F429059

General Info

Members Datasets Scaffolds Average Seq Length
381 227 762 512

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0003717|Ga0495636_0003717_2410_4128
Length 572
Sequence MLNEARAMPRQGENAMSVLSRIRGGHGVRAAALSAAVIVALGACDRIRDLTSADGDAARPETTAPTDFAFAEAGIGDLSARMDRGELSSHALTRAYLDRIAAVDDAGPTLNAVIELNPLALQEADARDAERKAGRIRGPLHGIPVLLKDNIDATPMVNSAGSLALANHKPRRDAFVVARLRAAGAVILGKANLSEWANFRSPHSTSGWSARGGLTRNPYVLDHSACGSSSGTASAIAANLATAGIGTETDGSIICPAAVTGLVGLKPTVGLVSRDGIIPISRSQDTAGPMARSVSDAAYLLAAMVGRDEGDAVTANSVGHAVFDYPLHLKVDGLRGARIGVLRQKMGASQVVDAAMERAIAAMRRAGAVVVDAQIPTDGQWNAGELDVLTWEFKAGLEHYLESHDAPVRTLAELIDFNKRHAGDELSYFGQELFEQADAKTPLSDPVYLDARSTIRRLAGVQGIDAALQAQQLDALIAPATGAAWLADMTNGDPHMGSGSDAAAVAGYPSLSVPMGESRGLPLGIVFMGTAWSEPRLLELAYSFEQATKARKPPRFLATLPALNSPTAKAAK

Samples

Sample ID Description Type Environment
1 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
172 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
221 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
222 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
223 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
224 2643221695 Lysobacter sp. Root494 Isolate Unclassified
225 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
226 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
227 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0
Rhizoplane 3.67
Rhizosphere 91.34
Stem 0
Stem Tuber 0
Unclassified 7.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495636_0003717 3300047318 Bacteria 5937
2 JGI25162J39368_1002955 3300002737 Bacteria 5713
3 JGI25164J39214_1002022 3300002772 Bacteria 3575
4 JGI25165J46597_1001838 3300003214 Bacteria 8835
5 rootH1_10051572 3300003316 Bacteria 4504
6 rootH2_10140398 3300003320 Bacteria 3395
7 rootH1_10004761 3300003323 Bacteria 43462
8 Ga0065715_10000537 3300005293 Bacteria 10762
9 Ga0070658_10000687 3300005327 Bacteria 29282
10 Ga0070690_100012987 3300005330 Bacteria 4912
11 Ga0070670_100005615 3300005331 Bacteria 10585
12 Ga0070670_100006030 3300005331 Bacteria 10247
13 Ga0070670_100023862 3300005331 Bacteria 5263
14 Ga0070670_100087074 3300005331 Unclassified 2684
15 Ga0070677_10000459 3300005333 Bacteria 13964
16 Ga0070677_10018715 3300005333 Bacteria 2499
17 Ga0068869_100001267 3300005334 Bacteria 14942
18 Ga0068869_100003769 3300005334 Bacteria 9332
19 Ga0068869_100059047 3300005334 Unclassified 2807
20 Ga0070666_10033928 3300005335 Bacteria 3381
21 Ga0070680_100007847 3300005336 Bacteria 8138
22 Ga0070680_100116558 3300005336 Unclassified 2227
23 Ga0068868_100036921 3300005338 Bacteria 3785
24 Ga0068868_100046196 3300005338 Bacteria 3409
25 Ga0070660_100013313 3300005339 Bacteria 5895
26 Ga0070689_100137314 3300005340 Bacteria 1964
27 Ga0070687_100001233 3300005343 Bacteria 8875
28 Ga0070661_100034640 3300005344 Bacteria 3662
29 Ga0070668_100108669 3300005347 Bacteria 2206
