F428992

General Info

Members Datasets Scaffolds Average Seq Length
381 208 763 234

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10000059|Ga0307515_10000059174
Length 265
Sequence MPAAPYNTQQNFLQSDQYLYCSLFLFLIQKSAMNVVITGASKGFGRAIAETFAAGGHHLFICSRNEIDLYRAMEELMTRYPDIKIKAKARDISVKEQAIDFGEWLLANAYNIDVLVNNAGRFIPGSIHNENEGVLEEMMQTNVYSAYHLTRTLLPAMIKRKSGHIFNICSIASLNAYHNGGAYSISKFALHGFSKNLREELKPHQIKVTSVFPGAAYTDSWSGSGIDPNRIMESNDIAAMIYAAACLSPQACVEDIIIRPQLGDL

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
149 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
190 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
191 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
192 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
193 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
194 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
201 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
202 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 2738541278 Niastella sp. CF465 Isolate Unclassified
206 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
207 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
208 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.82
Nodule 0
Rhizoplane 0.26
Rhizosphere 84.78
Stem 0
Stem Tuber 0
Unclassified 13.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10000059 3300028794 Bacteria 257520
2 JGI24744J21845_10012468 3300002077 Bacteria 1724
3 JGI24751J29686_10019815 3300002459 Bacteria 1393
4 JGI25154J39366_1000023 3300002738 Bacteria 219569
5 JGI25157J39369_1017172 3300002741 Bacteria 880
6 rootH1_10108546 3300003316 Bacteria 7212
7 rootH1_10108546 3300003323 Unclassified 2346
8 rootH2_10001613 3300003320 Bacteria 20111
9 rootH2_10001614 3300003320 Bacteria 29985
10 rootH2_10023604 3300003320 Bacteria 13207
11 rootH2_10045482 3300003320 Bacteria 4174
12 rootL2_10008865 3300003322 Bacteria 21299
13 rootL2_10011803 3300003322 Bacteria 2006
14 rootL2_10026021 3300003322 Bacteria 20401
15 rootL2_10129454 3300003322 Bacteria 5168
16 rootH1_10007189 3300003323 Bacteria 65578
17 rootH1_10141599 3300003323 Bacteria 2453
18 rootH1_10161708 3300003323 Bacteria 2096
19 JGI25160J50197_1000765 3300003354 Bacteria 17319
20 Ga0065712_10016751 3300005290 Bacteria 1744
21 Ga0065712_10076530 3300005290 Bacteria 3644
22 Ga0065715_10130693 3300005293 Bacteria 2021
23 Ga0070658_10087832 3300005327 Unclassified 2560
24 Ga0070676_10316934 3300005328 Unclassified 1062
25 Ga0070683_100002723 3300005329 Bacteria 14112
26 Ga0070670_100019080 3300005331 Bacteria 5881
27 Ga0070670_100027025 3300005331 Bacteria 4936
28 Ga0070670_100497562 3300005331 Bacteria 1084
29 Ga0068869_100015968 3300005334 Bacteria 5053
30 Ga0068869_100020539 3300005334 Bacteria 4529
31 Ga0068869_100058799 3300005334 Unclassified 2812
32 Ga0068869_100427485 3300005334 Bacteria 1094
33 Ga0070666_10000072 3300005335 Bacteria 75356
34 Ga0070666_10019589 3300005335 Bacteria 4370
35 Ga0070666_10096849 3300005335 Unclassified 2031
36 Ga0070682_100000019 3300005337 Bacteria 220844
37 Ga0068868_100031884 3300005338 Bacteria 4051
38 Ga0068868_100751094 3300005338 Unclassified 876
39 Ga0070660_100366946 3300005339 Bacteria 1187
40 Ga0070689_100178554 3300005340 Bacteria 1723
41 Ga0070689_100182379 3300005340 Unclassified 1706
42 Ga0070689_100451335 3300005340 Bacteria 1094
43 Ga0070669_100001473 3300005353 Bacteria 17021
44 Ga0070669_100073359 3300005353 Bacteria 2535
45 Ga0070669_100156634 3300005353 Unclassified 1767
46 Ga0070669_100216889 3300005353 Unclassified 1512
47 Ga0070675_100168112 3300005354 Bacteria 1890
48 Ga0070671_100014066 3300005355 Bacteria 6460
49 Ga0070674_100026200 3300005356 Bacteria 3805
50 Ga0070673_100017881 3300005364 Bacteria 5052
