F429033

General Info

Members Datasets Scaffolds Average Seq Length
381 226 762 168

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0321277|Ga0466959_0321277_482_1036
Length 184
Sequence MAEPFLSEIRIMSFNFAPKGWALCNGQILPINQNQALFSLLGTRYGGDGRTNFALPDLRGRISLHMGSSGGGNHALGEKGGEVAHTLNISEMAAHTHLVNAIDASPAQGNAGHIPSNTRLLAQSQAIVNGNAQDVQLYVPTNPSKSFAAGSVNPSGGSQPHQNQQPFLALNFCIALQGIFPSQN

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
173 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
176 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
224 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
225 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
226 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 56.43
Metatranscriptomes 42.52
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.71
Nodule 0
Rhizoplane 1.31
Rhizosphere 85.83
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0321277 3300045049 Bacteria 1058
2 JGI25152J39213_1014280 3300002773 Bacteria 1618
3 JGI25150J39212_1000131 3300002774 Bacteria 41933
4 JGI25151J46595_10042062 3300003187 Bacteria 1651
5 JGI25153J46596_10000036 3300003215 Bacteria 182205
6 rootH2_10100040 3300003320 Bacteria 1103
7 Ga0055536_1020423 3300003781 Bacteria 2045
8 Ga0055530_10017057 3300003791 Bacteria 2288
9 Ga0055540_1004778 3300003792 Bacteria 5965
10 Ga0055531_10085024 3300003794 Bacteria 686
11 Ga0055531_10085877 3300003794 Bacteria 680
12 Ga0065712_10139759 3300005290 Bacteria 1461
13 Ga0065715_10091483 3300005293 Bacteria 5759
14 Ga0070683_101160068 3300005329 Bacteria 742
15 Ga0070670_100912032 3300005331 Bacteria 797
16 Ga0070689_101132682 3300005340 Bacteria 700
17 Ga0070691_10201866 3300005341 Bacteria 1045
18 Ga0070669_100160363 3300005353 Bacteria 1747
19 Ga0070688_100859847 3300005365 Bacteria 713
20 Ga0070709_10115568 3300005434 Bacteria 1810
21 Ga0070714_100024782 3300005435 Bacteria 4943
22 Ga0070713_100006501 3300005436 Bacteria 8109
23 Ga0070710_11061498 3300005437 Bacteria 593
24 Ga0070708_100445005 3300005445 Bacteria 1222
25 Ga0070681_10981628 3300005458 Bacteria 764
26 Ga0070707_101292336 3300005468 Unclassified 696
27 Ga0070698_100387645 3300005471 Bacteria 1330
28 Ga0070699_100708047 3300005518 Bacteria 920
29 Ga0070699_100833677 3300005518 Unclassified 844
30 Ga0070695_100000714 3300005545 Bacteria 17670
31 Ga0070695_100080665 3300005545 Bacteria 2151
32 Ga0070696_100617124 3300005546 Bacteria 876
33 Ga0070696_100710119 3300005546 Unclassified 820
34 Ga0070704_100461079 3300005549 Viruses 1096
35 Ga0081539_10002275 3300005985 Bacteria 27826
36 Ga0070717_11102691 3300006028 Bacteria 723
37 Ga0075365_10057146 3300006038 Bacteria 2596
38 Ga0075365_10057467 3300006038 Bacteria 2588
39 Ga0075363_100239336 3300006048 Bacteria 1043
40 Ga0070716_100041784 3300006173 Bacteria 2556
41 Ga0070716_100219288 3300006173 Bacteria 1277
42 Ga0070716_100805425 3300006173 Viruses 728
43 Ga0075367_10230842 3300006178 Bacteria 1159
44 Ga0097621_101144745 3300006237 Viruses 732
45 Ga0075370_10115939 3300006353 Bacteria 1557
46 Ga0068871_100395633 3300006358 Bacteria 1230
47 Ga0075428_100099848 3300006844 Bacteria 3165
48 Ga0075428_100483889 3300006844 Bacteria 1325
49 Ga0105240_10105348 3300009093 Bacteria 3424
50 Ga0105240_11632288 3300009093 Bacteria 674
51 Ga0114129_10037559 3300009147 Bacteria 6837
52 Ga0114129_10263576 3300009147 Bacteria 2308
53 Ga0114129_10264444 3300009147 Bacteria 2304
54 Ga0105237_10232910 3300009545 Bacteria 1842
55 Ga0105237_10316691 3300009545 Bacteria 1563
56 Ga0105238_10005435 3300009551 Bacteria 12587