30 Ga0070668_100126502 3300005347 Unclassified 2047
31 Ga0070669_100027570 3300005353 Bacteria 4088
32 Ga0070669_100058583 3300005353 Bacteria 2827
33 Ga0070675_100061625 3300005354 Bacteria 3098
34 Ga0070675_100123967 3300005354 Unclassified 2197
35 Ga0070671_100053556 3300005355 Bacteria 3354
36 Ga0070671_100091415 3300005355 Bacteria 2549
37 Ga0070674_100064729 3300005356 Unclassified 2563
38 Ga0070673_100009309 3300005364 Bacteria 6591
39 Ga0070673_100069066 3300005364 Bacteria 2831
40 Ga0070688_100005489 3300005365 Bacteria 6684
41 Ga0070659_100061407 3300005366 Bacteria 2970
42 Ga0070667_100001547 3300005367 Bacteria 20612
43 Ga0070667_100001782 3300005367 Bacteria 19178
44 Ga0070713_100001513 3300005436 Bacteria 14808
45 Ga0070701_10017071 3300005438 Bacteria 3388
46 Ga0070705_100010383 3300005440 Bacteria 4660
47 Ga0070663_100036288 3300005455 Bacteria 3425
48 Ga0070678_100129162 3300005456 Bacteria 2005
49 Ga0070662_100035757 3300005457 Bacteria 3510
50 Ga0070662_100073847 3300005457 Bacteria 2521
51 Ga0070681_10005874 3300005458 Bacteria 11884
52 Ga0068867_100023277 3300005459 Bacteria 4434
53 Ga0068867_100087141 3300005459 Bacteria 2363
54 Ga0070685_10006462 3300005466 Bacteria 5979
55 Ga0070685_10008730 3300005466 Bacteria 5218
56 Ga0070706_100037213 3300005467 Bacteria 4494
57 Ga0070707_100044872 3300005468 Bacteria 4232
58 Ga0070707_100077178 3300005468 Bacteria 3214
59 Ga0070698_100065089 3300005471 Bacteria 3671
60 Ga0070699_100055483 3300005518 Bacteria 3430
61 Ga0070679_100010095 3300005530 Bacteria 8949
62 Ga0068853_100040270 3300005539 Bacteria 3986
63 Ga0070672_100026411 3300005543 Unclassified 4320
64 Ga0070672_100096803 3300005543 Bacteria 2388
65 Ga0070695_100058093 3300005545 Bacteria 2501
66 Ga0070665_100062676 3300005548 Bacteria 3728
67 Ga0070665_100121840 3300005548 Bacteria 2609
68 Ga0070665_100167741 3300005548 Unclassified 2197
69 Ga0068855_100000014 3300005563 Bacteria 232720
70 Ga0068855_100001441 3300005563 Bacteria 29631
71 Ga0068855_100211365 3300005563 Unclassified 2180
72 Ga0068857_100036624 3300005577 Unclassified 4347
73 Ga0068854_100037291 3300005578 Bacteria 3411
74 Ga0068856_100025448 3300005614 Bacteria 5772
75 Ga0068856_100061029 3300005614 Bacteria 3724
76 Ga0070702_100035203 3300005615 Unclassified 2765
77 Ga0068852_100001885 3300005616 Bacteria 14286
78 Ga0068859_100075419 3300005617 Bacteria 3413
79 Ga0068864_100001699 3300005618 Bacteria 18094
80 Ga0068864_100002307 3300005618 Bacteria 15784
81 Ga0068864_100024943 3300005618 Bacteria 5031
82 Ga0068864_100025880 3300005618 Bacteria 4944
83 Ga0068864_100107834 3300005618 Bacteria 2478
84 Ga0068866_10005894 3300005718 Bacteria 5090
85 Ga0068870_10043193 3300005840 Bacteria 2350
86 Ga0068863_100006845 3300005841 Bacteria 11176
87 Ga0068863_100025123 3300005841 Bacteria 5681
88 Ga0068858_100043338 3300005842 Bacteria 4172