51 Ga0070673_100091330 3300005364 Bacteria 2489
52 Ga0070673_100296906 3300005364 Unclassified 1421
53 Ga0070688_100432157 3300005365 Bacteria 981
54 Ga0070659_100001406 3300005366 Bacteria 17358
55 Ga0070667_100005066 3300005367 Bacteria 11030
56 Ga0070667_100007874 3300005367 Bacteria 8840
57 Ga0070667_100021229 3300005367 Bacteria 5395
58 Ga0070667_100064204 3300005367 Bacteria 3115
59 Ga0070700_100109981 3300005441 Bacteria 1831
60 Ga0070678_100027845 3300005456 Bacteria 3843
61 Ga0068867_100068349 3300005459 Bacteria 2651
62 Ga0068867_100181776 3300005459 Bacteria 1672
63 Ga0068867_100424682 3300005459 Unclassified 1127
64 Ga0070685_10009945 3300005466 Bacteria 4934
65 Ga0070685_10015240 3300005466 Bacteria 4081
66 Ga0070707_100544870 3300005468 Bacteria 1122
67 Ga0070698_100008121 3300005471 Bacteria 11346
68 Ga0070698_100219728 3300005471 Bacteria 1834
69 Ga0070684_100098957 3300005535 Bacteria 2602
70 Ga0068853_100101327 3300005539 Bacteria 2547
71 Ga0068853_100112208 3300005539 Bacteria 2423
72 Ga0068853_100252424 3300005539 Bacteria 1619
73 Ga0070672_100050456 3300005543 Bacteria 3240
74 Ga0070665_100000014 3300005548 Bacteria 484881
75 Ga0070665_100073080 3300005548 Bacteria 3436
76 Ga0068855_100010998 3300005563 Bacteria 10920
77 Ga0068854_100023108 3300005578 Bacteria 4243
78 Ga0068856_100048679 3300005614 Bacteria 4178
79 Ga0068852_100005115 3300005616 Bacteria 9343
80 Ga0068852_100031863 3300005616 Bacteria 4358
81 Ga0068859_100000006 3300005617 Bacteria 421509
82 Ga0068859_100285774 3300005617 Bacteria 1742
83 Ga0068859_100337782 3300005617 Bacteria 1600
84 Ga0068859_100629552 3300005617 Bacteria 1165
85 Ga0068864_100023261 3300005618 Bacteria 5202
86 Ga0068864_100065898 3300005618 Bacteria 3142
87 Ga0068864_100095234 3300005618 Bacteria 2633
88 Ga0068861_100220778 3300005719 Bacteria 1602
89 Ga0068851_10013185 3300005834 Bacteria 3910
90 Ga0068851_10053118 3300005834 Bacteria 2062
91 Ga0068870_10082814 3300005840 Bacteria 1777
92 Ga0068863_100033537 3300005841 Bacteria 4891
93 Ga0068863_100236855 3300005841 Unclassified 1762
94 Ga0068858_100004205 3300005842 Bacteria 14172
95 Ga0068858_100103960 3300005842 Bacteria 2650
96 Ga0068860_100000061 3300005843 Bacteria 192548
97 Ga0068860_100001096 3300005843 Bacteria 29818
98 Ga0068860_100002430 3300005843 Bacteria 19567
99 Ga0075366_10015481 3300006195 Bacteria 4372
100 Ga0075366_10319332 3300006195 Bacteria 951
101 Ga0097621_100002080 3300006237 Bacteria 13697
102 Ga0097621_100124415 3300006237 Bacteria 2189
103 Ga0097621_100128518 3300006237 Bacteria 2154
104 Ga0097621_100164824 3300006237 Bacteria 1907
105 Ga0097621_100175087 3300006237 Bacteria 1852
106 Ga0068871_100011294 3300006358 Bacteria 6549
107 Ga0068871_100040598 3300006358 Bacteria 3728
108 Ga0068871_100185708 3300006358 Bacteria 1789
109 Ga0068871_100529080 3300006358 Unclassified 1065
110 Ga0075428_100010088 3300006844 Bacteria 10494
111 Ga0075428_100021474 3300006844 Bacteria 7145
112 Ga0075428_100259270 3300006844 Bacteria 1872
113 Ga0075429_100005982 3300006880 Bacteria 10515
114 Ga0068865_100029896 3300006881 Unclassified 3619
115 Ga0068865_100042785 3300006881 Bacteria 3091
116 Ga0068865_100094096 3300006881 Unclassified 2180
117 Ga0097620_100000006 3300006931 Bacteria 421509
118 Ga0097620_100285772 3300006931 Bacteria 1742
119 Ga0097620_100337784 3300006931 Bacteria 1600
120 Ga0097620_100629559 3300006931 Bacteria 1165
121 Ga0105240_10000800 3300009093 Bacteria 56989
122 Ga0105240_10001787 3300009093 Bacteria 36277
123 Ga0105240_10001808 3300009093 Bacteria 36002
124 Ga0105240_10004358 3300009093 Bacteria 21601
125 Ga0105240_10320055 3300009093 Unclassified 1768
126 Ga0105240_10436249 3300009093 Bacteria 1469
127 Ga0111539_10179329 3300009094 Bacteria 2474
