
734 Ga0501257_021900
735 Ga0501257_043610
736 Ga0501241_016232
737 Ga0501241_029228
738 Ga0501035_0172033
739 Ga0501044_0315007
740 Ga0500651_0000625
741 Ga0500651_0006546
742 Ga0500566_0202241
743 Ga0500608_097577
744 Ga0500568_0048983
745 Ga0500624_000108
746 Ga0500624_000475
747 Ga0500634_0075274
748 Ga0500634_0171196
749 2522550541
750 2586210541
751 2722726718
752 2738758029
753 2738761122
754 2738764218
755 2739590438
756 2776611961
757 2776613335
758 2840678376
759 2883071020
760 2890739285
761 2896086193
762 3003235630

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

18

81

0.97

PF07729

FCD

FCD domain

106

228

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bwg-assembly2.cif.gz_C-2 the crystal structure of possible transcriptional regulator yydk from bacillus subtilis subsp. subtilis str. 168 0.8871 16 82
3f8m-assembly1.cif.gz_B crystal structure of phnf from mycobacterium smegmatis 0.8758 19 81
8b2l-assembly1.cif.gz_E1 cryo-em structure of the plant 80s ribosome 0.8756 51 80
3bwg-assembly1.cif.gz_B the crystal structure of possible transcriptional regulator yydk from bacillus subtilis subsp. subtilis str. 168 0.865 13 80
3bwg-assembly1.cif.gz_A the crystal structure of possible transcriptional regulator yydk from bacillus subtilis subsp. subtilis str. 168 0.8444 18 82
ID Description Score Start End Superfamily
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9339 38 79 1.10.10.10
6az6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9159 15 80 1.10.10.10
af_P0ACL7_6_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9038 13 81 1.10.10.10
af_Q2G1B1_1_68_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8953 13 80 1.10.10.10
3bwgC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8842 16 82 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5B8VK12-F1-model_v4 FadR family transcriptional regulator 0.8643 9 230 GO:0003677
GO:0003700
GO:0005737
AF-A0A2T5BXX9-F1-model_v4 DNA-binding FadR family transcriptional regulator 0.8559 9 230 GO:0003677
GO:0003700
GO:0005737
AF-A0A1F3NEE3-F1-model_v4 GntR family transcriptional regulator 0.8554 1 230 GO:0003677
GO:0003700
GO:0005737
AF-A0A4Q0XFH8-F1-model_v4 FadR family transcriptional regulator 0.8536 10 230 GO:0003677
GO:0003700
GO:0005737
AF-A0A1F3NEE3-F1-model_v4 GntR family transcriptional regulator 0.8487 1 230 GO:0003677
GO:0003700
GO:0005737

Map