89 Ga0068858_100053246 3300005842 Bacteria 3744
90 Ga0068858_100070861 3300005842 Bacteria 3232
91 Ga0068860_100020396 3300005843 Bacteria 6420
92 Ga0068860_100066614 3300005843 Bacteria 3421
93 Ga0068862_100021820 3300005844 Bacteria 5354
94 Ga0068862_100120821 3300005844 Bacteria 2309
95 Ga0081540_1001624 3300005983 Bacteria 19159
96 Ga0081539_10030913 3300005985 Bacteria 3312
97 Ga0097621_100058572 3300006237 Bacteria 3151
98 Ga0097621_100185490 3300006237 Bacteria 1799
99 Ga0068871_100048570 3300006358 Bacteria 3426
100 Ga0075428_100069939 3300006844 Bacteria 3837
101 Ga0075428_100071383 3300006844 Bacteria 3795
102 Ga0075430_100011230 3300006846 Bacteria 7596
103 Ga0075431_100145321 3300006847 Bacteria 2444
104 Ga0075433_10000249 3300006852 Bacteria 31205
105 Ga0075433_10010575 3300006852 Bacteria 7417
106 Ga0075433_10019070 3300006852 Bacteria 5706
107 Ga0075433_10034312 3300006852 Bacteria 4357
108 Ga0075434_100000081 3300006871 Bacteria 51958
109 Ga0075434_100007448 3300006871 Bacteria 10125
110 Ga0075434_100089869 3300006871 Bacteria 3072
111 Ga0075429_100001267 3300006880 Bacteria 20553
112 Ga0075429_100021956 3300006880 Bacteria 5534
113 Ga0075429_100026972 3300006880 Bacteria 4988
114 Ga0075429_100030521 3300006880 Bacteria 4683
115 Ga0068865_100028596 3300006881 Bacteria 3692
116 Ga0068865_100082450 3300006881 Bacteria 2312
117 Ga0075436_100021214 3300006914 Bacteria 4457
118 Ga0097620_100075422 3300006931 Bacteria 3413
119 Ga0075435_100000874 3300007076 Bacteria 18896
120 Ga0075435_100034931 3300007076 Bacteria 3987
121 Ga0075435_100055363 3300007076 Bacteria 3203
122 Ga0099794_10011677 3300007265 Bacteria 3768
123 Ga0099794_10016768 3300007265 Bacteria 3253
124 Ga0105240_10039439 3300009093 Bacteria 6049
125 Ga0111539_10023506 3300009094 Bacteria 7573
126 Ga0111539_10025756 3300009094 Bacteria 7204
127 Ga0111539_10076961 3300009094 Bacteria 3928
128 Ga0111539_10107963 3300009094 Bacteria 3266
129 Ga0111539_10151895 3300009094 Bacteria 2710
130 Ga0105245_10003693 3300009098 Bacteria 13660
131 Ga0105245_10013132 3300009098 Bacteria 7217
132 Ga0105245_10082093 3300009098 Bacteria 2948
133 Ga0105247_10019510 3300009101 Bacteria 4071
134 Ga0105247_10022462 3300009101 Unclassified 3800
135 Ga0114129_10000207 3300009147 Bacteria 65630
136 Ga0114129_10000366 3300009147 Bacteria 52352
137 Ga0114129_10022632 3300009147 Bacteria 8914
138 Ga0114129_10023532 3300009147 Bacteria 8731
139 Ga0114129_10043938 3300009147 Bacteria 6286
140 Ga0114129_10182913 3300009147 Bacteria 2851
141 Ga0105243_10040847 3300009148 Bacteria 3625
142 Ga0105241_10073551 3300009174 Bacteria 2659
143 Ga0105241_10073840 3300009174 Unclassified 2655
144 Ga0105242_10052398 3300009176 Unclassified 3329
145 Ga0105242_10127362 3300009176 Bacteria 2193
146 Ga0105248_10001705 3300009177 Bacteria 24457
147 Ga0105248_10002702 3300009177 Bacteria 19705