128 Ga0105245_10116422 3300009098 Unclassified 2492
129 Ga0105245_10193788 3300009098 Bacteria 1948
130 Ga0105245_10717955 3300009098 Unclassified 1034
131 Ga0105245_10758420 3300009098 Bacteria 1007
132 Ga0105247_10004545 3300009101 Bacteria 8845
133 Ga0105241_10002863 3300009174 Bacteria 12889
134 Ga0105241_10024166 3300009174 Bacteria 4513
135 Ga0105242_10014250 3300009176 Bacteria 6158
136 Ga0105242_10033301 3300009176 Bacteria 4126
137 Ga0105242_10362748 3300009176 Unclassified 1341
138 Ga0105248_11107997 3300009177 Bacteria 895
139 Ga0105237_10005526 3300009545 Bacteria 14250
140 Ga0105237_10006018 3300009545 Bacteria 13573
141 Ga0105237_10641995 3300009545 Bacteria 1068
142 Ga0105237_11034522 3300009545 Unclassified 828
143 Ga0105238_10000592 3300009551 Bacteria 38095
144 Ga0105238_10041703 3300009551 Bacteria 4649
145 Ga0105249_10003608 3300009553 Bacteria 13384
146 Ga0105249_10110038 3300009553 Bacteria 2603
147 Ga0105249_10412863 3300009553 Bacteria 1382
148 Ga0105249_10631445 3300009553 Bacteria 1128
149 Ga0105239_10000019 3300010375 Bacteria 273836
150 Ga0105239_10001405 3300010375 Bacteria 32195
151 Ga0105239_10043095 3300010375 Unclassified 4945
152 Ga0105239_10047892 3300010375 Bacteria 4685
153 Ga0105239_10048779 3300010375 Bacteria 4643
154 Ga0105239_10086497 3300010375 Bacteria 3455
155 Ga0105246_10044999 3300011119 Bacteria 3003
156 Ga0105246_10442471 3300011119 Bacteria 1090
157 Ga0157373_10000115 3300013100 Bacteria 63326
158 Ga0157374_10000011 3300013296 Bacteria 466749
159 Ga0157374_10209207 3300013296 Bacteria 1912
160 Ga0157374_10814220 3300013296 Unclassified 950
161 Ga0157378_10053579 3300013297 Bacteria 3592
162 Ga0157378_10098503 3300013297 Bacteria 2666
163 Ga0157378_10138632 3300013297 Unclassified 2257
164 Ga0163162_10002714 3300013306 Bacteria 16800
165 Ga0163162_10004708 3300013306 Bacteria 13154
166 Ga0163162_10511533 3300013306 Unclassified 1331
167 Ga0163162_10617355 3300013306 Unclassified 1210
168 Ga0157372_10091688 3300013307 Unclassified 3456
169 Ga0157372_10124972 3300013307 Bacteria 2958
170 Ga0157372_10196266 3300013307 Bacteria 2338
171 Ga0157372_10577664 3300013307 Bacteria 1310
172 Ga0157372_10737128 3300013307 Bacteria 1146
173 Ga0157375_10060457 3300013308 Unclassified 3757
174 Ga0157375_10218726 3300013308 Bacteria 2063
175 Ga0163163_10085587 3300014325 Unclassified 3161
176 Ga0157380_10041582 3300014326 Unclassified 3588
177 Ga0157380_10081707 3300014326 Bacteria 2644
178 Ga0157380_10132928 3300014326 Bacteria 2126
179 Ga0157380_10421280 3300014326 Bacteria 1274
180 Ga0157377_10028355 3300014745 Bacteria 3013
181 Ga0157377_10085024 3300014745 Bacteria 1857
182 Ga0157376_10002332 3300014969 Bacteria 12822
183 Ga0157376_10067562 3300014969 Bacteria 3024
184 Ga0163161_10074668 3300017792 Bacteria 2487
185 Ga0163161_10110470 3300017792 Bacteria 2055
186 Ga0163161_10415329 3300017792 Bacteria 1081
187 Ga0213876_10000680 3300021384 Bacteria 24189
188 Ga0209646_1000004 3300025246 Bacteria 786587
189 Ga0209026_1000136 3300025250 Bacteria 116507
190 Ga0209026_1000478 3300025250 Bacteria 30162
191 Ga0209129_1023329 3300025258 Bacteria 1104
192 Ga0207666_1000677 3300025271 Bacteria 4088
193 Ga0207426_1000211 3300025302 Bacteria 137322
194 Ga0207426_1001807 3300025302 Bacteria 15872
195 Ga0207697_10028303 3300025315 Bacteria 2292
196 Ga0207697_10156673 3300025315 Bacteria 992
197 Ga0207656_10093788 3300025321 Bacteria 1366
198 Ga0207656_10130713 3300025321 Bacteria 1176
199 Ga0207682_10057034 3300025893 Bacteria 1627
200 Ga0207642_10068365 3300025899 Bacteria 1681
201 Ga0207688_10014553 3300025901 Bacteria 4274
202 Ga0207680_10000137 3300025903 Bacteria 34668
203 Ga0207680_10080124 3300025903 Unclassified 2050