57 Ga0099796_10112314 3300010159 Bacteria 1038
58 Ga0105239_10070661 3300010375 Unclassified 3835
59 Ga0157373_10000035 3300013100 Bacteria 123284
60 Ga0157370_10001860 3300013104 Bacteria 26021
61 Ga0157370_11479340 3300013104 Bacteria 611
62 Ga0157374_10383455 3300013296 Bacteria 1400
63 Ga0157375_10000200 3300013308 Bacteria 55945
64 Ga0163163_10002086 3300014325 Bacteria 16878
65 Ga0182008_10026412 3300014497 Bacteria 2945
66 Ga0157376_10184961 3300014969 Bacteria 1907
67 Ga0182006_1000863 3300015261 Bacteria 20367
68 Ga0163161_11488118 3300017792 Bacteria 594
69 Ga0213875_10022046 3300021388 Bacteria 3048
70 Ga0207425_1000037 3300025245 Bacteria 224645
71 Ga0209129_1000520 3300025258 Bacteria 27282
72 Ga0209673_1059689 3300025273 Bacteria 959
73 Ga0209676_1009744 3300025292 Bacteria 4103
74 Ga0209025_1000117 3300025294 Bacteria 215073
75 Ga0209758_1000103 3300025297 Bacteria 223968
76 Ga0209050_1000001 3300025298 Bacteria 3563507
77 Ga0209051_1001284 3300025303 Bacteria 22247
78 Ga0209051_1059316 3300025303 Bacteria 1214
79 Ga0209257_1000949 3300025304 Bacteria 40020
80 Ga0209257_1001068 3300025304 Bacteria 36202
81 Ga0207707_10312492 3300025912 Bacteria 1358
82 Ga0207695_10043810 3300025913 Bacteria 4764
83 Ga0207671_10169395 3300025914 Bacteria 1695
84 Ga0207660_10527430 3300025917 Bacteria 959
85 Ga0207652_10222060 3300025921 Bacteria 1703
86 Ga0207681_10148418 3300025923 Bacteria 1754
87 Ga0207700_10000002 3300025928 Bacteria 775978
88 Ga0207664_10458987 3300025929 Bacteria 1138
89 Ga0207665_10126455 3300025939 Bacteria 1810
90 Ga0207676_10034643 3300026095 Bacteria 3824
91 Ga0307408_100761448 3300031548 Bacteria 875
92 Ga0373936_0028327 3300035113 Bacteria 2202
93 Ga0373945_0043606 3300035116 Bacteria 1628
94 Ga0373954_0001190 3300035118 Bacteria 10449
95 Ga0373956_0022673 3300035119 Bacteria 2688
96 Ga0373943_0160604 3300035170 Bacteria 1223
97 Ga0373955_0039934 3300035172 Bacteria 2507
98 Ga0373924_0092038 3300035410 Bacteria 1298
99 Ga0373935_0000108 3300035692 Bacteria 37623
100 Ga0373933_0006176 3300035724 Bacteria 6522
101 Ga0373933_0375266 3300035724 Bacteria 926
102 Ga0373947_0194462 3300035725 Bacteria 1325
103 Ga0373937_0000007 3300036401 Bacteria 183537
104 Ga0316584_0214290 3300036712 Bacteria 1417
105 Ga0373925_0000011 3300037068 Bacteria 209840
106 Ga0395900_0375477 3300037418 Bacteria 1391
107 Ga0395900_0392390 3300037418 Bacteria 1354
108 Ga0395898_0098884 3300037466 Bacteria 2802
109 Ga0436364_0017402 3300037853 Bacteria 3071
110 Ga0436365_1563685 3300039437 Bacteria 582
111 Ga0436360_0873760 3300039438 Viruses 1018
112 Ga0436363_0311674 3300039450 Bacteria 1596
113 Ga0439434_0184133 3300042435 Bacteria 700
114 Ga0466972_0044171 3300044658 Bacteria 2162
115 Ga0466982_0000006 3300044672 Bacteria 333931
116 Ga0466966_0001515 3300044684 Bacteria 14894
117 Ga0466966_0184606 3300044684 Bacteria 1265
118 Ga0466961_0061676 3300044693 Bacteria 2383
119 Ga0466963_0301551 3300044694 Bacteria 1127
120 Ga0466963_0410490 3300044694 Bacteria 955
121 Ga0466964_0006076 3300044706 Bacteria 4499
122 Ga0466971_0017295 3300044719 Bacteria 3188
123 Ga0466968_0044840 3300044735 Bacteria 1874
124 Ga0466970_0139946 3300044765 Bacteria 1332
125 Ga0466957_0201023 3300044842 Bacteria 1309
126 Ga0466957_0651833 3300044842 Bacteria 740
127 Ga0466960_0073110 3300044901 Bacteria 1710
128 Ga0466959_0324212 3300045049 Bacteria 1053
129 Ga0451576_1132900 3300045051 Bacteria 818
130 Ga0495592_0000390 3300046454 Bacteria 34192
131 Ga0495629_0013611 3300046459 Bacteria 5869
132 Ga0495629_0811849 3300046459 Unclassified 617