204 Ga0207645_10002012 3300025907 Bacteria 16324
205 Ga0207643_10025235 3300025908 Bacteria 3284
206 Ga0207705_10127002 3300025909 Unclassified 1896
207 Ga0207654_10006854 3300025911 Bacteria 5734
208 Ga0207654_10011213 3300025911 Bacteria 4567
209 Ga0207654_10067014 3300025911 Unclassified 2119
210 Ga0207695_10000087 3300025913 Bacteria 276412
211 Ga0207695_10000863 3300025913 Bacteria 55452
212 Ga0207695_10001230 3300025913 Bacteria 43841
213 Ga0207695_10001645 3300025913 Bacteria 35984
214 Ga0207695_10067464 3300025913 Unclassified 3670
215 Ga0207671_10000311 3300025914 Bacteria 71753
216 Ga0207671_10000931 3300025914 Bacteria 36651
217 Ga0207671_10022697 3300025914 Bacteria 4741
218 Ga0207671_10036310 3300025914 Unclassified 3655
219 Ga0207671_10263900 3300025914 Bacteria 1356
220 Ga0207662_10016699 3300025918 Bacteria 4145
221 Ga0207657_10338837 3300025919 Bacteria 1187
222 Ga0207681_10027603 3300025923 Bacteria 3672
223 Ga0207681_10074799 3300025923 Bacteria 2374
224 Ga0207650_10026266 3300025925 Bacteria 4152
225 Ga0207650_10041015 3300025925 Bacteria 3389
226 Ga0207650_10044063 3300025925 Bacteria 3278
227 Ga0207659_10238404 3300025926 Bacteria 1470
228 Ga0207687_10587273 3300025927 Unclassified 938
229 Ga0207690_10001089 3300025932 Bacteria 17317
230 Ga0207686_10000764 3300025934 Bacteria 19790
231 Ga0207670_10017672 3300025936 Bacteria 4314
232 Ga0207670_10100696 3300025936 Bacteria 2063
233 Ga0207670_10368404 3300025936 Bacteria 1141
234 Ga0207704_10137966 3300025938 Bacteria 1701
235 Ga0207704_10143669 3300025938 Bacteria 1673
236 Ga0207691_10016625 3300025940 Bacteria 6985
237 Ga0207691_10625167 3300025940 Bacteria 911
238 Ga0207689_10004743 3300025942 Bacteria 12259
239 Ga0207689_10018458 3300025942 Bacteria 5886
240 Ga0207689_10019310 3300025942 Bacteria 5745
241 Ga0207689_10269313 3300025942 Bacteria 1410
242 Ga0207661_10040456 3300025944 Bacteria 3664
243 Ga0207667_10000279 3300025949 Bacteria 70460
244 Ga0207651_10022281 3300025960 Unclassified 3870
245 Ga0207651_10537836 3300025960 Bacteria 1014
246 Ga0207651_10822149 3300025960 Bacteria 824
247 Ga0207712_10013894 3300025961 Bacteria 5164
248 Ga0207712_10116801 3300025961 Bacteria 2011
249 Ga0207640_10029184 3300025981 Bacteria 3383
250 Ga0207658_10010201 3300025986 Bacteria 6383
251 Ga0207658_10014921 3300025986 Bacteria 5325
252 Ga0207658_10038163 3300025986 Bacteria 3458
253 Ga0207677_10463910 3300026023 Bacteria 1088
254 Ga0207703_10005646 3300026035 Bacteria 10045
255 Ga0207639_10015699 3300026041 Bacteria 5342
256 Ga0207639_10035550 3300026041 Bacteria 3687
257 Ga0207639_10513626 3300026041 Unclassified 1096
258 Ga0207639_10563999 3300026041 Bacteria 1047
259 Ga0207708_10204730 3300026075 Bacteria 1575
260 Ga0207708_10274478 3300026075 Unclassified 1364
261 Ga0207702_10025359 3300026078 Bacteria 4920
262 Ga0207641_10000058 3300026088 Bacteria 166385
263 Ga0207641_10009677 3300026088 Bacteria 7940
264 Ga0207641_10235635 3300026088 Unclassified 1703
265 Ga0207648_10003197 3300026089 Bacteria 17252
266 Ga0207648_10199834 3300026089 Bacteria 1773
267 Ga0207648_10266984 3300026089 Bacteria 1528
268 Ga0207676_10004562 3300026095 Bacteria 9810
269 Ga0207676_10053354 3300026095 Bacteria 3164
270 Ga0207676_10104736 3300026095 Bacteria 2354
271 Ga0207675_100055983 3300026118 Unclassified 3679
272 Ga0207675_100338265 3300026118 Unclassified 1473
273 Ga0207683_10001428 3300026121 Bacteria 21608
274 Ga0207683_10047314 3300026121 Bacteria 3767
275 Ga0207698_10003938 3300026142 Bacteria 8990
276 Ga0207698_10020484 3300026142 Bacteria 4554
277 Ga0209968_1040720 3300027526 Bacteria 794
278 Ga0268266_10000068 3300028379 Bacteria 241100
279 Ga0268266_10084742 3300028379 Bacteria 2768