133 Ga0495638_0001170 3300046460 Bacteria 25207
134 Ga0495638_0016948 3300046460 Bacteria 4870
135 Ga0495651_0002515 3300046462 Bacteria 14197
136 Ga0495653_0000249 3300046463 Bacteria 43160
137 Ga0495650_0030696 3300046471 Bacteria 2430
138 Ga0495580_0312944 3300046472 Viruses 1068
139 Ga0495662_0024332 3300046476 Bacteria 2922
140 Ga0495664_0000024 3300046477 Bacteria 126593
141 Ga0495608_0000004 3300046511 Bacteria 355027
142 Ga0495610_0000224 3300046512 Bacteria 60910
143 Ga0495610_0049442 3300046512 Bacteria 2059
144 Ga0495616_0213130 3300046513 Bacteria 844
145 Ga0495618_0000036 3300046514 Bacteria 101535
146 Ga0495628_0000006 3300046516 Bacteria 306606
147 Ga0495630_0000601 3300046517 Bacteria 26137
148 Ga0495637_0005144 3300046520 Bacteria 6705
149 Ga0495652_0000038 3300046529 Bacteria 129311
150 Ga0495640_0000013 3300046533 Bacteria 172438
151 Ga0495640_0233680 3300046533 Bacteria 1156
152 Ga0495587_0000004 3300046536 Bacteria 358433
153 Ga0495645_0000001 3300046543 Bacteria 657910
154 Ga0495667_0000084 3300046559 Bacteria 67342
155 Ga0495668_0000034 3300046616 Bacteria 254171
156 Ga0495634_0051265 3300046642 Bacteria 2769
157 Ga0495634_0111245 3300046642 Bacteria 1761
158 Ga0495625_0012665 3300046660 Bacteria 6825
159 Ga0495635_0000003 3300046663 Bacteria 390055
160 Ga0495635_0232646 3300046663 Bacteria 1245
161 Ga0495657_0000248 3300046675 Bacteria 49080
162 Ga0495599_0000014 3300046678 Bacteria 177414
163 Ga0495623_0000015 3300046679 Bacteria 117329
164 Ga0495646_0000005 3300046680 Bacteria 266899
165 Ga0495658_0204063 3300046683 Viruses 1233
166 Ga0495613_0047066 3300046689 Bacteria 3186
167 Ga0495624_0169014 3300046690 Bacteria 1334
168 Ga0495600_0599381 3300046809 Bacteria 669
169 Ga0495581_0459833 3300047315 Bacteria 741
170 Ga0495604_0000002 3300047317 Bacteria 530904
171 Ga0495674_0000004 3300047319 Bacteria 531855
172 Ga0495674_0611255 3300047319 Bacteria 863
173 Ga0495672_0015071 3300047320 Bacteria 5261
174 Ga0495680_0000142 3300047322 Bacteria 72324
175 Ga0495680_0101952 3300047322 Bacteria 2138
176 Ga0495680_0199303 3300047322 Unclassified 1437
177 Ga0495675_0000053 3300047444 Bacteria 78760
178 Ga0495684_0000004 3300047471 Bacteria 307093
179 Ga0495686_0465802 3300047472 Bacteria 669
180 Ga0495593_0002002 3300047673 Bacteria 12149
181 Ga0495602_0000001 3300048088 Bacteria 510904
182 Ga0496102_0121121 3300048905 Bacteria 2443
183 Ga0496103_0033317 3300048906 Bacteria 3147
184 Ga0496105_0668066 3300048908 Bacteria 800
185 Ga0496106_0369333 3300048909 Bacteria 1153
186 Ga0496110_0035721 3300048913 Bacteria 4313
187 Ga0496117_0149286 3300048920 Bacteria 1386
188 Ga0496118_0127371 3300048921 Bacteria 1643
189 Ga0496124_0027969 3300048927 Bacteria 5050
190 Ga0501238_000907 3300049671 Bacteria 3381
191 Ga0501238_018489 3300049671 Bacteria 975
192 Ga0501083_0085717 3300049744 Bacteria 2084
193 nmdc:mga00v17_118500_c1 3300050491 Bacteria 1684
194 nmdc:mga0yw44_171489_c1 3300050492 Bacteria 1425
195 nmdc:mga0yw44_190530_c1 3300050492 Bacteria 1352
196 nmdc:mga0yw44_251716_c1 3300050492 Bacteria 1176
197 nmdc:mga0yw44_36217_c1 3300050492 Bacteria 2906
198 nmdc:mga0yw44_44789_c1 3300050492 Bacteria 2649
199 nmdc:mga07m45_131502_c1 3300050496 Bacteria 1448
200 nmdc:mga05p37_213749_c1 3300050507 Bacteria 2330
201 nmdc:mga05p37_80026_c1 3300050507 Bacteria 4024
202 nmdc:mga09592_265297_c1 3300050508 Bacteria 1489
203 nmdc:mga0qj67_23850_c1 3300050509 Bacteria 4711
204 Ga0495601_0000026 3300053077 Bacteria 126257
205 Ga0495601_0172362 3300053077 Bacteria 1414
206 Ga0495612_0000005 3300053078 Bacteria 286943
207 Ga0495595_0000065 3300053084 Bacteria 52635
208 Ga0495619_0000003 3300053085 Bacteria 515784
209 Ga0495619_0512287 3300053085 Bacteria 825
210 Ga0500556_0000479 3300053104 Bacteria 27876
211 Ga0500592_011413 3300053116 Bacteria 1421
212 Ga0500658_0007555 3300053134 Bacteria 4017
213 Ga0500645_001260 3300053730 Bacteria 13310
214 Ga0500645_007295 3300053730 Bacteria 3864
215 Ga0587084_003424 3300059477 Bacteria 1744
216 Ga0587084_011356 3300059477 Bacteria 1185
217 Ga0587084_018494 3300059477 Bacteria 1017
218 Ga0587084_044902 3300059477 Bacteria 764
219 Ga0587093_001140 3300059478 Bacteria 2146
220 Ga0587093_002065 3300059478 Bacteria 1812
221 Ga0587093_005134 3300059478 Bacteria 1369
222 Ga0587093_024915 3300059478 Bacteria 827
223 Ga0587093_037519 3300059478 Bacteria 723
224 Ga0587066_005566 3300059490 Bacteria 1619
225 Ga0587066_019640 3300059490 Bacteria 1101
226 Ga0587066_073182 3300059490 Bacteria 726
227 Ga0587066_096373 3300059490 Bacteria 665
228 Ga0587070_002603 3300059491 Bacteria 2069
229 Ga0587070_003060 3300059491 Bacteria 1968
230 Ga0587070_011013 3300059491 Bacteria 1344
231 Ga0587070_020273 3300059491 Bacteria 1110
232 Ga0587070_021292 3300059491 Bacteria 1094
233 Ga0587073_0006506 3300059492 Bacteria 1801
234 Ga0587073_0007805 3300059492 Bacteria 1708
235 Ga0587073_0141687 3300059492 Bacteria 671
236 Ga0587073_0144771 3300059492 Bacteria 666
237 Ga0587077_005026 3300059493 Bacteria 1781
238 Ga0587077_007018 3300059493 Bacteria 1622
239 Ga0587077_036750 3300059493 Bacteria 963
240 Ga0587077_045347 3300059493 Bacteria 899
241 Ga0587077_154113 3300059493 Bacteria 603
242 Ga0587080_005736 3300059503 Bacteria 1681
243 Ga0587082_000786 3300059504 Bacteria 2935
244 Ga0587082_004259 3300059504 Bacteria 1779
245 Ga0587082_014947 3300059504 Bacteria 1191
246 Ga0587082_061891 3300059504 Bacteria 740
247 Ga0587083_0003740 3300059505 Bacteria 2054
248 Ga0587083_0004813 3300059505 Bacteria 1907
249 Ga0587083_0018737 3300059505 Bacteria 1256
250 Ga0587085_003063 3300059506 Bacteria 1777
251 Ga0587085_003313 3300059506 Bacteria 1738
252 Ga0587085_004964 3300059506 Bacteria 1541
253 Ga0587085_014898 3300059506 Bacteria 1104
254 Ga0587086_002564 3300059507 Bacteria 1734
255 Ga0587086_006220 3300059507 Bacteria 1324
256 Ga0587086_006966 3300059507 Bacteria 1281
257 Ga0587086_011641 3300059507 Bacteria 1082
258 Ga0587086_055594 3300059507 Bacteria 648
259 Ga0587088_007754 3300059508 Bacteria 1497
260 Ga0587088_023452 3300059508 Bacteria 1050
261 Ga0587088_046943 3300059508 Bacteria 833
262 Ga0587089_005463 3300059509 Bacteria 1441
263 Ga0587090_004078 3300059510 Bacteria 1746
264 Ga0587090_005350 3300059510 Bacteria 1605
265 Ga0587090_022792 3300059510 Bacteria 992
266 Ga0587091_002911 3300059511 Bacteria 2096
267 Ga0587091_005158 3300059511 Bacteria 1761
268 Ga0587091_033819 3300059511 Bacteria 974
269 Ga0587091_094536 3300059511 Bacteria 692
270 Ga0587092_001080 3300059512 Bacteria 2533
271 Ga0587092_003474 3300059512 Bacteria 1794
272 Ga0587092_004470 3300059512 Bacteria 1670
273 Ga0587092_037885 3300059512 Bacteria 827
274 Ga0587094_003090 3300059513 Bacteria 1782
275 Ga0587094_004757 3300059513 Bacteria 1557
276 Ga0587094_041735 3300059513 Bacteria 749
277 Ga0587094_061122 3300059513 Bacteria 659
278 Ga0587095_001178 3300059514 Bacteria 1556
279 Ga0587095_001376 3300059514 Bacteria 1485
280 Ga0587095_016112 3300059514 Bacteria 683
281 Ga0587106_004519 3300059605 Bacteria 1535
282 Ga0587106_004889 3300059605 Bacteria 1500
283 Ga0587106_009245 3300059605 Bacteria 1249
284 Ga0587106_102494 3300059605 Bacteria 586