280 Ga0268265_10124617 3300028380 Bacteria 2129
281 Ga0268264_10000079 3300028381 Bacteria 249516
282 Ga0268264_10003074 3300028381 Bacteria 14443
283 Ga0268264_10458182 3300028381 Bacteria 1237
284 Ga0307517_10001481 3300028786 Bacteria 39285
285 Ga0307517_10113112 3300028786 Unclassified 2051
286 Ga0307511_10000201 3300030521 Bacteria 60079
287 Ga0316182_1163057 3300030745 Bacteria 798
288 Ga0265327_10000030 3300031251 Bacteria 333531
289 Ga0307509_10090525 3300031507 Bacteria 3135
290 Ga0307509_10265102 3300031507 Bacteria 1489
291 Ga0307516_10003458 3300031730 Bacteria 20249
292 Ga0307410_10042226 3300031852 Bacteria 3013
293 Ga0307415_100305612 3300032126 Bacteria 1320
294 Ga0307507_10000034 3300033179 Bacteria 188697
295 Ga0307510_10087169 3300033180 Bacteria 2989
296 Ga0373927_0049047 3300035695 Bacteria 2731
297 Ga0373937_0515749 3300036401 Bacteria 1136
298 Ga0451797_0794945 3300041453 Bacteria 940
299 Ga0439449_0004451 3300042007 Bacteria 5406
300 Ga0439449_0056892 3300042007 Bacteria 1444
301 Ga0439449_0155340 3300042007 Bacteria 854
302 Ga0439457_000748 3300042014 Bacteria 9679
303 Ga0439462_0011837 3300042015 Bacteria 2224
304 Ga0439462_0028167 3300042015 Bacteria 1485
305 Ga0466965_0015215 3300044683 Bacteria 3655
306 Ga0466961_0009575 3300044693 Bacteria 6169
307 Ga0466968_0145164 3300044735 Bacteria 1088
308 Ga0466970_0045416 3300044765 Bacteria 2339
309 Ga0466970_0340267 3300044765 Unclassified 850
310 Ga0466957_0043245 3300044842 Bacteria 2728
311 Ga0466960_0002992 3300044901 Bacteria 6445
312 Ga0466959_0080462 3300045049 Bacteria 2348
313 Ga0466958_0026150 3300045836 Bacteria 3448
314 Ga0495638_0077294 3300046460 Bacteria 2027
315 Ga0495583_0078247 3300046506 Bacteria 1441
316 Ga0495648_0003375 3300046524 Bacteria 14060
317 Ga0495598_0147003 3300046537 Bacteria 820
318 Ga0495633_0000116 3300046558 Bacteria 108667
319 Ga0495668_0002655 3300046616 Bacteria 14375
320 Ga0495611_0000026 3300046648 Bacteria 118428
321 Ga0495625_0229515 3300046660 Bacteria 1213
322 Ga0495635_0157080 3300046663 Unclassified 1548
323 Ga0495670_0055992 3300046691 Unclassified 1978
324 Ga0495687_043322 3300047443 Bacteria 1961
325 Ga0495686_0000005 3300047472 Bacteria 827143
326 Ga0501033_0001685 3300049570 Bacteria 19341
327 Ga0501033_0008636 3300049570 Bacteria 7884
328 Ga0501033_0374596 3300049570 Bacteria 995
329 Ga0501034_0078671 3300049571 Bacteria 3301
330 Ga0501034_0110134 3300049571 Bacteria 2745
331 Ga0501034_0119069 3300049571 Unclassified 2627
332 Ga0501034_0646107 3300049571 Bacteria 960
333 Ga0501037_0405840 3300049573 Bacteria 934
334 Ga0501043_0021545 3300049579 Bacteria 5054
335 Ga0501043_0034982 3300049579 Bacteria 3951
336 Ga0501043_0398368 3300049579 Unclassified 1040
337 Ga0501046_0013771 3300049580 Bacteria 6837
338 Ga0501047_0110766 3300049581 Unclassified 2628
339 Ga0501072_0137819 3300049588 Bacteria 1946
340 Ga0501074_0068956 3300049590 Bacteria 2542
341 Ga0501219_000178 3300049703 Bacteria 11731
342 Ga0501225_0008601 3300049705 Bacteria 2925
343 Ga0501080_0294662 3300049742 Bacteria 1472
344 Ga0501083_0029149 3300049744 Bacteria 3799
345 Ga0501241_006845 3300049758 Bacteria 2096
346 Ga0501044_0001506 3300049823 Bacteria 27312
347 Ga0501044_0009390 3300049823 Bacteria 10656
348 Ga0501044_0029803 3300049823 Bacteria 5753
349 Ga0501044_0144898 3300049823 Bacteria 2362
350 Ga0501044_0201861 3300049823 Unclassified 1946
351 Ga0501044_0204390 3300049823 Unclassified 1932
352 Ga0501284_00036 3300050005 Bacteria 57905
353 nmdc:mga0k408_295626_c1 3300050493 Bacteria 966
354 nmdc:mga0k408_44352_c1 3300050493 Bacteria 2564
355 nmdc:mga09592_7231_c1 3300050508 Bacteria 9020
356 nmdc:mga0qj67_44695_c1 3300050509 Bacteria 3492
357 nmdc:mga08y16_190638_c1 3300050511 Bacteria 2126