285 Ga0587125_001858 3300059607 Bacteria 1610
286 Ga0587125_004010 3300059607 Bacteria 1286
287 Ga0587125_037468 3300059607 Bacteria 643
288 Ga0587099_019591 3300059622 Bacteria 755
289 Ga0587101_003346 3300059623 Bacteria 1620
290 Ga0587101_019614 3300059623 Bacteria 960
291 Ga0587101_029914 3300059623 Bacteria 843
292 Ga0587101_058728 3300059623 Bacteria 681
293 Ga0587101_084944 3300059623 Bacteria 606
294 Ga0587109_004247 3300059624 Bacteria 1972
295 Ga0587109_008080 3300059624 Bacteria 1612
296 Ga0587109_067349 3300059624 Bacteria 767
297 Ga0587109_116411 3300059624 Bacteria 630
298 Ga0587115_004331 3300059626 Bacteria 1548
299 Ga0587115_026165 3300059626 Bacteria 842
300 Ga0587117_003666 3300059627 Bacteria 1549
301 Ga0587117_018165 3300059627 Bacteria 954
302 Ga0587117_033134 3300059627 Bacteria 789
303 Ga0587127_006431 3300059629 Bacteria 832
304 Ga0587127_014132 3300059629 Bacteria 656
305 Ga0587128_003371 3300059630 Bacteria 1768
306 Ga0587130_003790 3300059631 Bacteria 1294
307 Ga0587062_001339 3300059639 Bacteria 2094
308 Ga0587062_006396 3300059639 Bacteria 1337
309 Ga0587062_053074 3300059639 Bacteria 692
310 Ga0587067_006117 3300059640 Bacteria 1662
311 Ga0587067_011333 3300059640 Bacteria 1371
312 Ga0587067_027295 3300059640 Bacteria 1029
313 Ga0587067_036492 3300059640 Bacteria 935
314 Ga0587068_001766 3300059641 Bacteria 2505
315 Ga0587068_017545 3300059641 Bacteria 1144
316 Ga0587068_057543 3300059641 Bacteria 741
317 Ga0587069_002395 3300059642 Bacteria 1886
318 Ga0587069_003044 3300059642 Bacteria 1773
319 Ga0587069_003248 3300059642 Bacteria 1738
320 Ga0587069_003833 3300059642 Bacteria 1655
321 Ga0587072_009520 3300059643 Bacteria 1554
322 Ga0587072_010202 3300059643 Bacteria 1514
323 Ga0587072_021358 3300059643 Bacteria 1148
324 Ga0587072_092562 3300059643 Bacteria 668
325 Ga0587075_001521 3300059644 Bacteria 2265
326 Ga0587075_002413 3300059644 Bacteria 1970
327 Ga0587075_011083 3300059644 Bacteria 1204
328 Ga0587076_000503 3300059645 Bacteria 3229
329 Ga0587076_002544 3300059645 Bacteria 2056
330 Ga0587076_003537 3300059645 Bacteria 1871
331 Ga0587076_014957 3300059645 Bacteria 1202
332 Ga0587076_040447 3300059645 Bacteria 869
333 Ga0587078_001991 3300059646 Bacteria 1931
334 Ga0587078_002680 3300059646 Bacteria 1740
335 Ga0587078_003386 3300059646 Bacteria 1611
336 Ga0587078_021359 3300059646 Bacteria 820
337 Ga0587078_022066 3300059646 Viruses 811
338 Ga0587079_000900 3300059647 Bacteria 3042
339 Ga0587079_000919 3300059647 Bacteria 3017
340 Ga0587079_001898 3300059647 Bacteria 2449
341 Ga0587079_009881 3300059647 Bacteria 1497
342 Ga0587079_020212 3300059647 Bacteria 1186
343 Ga0587079_044049 3300059647 Bacteria 913
344 Ga0587100_001066 3300059648 Bacteria 1512
345 Ga0587102_001718 3300059649 Bacteria 1591
346 Ga0587102_022955 3300059649 Bacteria 717
347 Ga0587107_001746 3300059652 Bacteria 1830
348 Ga0587107_011160 3300059652 Bacteria 1095
349 Ga0587107_013544 3300059652 Bacteria 1035
350 Ga0587107_023068 3300059652 Bacteria 886
351 Ga0587107_047515 3300059652 Unclassified 716
352 Ga0587108_014919 3300059653 Bacteria 695
353 Ga0587108_015696 3300059653 Bacteria 683
354 Ga0587110_000546 3300059654 Bacteria 2294
355 Ga0587110_001031 3300059654 Bacteria 1899
356 Ga0587110_001847 3300059654 Bacteria 1604
357 Ga0587116_02535 3300059656 Bacteria 968
358 Ga0587116_05136 3300059656 Bacteria 779
359 Ga0587116_06726 3300059656 Bacteria 715
360 Ga0587119_002503 3300059658 Bacteria 1663
361 Ga0587119_002665 3300059658 Bacteria 1634
362 Ga0587071_002763 3300060344 Bacteria 2433
363 Ga0587071_006117 3300060344 Bacteria 1869
364 Ga0587071_015721 3300060344 Bacteria 1331
365 Ga0587071_037085 3300060344 Bacteria 963
366 Ga0587071_040810 3300060344 Bacteria 929
367 Ga0587071_086215 3300060344 Bacteria 707
368 Ga0587111_0001070 3300060346 Bacteria 3088
369 Ga0587111_0003362 3300060346 Bacteria 2265
370 Ga0587111_0006613 3300060346 Bacteria 1847
371 Ga0587111_0008251 3300060346 Bacteria 1721
372 Ga0587111_0021809 3300060346 Bacteria 1239
373 Ga0587111_0050892 3300060346 Bacteria 914
374 Ga0587111_0095982 3300060346 Bacteria 731
375 Ga0587111_0168363 3300060346 Bacteria 601
376 Ga0587111_0215060 3300060346 Unclassified 552
377 Ga0466962_0001003 3300061719 Bacteria 12911
378 2644682437 2643221725 Bacteria 5087956
379 2802651209 2802428842 Bacteria 4926114
380 2884963311 2884960567 Bacteria 5437054
381 2977272622 2977268062 Bacteria 5243061
382 Ga0466959_0321277
383 JGI25152J39213_1014280
384 JGI25150J39212_1000131
385 JGI25151J46595_10042062
386 JGI25153J46596_10000036
387 rootH2_10100040
388 Ga0055536_1020423
389 Ga0055530_10017057
390 Ga0055540_1004778
391 Ga0055531_10085024
392 Ga0055531_10085877
393 Ga0065712_10139759
394 Ga0065715_10091483
395 Ga0070683_101160068
396 Ga0070670_100912032
397 Ga0070689_101132682
398 Ga0070691_10201866
399 Ga0070669_100160363
400 Ga0070688_100859847
401 Ga0070709_10115568
402 Ga0070714_100024782
403 Ga0070713_100006501
404 Ga0070710_11061498
405 Ga0070708_100445005
406 Ga0070681_10981628
407 Ga0070707_101292336
408 Ga0070698_100387645
409 Ga0070699_100708047
410 Ga0070699_100833677
411 Ga0070695_100000714
412 Ga0070695_100080665
413 Ga0070696_100617124
414 Ga0070696_100710119
415 Ga0070704_100461079
416 Ga0081539_10002275
417 Ga0070717_11102691
418 Ga0075365_10057146
419 Ga0075365_10057467
420 Ga0075363_100239336
421 Ga0070716_100041784
422 Ga0070716_100219288
423 Ga0070716_100805425
424 Ga0075367_10230842
425 Ga0097621_101144745
426 Ga0075370_10115939
427 Ga0068871_100395633
428 Ga0075428_100099848
429 Ga0075428_100483889
430 Ga0105240_10105348
431 Ga0105240_11632288
432 Ga0114129_10037559
433 Ga0114129_10263576
434 Ga0114129_10264444
435 Ga0105237_10232910
436 Ga0105237_10316691
437 Ga0105238_10005435
438 Ga0099796_10112314
439 Ga0105239_10070661
440 Ga0157373_10000035
441 Ga0157370_10001860
442 Ga0157370_11479340
443 Ga0157374_10383455
444 Ga0157375_10000200
445 Ga0163163_10002086
446 Ga0182008_10026412
447 Ga0157376_10184961
448 Ga0182006_1000863
449 Ga0163161_11488118
450 Ga0213875_10022046
451 Ga0207425_1000037
452 Ga0209129_1000520
453 Ga0209673_1059689
454 Ga0209676_1009744
455 Ga0209025_1000117
456 Ga0209758_1000103
457 Ga0209050_1000001
458 Ga0209051_1001284
459 Ga0209051_1059316
460 Ga0209257_1000949
461 Ga0209257_1001068
462 Ga0207707_10312492
463 Ga0207695_10043810
464 Ga0207671_10169395
465 Ga0207660_10527430
466 Ga0207652_10222060
467 Ga0207681_10148418
468 Ga0207700_10000002
469 Ga0207664_10458987
470 Ga0207665_10126455
471 Ga0207676_10034643
472 Ga0307408_100761448
473 Ga0373936_0028327
474 Ga0373945_0043606
475 Ga0373954_0001190
476 Ga0373956_0022673
477 Ga0373943_0160604
478 Ga0373955_0039934
479 Ga0373924_0092038
480 Ga0373935_0000108
481 Ga0373933_0006176
482 Ga0373933_0375266
483 Ga0373947_0194462
484 Ga0373937_0000007
485 Ga0316584_0214290
486 Ga0373925_0000011
487 Ga0395900_0375477
488 Ga0395900_0392390
489 Ga0395898_0098884
490 Ga0436364_0017402
491 Ga0436365_1563685
492 Ga0436360_0873760
493 Ga0436363_0311674
494 Ga0439434_0184133
495 Ga0466972_0044171
496 Ga0466982_0000006
497 Ga0466966_0001515
498 Ga0466966_0184606
499 Ga0466961_0061676