358 nmdc:mga08y16_831145_c1 3300050511 Bacteria 914
359 Ga0500644_0107820 3300053088 Bacteria 1068
360 Ga0500583_0000076 3300053092 Bacteria 59162
361 Ga0500583_0000662 3300053092 Bacteria 10175
362 Ga0500583_0054041 3300053092 Bacteria 1874
363 Ga0500556_0026985 3300053104 Bacteria 1913
364 Ga0500556_0083918 3300053104 Bacteria 1208
365 Ga0500594_0020266 3300053118 Bacteria 1657
366 Ga0500642_0018750 3300053130 Bacteria 2684
367 Ga0500652_025832 3300053131 Unclassified 2255
368 Ga0500658_0141414 3300053134 Unclassified 1080
369 Ga0500559_0095612 3300053136 Bacteria 1364
370 Ga0500568_0050904 3300053139 Bacteria 1631
371 Ga0500573_0061891 3300053140 Bacteria 2144
372 Ga0500616_0013304 3300053153 Bacteria 4784
373 Ga0500622_0001733 3300053156 Bacteria 16854
374 Ga0500622_0048613 3300053156 Bacteria 2188
375 Ga0500611_000060 3300053727 Bacteria 47744
376 Ga0500645_028407 3300053730 Bacteria 1693
377 Ga0501084_0244924 3300054114 Bacteria 1513
378 Ga0466962_0042543 3300061719 Bacteria 2174
379 2738725626 2738541278 Bacteria 9755573
380 2929159696 2929154850 Bacteria 6753285
381 2929921732 2929921140 Bacteria 8649150
382 8003154279 8003151029 Bacteria 8187759
383 Ga0307515_10000059
384 JGI24744J21845_10012468
385 JGI24751J29686_10019815
386 JGI25154J39366_1000023
387 JGI25157J39369_1017172
388 rootH1_10108546
389 rootH2_10001613
390 rootH2_10001614
391 rootH2_10023604
392 rootH2_10045482
393 rootL2_10008865
394 rootL2_10011803
395 rootL2_10026021
396 rootL2_10129454
397 rootH1_10007189
398 rootH1_10141599
399 rootH1_10161708
400 JGI25160J50197_1000765
401 Ga0065712_10016751
402 Ga0065712_10076530
403 Ga0065715_10130693
404 Ga0070658_10087832
405 Ga0070676_10316934
406 Ga0070683_100002723
407 Ga0070670_100019080
408 Ga0070670_100027025
409 Ga0070670_100497562
410 Ga0068869_100015968
411 Ga0068869_100020539
412 Ga0068869_100058799
413 Ga0068869_100427485
414 Ga0070666_10000072
415 Ga0070666_10019589
416 Ga0070666_10096849
417 Ga0070682_100000019
418 Ga0068868_100031884
419 Ga0068868_100751094
420 Ga0070660_100366946
421 Ga0070689_100178554
422 Ga0070689_100182379
423 Ga0070689_100451335
424 Ga0070669_100001473
425 Ga0070669_100073359
426 Ga0070669_100156634
427 Ga0070669_100216889
428 Ga0070675_100168112
429 Ga0070671_100014066
430 Ga0070674_100026200
431 Ga0070673_100017881
432 Ga0070673_100091330
433 Ga0070673_100296906
434 Ga0070688_100432157
435 Ga0070659_100001406
436 Ga0070667_100005066
437 Ga0070667_100007874
438 Ga0070667_100021229
439 Ga0070667_100064204
440 Ga0070700_100109981
441 Ga0070678_100027845
442 Ga0068867_100068349
443 Ga0068867_100181776
444 Ga0068867_100424682
445 Ga0070685_10009945
446 Ga0070685_10015240
447 Ga0070707_100544870
448 Ga0070698_100008121
449 Ga0070698_100219728
450 Ga0070684_100098957
451 Ga0068853_100101327
452 Ga0068853_100112208
453 Ga0068853_100252424
454 Ga0070672_100050456
455 Ga0070665_100000014
456 Ga0070665_100073080
457 Ga0068855_100010998
458 Ga0068854_100023108
459 Ga0068856_100048679
460 Ga0068852_100005115
461 Ga0068852_100031863
462 Ga0068859_100000006
463 Ga0068859_100285774
464 Ga0068859_100337782
465 Ga0068859_100629552
466 Ga0068864_100023261
467 Ga0068864_100065898
468 Ga0068864_100095234
469 Ga0068861_100220778
470 Ga0068851_10013185
471 Ga0068851_10053118
472 Ga0068870_10082814
473 Ga0068863_100033537
474 Ga0068863_100236855
475 Ga0068858_100004205
476 Ga0068858_100103960
477 Ga0068860_100000061
478 Ga0068860_100001096
479 Ga0068860_100002430
480 Ga0075366_10015481
481 Ga0075366_10319332
482 Ga0097621_100002080
483 Ga0097621_100124415
484 Ga0097621_100128518
485 Ga0097621_100164824
486 Ga0097621_100175087
487 Ga0068871_100011294
488 Ga0068871_100040598
489 Ga0068871_100185708
490 Ga0068871_100529080