500 Ga0466963_0301551
501 Ga0466963_0410490
502 Ga0466964_0006076
503 Ga0466971_0017295
504 Ga0466968_0044840
505 Ga0466970_0139946
506 Ga0466957_0201023
507 Ga0466957_0651833
508 Ga0466960_0073110
509 Ga0466959_0324212
510 Ga0451576_1132900
511 Ga0495592_0000390
512 Ga0495629_0013611
513 Ga0495629_0811849
514 Ga0495638_0001170
515 Ga0495638_0016948
516 Ga0495651_0002515
517 Ga0495653_0000249
518 Ga0495650_0030696
519 Ga0495580_0312944
520 Ga0495662_0024332
521 Ga0495664_0000024
522 Ga0495608_0000004
523 Ga0495610_0000224
524 Ga0495610_0049442
525 Ga0495616_0213130
526 Ga0495618_0000036
527 Ga0495628_0000006
528 Ga0495630_0000601
529 Ga0495637_0005144
530 Ga0495652_0000038
531 Ga0495640_0000013
532 Ga0495640_0233680
533 Ga0495587_0000004
534 Ga0495645_0000001
535 Ga0495667_0000084
536 Ga0495668_0000034
537 Ga0495634_0051265
538 Ga0495634_0111245
539 Ga0495625_0012665
540 Ga0495635_0000003
541 Ga0495635_0232646
542 Ga0495657_0000248
543 Ga0495599_0000014
544 Ga0495623_0000015
545 Ga0495646_0000005
546 Ga0495658_0204063
547 Ga0495613_0047066
548 Ga0495624_0169014
549 Ga0495600_0599381
550 Ga0495581_0459833
551 Ga0495604_0000002
552 Ga0495674_0000004
553 Ga0495674_0611255
554 Ga0495672_0015071
555 Ga0495680_0000142
556 Ga0495680_0101952
557 Ga0495680_0199303
558 Ga0495675_0000053
559 Ga0495684_0000004
560 Ga0495686_0465802
561 Ga0495593_0002002
562 Ga0495602_0000001
563 Ga0496102_0121121
564 Ga0496103_0033317
565 Ga0496105_0668066
566 Ga0496106_0369333
567 Ga0496110_0035721
568 Ga0496117_0149286
569 Ga0496118_0127371
570 Ga0496124_0027969
571 Ga0501238_000907
572 Ga0501238_018489
573 Ga0501083_0085717
574 nmdc:mga00v17_118500_c1
575 nmdc:mga0yw44_171489_c1
576 nmdc:mga0yw44_190530_c1
577 nmdc:mga0yw44_251716_c1
578 nmdc:mga0yw44_36217_c1
579 nmdc:mga0yw44_44789_c1
580 nmdc:mga07m45_131502_c1
581 nmdc:mga05p37_213749_c1
582 nmdc:mga05p37_80026_c1
583 nmdc:mga09592_265297_c1
584 nmdc:mga0qj67_23850_c1
585 Ga0495601_0000026
586 Ga0495601_0172362
587 Ga0495612_0000005
588 Ga0495595_0000065
589 Ga0495619_0000003
590 Ga0495619_0512287
591 Ga0500556_0000479
592 Ga0500592_011413
593 Ga0500658_0007555
594 Ga0500645_001260
595 Ga0500645_007295
596 Ga0587084_003424
597 Ga0587084_011356
598 Ga0587084_018494
599 Ga0587084_044902
600 Ga0587093_001140
601 Ga0587093_002065
602 Ga0587093_005134
603 Ga0587093_024915
604 Ga0587093_037519
605 Ga0587066_005566
606 Ga0587066_019640
607 Ga0587066_073182
608 Ga0587066_096373
609 Ga0587070_002603
610 Ga0587070_003060
611 Ga0587070_011013
612 Ga0587070_020273
613 Ga0587070_021292
614 Ga0587073_0006506
615 Ga0587073_0007805
616 Ga0587073_0141687
617 Ga0587073_0144771
618 Ga0587077_005026
619 Ga0587077_007018
620 Ga0587077_036750
621 Ga0587077_045347
622 Ga0587077_154113
623 Ga0587080_005736
624 Ga0587082_000786
625 Ga0587082_004259
626 Ga0587082_014947
627 Ga0587082_061891
628 Ga0587083_0003740
629 Ga0587083_0004813
630 Ga0587083_0018737
631 Ga0587085_003063
632 Ga0587085_003313
633 Ga0587085_004964
634 Ga0587085_014898
635 Ga0587086_002564
636 Ga0587086_006220
637 Ga0587086_006966
638 Ga0587086_011641
639 Ga0587086_055594
640 Ga0587088_007754
641 Ga0587088_023452
642 Ga0587088_046943
643 Ga0587089_005463
644 Ga0587090_004078
645 Ga0587090_005350
646 Ga0587090_022792
647 Ga0587091_002911
648 Ga0587091_005158
649 Ga0587091_033819
650 Ga0587091_094536
651 Ga0587092_001080
652 Ga0587092_003474
653 Ga0587092_004470
654 Ga0587092_037885
655 Ga0587094_003090
656 Ga0587094_004757
657 Ga0587094_041735
658 Ga0587094_061122
659 Ga0587095_001178
660 Ga0587095_001376
661 Ga0587095_016112
662 Ga0587106_004519
663 Ga0587106_004889
664 Ga0587106_009245
665 Ga0587106_102494
666 Ga0587125_001858
667 Ga0587125_004010
668 Ga0587125_037468
669 Ga0587099_019591
670 Ga0587101_003346
671 Ga0587101_019614
672 Ga0587101_029914
673 Ga0587101_058728
674 Ga0587101_084944
675 Ga0587109_004247
676 Ga0587109_008080
677 Ga0587109_067349
678 Ga0587109_116411
679 Ga0587115_004331
680 Ga0587115_026165
681 Ga0587117_003666
682 Ga0587117_018165
683 Ga0587117_033134
684 Ga0587127_006431
685 Ga0587127_014132
686 Ga0587128_003371
687 Ga0587130_003790
688 Ga0587062_001339
689 Ga0587062_006396
690 Ga0587062_053074
691 Ga0587067_006117
692 Ga0587067_011333
693 Ga0587067_027295
694 Ga0587067_036492
695 Ga0587068_001766
696 Ga0587068_017545
697 Ga0587068_057543
698 Ga0587069_002395
699 Ga0587069_003044
700 Ga0587069_003248
701 Ga0587069_003833
702 Ga0587072_009520
703 Ga0587072_010202
704 Ga0587072_021358
705 Ga0587072_092562
706 Ga0587075_001521
707 Ga0587075_002413
708 Ga0587075_011083
709 Ga0587076_000503
710 Ga0587076_002544
711 Ga0587076_003537
712 Ga0587076_014957
713 Ga0587076_040447
714 Ga0587078_001991
715 Ga0587078_002680
716 Ga0587078_003386
717 Ga0587078_021359
718 Ga0587078_022066
719 Ga0587079_000900
720 Ga0587079_000919
721 Ga0587079_001898
722 Ga0587079_009881
723 Ga0587079_020212
724 Ga0587079_044049
725 Ga0587100_001066
726 Ga0587102_001718
727 Ga0587102_022955
728 Ga0587107_001746
729 Ga0587107_011160
730 Ga0587107_013544
731 Ga0587107_023068
732 Ga0587107_047515
733 Ga0587108_014919
734 Ga0587108_015696
735 Ga0587110_000546
736 Ga0587110_001031
737 Ga0587110_001847
738 Ga0587116_02535
739 Ga0587116_05136
740 Ga0587116_06726
741 Ga0587119_002503
742 Ga0587119_002665
743 Ga0587071_002763
744 Ga0587071_006117
745 Ga0587071_015721
746 Ga0587071_037085
747 Ga0587071_040810
748 Ga0587071_086215
749 Ga0587111_0001070
750 Ga0587111_0003362
751 Ga0587111_0006613
752 Ga0587111_0008251
753 Ga0587111_0021809
754 Ga0587111_0050892
755 Ga0587111_0095982
756 Ga0587111_0168363
757 Ga0587111_0215060
758 Ga0466962_0001003
759 2644682437
760 2802651209
761 2884963311
762 2977272622

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lye-assembly1.cif.gz_A-3 re-refined structure of the bacteriophage t4 short tail fibre pdb entry 1h6w containing 71 additionally identified residues 0.8508 4 57
5iv5-assembly1.cif.gz_O cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex 0.3931 4 163
1pdi-assembly1.cif.gz_A fitting of the c-terminal part of the short tail fibers into the cryo-em reconstruction of t4 baseplate 0.38 4 164
5iv5-assembly1.cif.gz_O cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex 0.3729 4 163
1ocy-assembly1.cif.gz_A structure of the receptor-binding domain of the bacteriophage t4 short tail fibre 0.3666 4 163
ID Description Score Start End Superfamily
1h6wA03 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.8775 8 57 3.90.1340.10
1ocyA01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.8165 4 57 3.90.1340.10
2xgfC01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.7216 1 56 3.90.1340.10
1h6wA03 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.6634 8 57 3.90.1340.10
2xgfC01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.6053 1 56 3.90.1340.10
ID Description Score Start End GO Terms
AF-A0A1T5BT98-F1-model_v4 Phage Tail Collar Domain 0.7195 2 171
AF-A0A7Y2FQZ0-F1-model_v4 Phage tail protein 0.7056 2 171
AF-A0A2M7WPM6-F1-model_v4 Phage tail protein 0.6955 2 171
AF-A0A1T5BT98-F1-model_v4 Phage Tail Collar Domain 0.6932 2 171
AF-A4U469-F1-model_v4 Microcystin dependent protein 0.6708 3 171

Map