491 Ga0075428_100010088
492 Ga0075428_100021474
493 Ga0075428_100259270
494 Ga0075429_100005982
495 Ga0068865_100029896
496 Ga0068865_100042785
497 Ga0068865_100094096
498 Ga0097620_100000006
499 Ga0097620_100285772
500 Ga0097620_100337784
501 Ga0097620_100629559
502 Ga0105240_10000800
503 Ga0105240_10001787
504 Ga0105240_10001808
505 Ga0105240_10004358
506 Ga0105240_10320055
507 Ga0105240_10436249
508 Ga0111539_10179329
509 Ga0105245_10116422
510 Ga0105245_10193788
511 Ga0105245_10717955
512 Ga0105245_10758420
513 Ga0105247_10004545
514 Ga0105241_10002863
515 Ga0105241_10024166
516 Ga0105242_10014250
517 Ga0105242_10033301
518 Ga0105242_10362748
519 Ga0105248_11107997
520 Ga0105237_10005526
521 Ga0105237_10006018
522 Ga0105237_10641995
523 Ga0105237_11034522
524 Ga0105238_10000592
525 Ga0105238_10041703
526 Ga0105249_10003608
527 Ga0105249_10110038
528 Ga0105249_10412863
529 Ga0105249_10631445
530 Ga0105239_10000019
531 Ga0105239_10001405
532 Ga0105239_10043095
533 Ga0105239_10047892
534 Ga0105239_10048779
535 Ga0105239_10086497
536 Ga0105246_10044999
537 Ga0105246_10442471
538 Ga0157373_10000115
539 Ga0157374_10000011
540 Ga0157374_10209207
541 Ga0157374_10814220
542 Ga0157378_10053579
543 Ga0157378_10098503
544 Ga0157378_10138632
545 Ga0163162_10002714
546 Ga0163162_10004708
547 Ga0163162_10511533
548 Ga0163162_10617355
549 Ga0157372_10091688
550 Ga0157372_10124972
551 Ga0157372_10196266
552 Ga0157372_10577664
553 Ga0157372_10737128
554 Ga0157375_10060457
555 Ga0157375_10218726
556 Ga0163163_10085587
557 Ga0157380_10041582
558 Ga0157380_10081707
559 Ga0157380_10132928
560 Ga0157380_10421280
561 Ga0157377_10028355
562 Ga0157377_10085024
563 Ga0157376_10002332
564 Ga0157376_10067562
565 Ga0163161_10074668
566 Ga0163161_10110470
567 Ga0163161_10415329
568 Ga0213876_10000680
569 Ga0209646_1000004
570 Ga0209026_1000136
571 Ga0209026_1000478
572 Ga0209129_1023329
573 Ga0207666_1000677
574 Ga0207426_1000211
575 Ga0207426_1001807
576 Ga0207697_10028303
577 Ga0207697_10156673
578 Ga0207656_10093788
579 Ga0207656_10130713
580 Ga0207682_10057034
581 Ga0207642_10068365
582 Ga0207688_10014553
583 Ga0207680_10000137
584 Ga0207680_10080124
585 Ga0207645_10002012
586 Ga0207643_10025235
587 Ga0207705_10127002
588 Ga0207654_10006854
589 Ga0207654_10011213
590 Ga0207654_10067014
591 Ga0207695_10000087
592 Ga0207695_10000863
593 Ga0207695_10001230
594 Ga0207695_10001645
595 Ga0207695_10067464
596 Ga0207671_10000311
597 Ga0207671_10000931
598 Ga0207671_10022697
599 Ga0207671_10036310
600 Ga0207671_10263900
601 Ga0207662_10016699
602 Ga0207657_10338837
603 Ga0207681_10027603
604 Ga0207681_10074799
605 Ga0207650_10026266
606 Ga0207650_10041015
607 Ga0207650_10044063
608 Ga0207659_10238404
609 Ga0207687_10587273
610 Ga0207690_10001089
611 Ga0207686_10000764
612 Ga0207670_10017672
613 Ga0207670_10100696
614 Ga0207670_10368404
615 Ga0207704_10137966
616 Ga0207704_10143669
617 Ga0207691_10016625
618 Ga0207691_10625167
619 Ga0207689_10004743
620 Ga0207689_10018458
621 Ga0207689_10019310
622 Ga0207689_10269313
623 Ga0207661_10040456
624 Ga0207667_10000279
625 Ga0207651_10022281
626 Ga0207651_10537836
627 Ga0207651_10822149
628 Ga0207712_10013894
629 Ga0207712_10116801
630 Ga0207640_10029184
631 Ga0207658_10010201
632 Ga0207658_10014921
633 Ga0207658_10038163
634 Ga0207677_10463910
635 Ga0207703_10005646
636 Ga0207639_10015699
637 Ga0207639_10035550
638 Ga0207639_10513626
639 Ga0207639_10563999
640 Ga0207708_10204730
641 Ga0207708_10274478
642 Ga0207702_10025359
643 Ga0207641_10000058
644 Ga0207641_10009677
645 Ga0207641_10235635
646 Ga0207648_10003197
647 Ga0207648_10199834
648 Ga0207648_10266984
649 Ga0207676_10004562
650 Ga0207676_10053354
651 Ga0207676_10104736
652 Ga0207675_100055983
653 Ga0207675_100338265
654 Ga0207683_10001428
655 Ga0207683_10047314
656 Ga0207698_10003938
657 Ga0207698_10020484
658 Ga0209968_1040720
659 Ga0268266_10000068
660 Ga0268266_10084742
661 Ga0268265_10124617
662 Ga0268264_10000079
663 Ga0268264_10003074
664 Ga0268264_10458182
665 Ga0307517_10001481
666 Ga0307517_10113112
667 Ga0307511_10000201
668 Ga0316182_1163057
669 Ga0265327_10000030
670 Ga0307509_10090525
671 Ga0307509_10265102
672 Ga0307516_10003458
673 Ga0307410_10042226
674 Ga0307415_100305612
675 Ga0307507_10000034
676 Ga0307510_10087169
677 Ga0373927_0049047
678 Ga0373937_0515749
679 Ga0451797_0794945
680 Ga0439449_0004451
681 Ga0439449_0056892
682 Ga0439449_0155340
683 Ga0439457_000748
684 Ga0439462_0011837
685 Ga0439462_0028167
686 Ga0466965_0015215
687 Ga0466961_0009575
688 Ga0466968_0145164
689 Ga0466970_0045416
690 Ga0466970_0340267
691 Ga0466957_0043245
692 Ga0466960_0002992
693 Ga0466959_0080462
694 Ga0466958_0026150
695 Ga0495638_0077294
696 Ga0495583_0078247
697 Ga0495648_0003375
698 Ga0495598_0147003
699 Ga0495633_0000116
700 Ga0495668_0002655
701 Ga0495611_0000026
702 Ga0495625_0229515
703 Ga0495635_0157080
704 Ga0495670_0055992
705 Ga0495687_043322
706 Ga0495686_0000005
707 Ga0501033_0001685
708 Ga0501033_0008636
709 Ga0501033_0374596
710 Ga0501034_0078671
711 Ga0501034_0110134
712 Ga0501034_0119069
713 Ga0501034_0646107
714 Ga0501037_0405840
715 Ga0501043_0021545
716 Ga0501043_0034982
717 Ga0501043_0398368
718 Ga0501046_0013771
719 Ga0501047_0110766
720 Ga0501072_0137819
721 Ga0501074_0068956
722 Ga0501219_000178
723 Ga0501225_0008601
724 Ga0501080_0294662
725 Ga0501083_0029149
726 Ga0501241_006845
727 Ga0501044_0001506
728 Ga0501044_0009390
729 Ga0501044_0029803
730 Ga0501044_0144898
731 Ga0501044_0201861
732 Ga0501044_0204390
733 Ga0501284_00036
734 nmdc:mga0k408_295626_c1
735 nmdc:mga0k408_44352_c1
736 nmdc:mga09592_7231_c1
737 nmdc:mga0qj67_44695_c1
738 nmdc:mga08y16_190638_c1
739 nmdc:mga08y16_831145_c1
740 Ga0500644_0107820
741 Ga0500583_0000076
742 Ga0500583_0000662
743 Ga0500583_0054041
744 Ga0500556_0026985
745 Ga0500556_0083918
746 Ga0500594_0020266
747 Ga0500642_0018750
748 Ga0500652_025832
749 Ga0500658_0141414
750 Ga0500559_0095612
751 Ga0500568_0050904
752 Ga0500573_0061891
753 Ga0500616_0013304
754 Ga0500622_0001733
755 Ga0500622_0048613
756 Ga0500611_000060
757 Ga0500645_028407
758 Ga0501084_0244924
759 Ga0466962_0042543
760 2738725626
761 2929159696
762 2929921732
763 8003154279

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

33

227

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

39

253

0.91

PF08659

KR

KR domain

34

211

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9583 2 234
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9486 2 236
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9393 2 235
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9368 2 234
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.935 2 234
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9634 2 49 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9586 93 187 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9583 2 234 3.40.50.720
af_Q2FVD5_4_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9387 3 233 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9368 2 234 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q5Y4M5-F1-model_v4 deleted 0.9905 39 238
AF-A0A2S7T0A5-F1-model_v4 Short-chain dehydrogenase 0.9865 2 238 GO:0016020
GO:0016491
AF-A0A364XWP1-F1-model_v4 Short-chain dehydrogenase 0.9862 2 238 GO:0016491
AF-A0A355BVG1-F1-model_v4 Short-chain dehydrogenase 0.986 2 238 GO:0016020
GO:0016491
AF-A0A381RBC3-F1-model_v4 Short-chain dehydrogenase 0.9847 2 238 GO:0016491

Map