148 Ga0105248_10255308 3300009177 Unclassified 1973
149 Ga0105237_10008911 3300009545 Bacteria 10812
150 Ga0105237_10010465 3300009545 Bacteria 9863
151 Ga0105237_10075661 3300009545 Unclassified 3358
152 Ga0105238_10001975 3300009551 Bacteria 20659
153 Ga0105238_10043564 3300009551 Bacteria 4541
154 Ga0105249_10007881 3300009553 Bacteria 9279
155 Ga0105249_10031351 3300009553 Bacteria 4808
156 Ga0105239_10021016 3300010375 Bacteria 7203
157 Ga0105239_10273512 3300010375 Bacteria 1900
158 Ga0105246_10129761 3300011119 Bacteria 1881
159 Ga0157373_10000045 3300013100 Bacteria 112207
160 Ga0157373_10005334 3300013100 Bacteria 9659
161 Ga0157371_10001039 3300013102 Bacteria 30425
162 Ga0157369_10000125 3300013105 Bacteria 110481
163 Ga0157369_10081638 3300013105 Unclassified 3460
164 Ga0157374_10006184 3300013296 Bacteria 10146
165 Ga0157374_10083331 3300013296 Bacteria 3038
166 Ga0157374_10120149 3300013296 Unclassified 2535
167 Ga0157378_10001109 3300013297 Bacteria 24517
168 Ga0157378_10167061 3300013297 Bacteria 2061
169 Ga0157378_10196825 3300013297 Unclassified 1904
170 Ga0163162_10009071 3300013306 Bacteria 9671
171 Ga0163162_10078951 3300013306 Bacteria 3357
172 Ga0163162_10144831 3300013306 Unclassified 2491
173 Ga0163162_10217537 3300013306 Bacteria 2040
174 Ga0157372_10001766 3300013307 Bacteria 23447
175 Ga0157372_10046546 3300013307 Bacteria 4816
176 Ga0157372_10185485 3300013307 Bacteria 2409
177 Ga0157375_10021319 3300013308 Bacteria 5938
178 Ga0157375_10077242 3300013308 Bacteria 3359
179 Ga0157375_10082472 3300013308 Bacteria 3257
180 Ga0163163_10025948 3300014325 Bacteria 5593
181 Ga0163163_10030866 3300014325 Bacteria 5168
182 Ga0163163_10059204 3300014325 Bacteria 3788
183 Ga0157380_10005334 3300014326 Bacteria 8981
184 Ga0157380_10027635 3300014326 Bacteria 4316
185 Ga0157380_10033604 3300014326 Bacteria 3951
186 Ga0157377_10021236 3300014745 Bacteria 3414
187 Ga0157376_10001295 3300014969 Bacteria 16479
188 Ga0157376_10004409 3300014969 Bacteria 9797
189 Ga0157376_10180046 3300014969 Bacteria 1931
190 Ga0163161_10046524 3300017792 Unclassified 3131
191 Ga0209563_101367 3300025230 Bacteria 6590
192 Ga0207427_100110 3300025231 Bacteria 113735
193 Ga0209437_100093 3300025233 Bacteria 239733
194 Ga0209233_1000089 3300025261 Bacteria 316381
195 Ga0209025_1011493 3300025294 Bacteria 5822
196 Ga0207682_10000652 3300025893 Bacteria 16202
197 Ga0207682_10004596 3300025893 Bacteria 5749
198 Ga0207680_10011398 3300025903 Bacteria 4492
199 Ga0207680_10055643 3300025903 Bacteria 2385
200 Ga0207647_10025276 3300025904 Bacteria 3905
201 Ga0207645_10000844 3300025907 Bacteria 25580
202 Ga0207645_10038142 3300025907 Bacteria 3082
203 Ga0207645_10040732 3300025907 Bacteria 2975
204 Ga0207643_10000011 3300025908 Bacteria 150819
205 Ga0207643_10057450 3300025908 Bacteria 2215
206 Ga0207705_10005657 3300025909 Bacteria 9330
207 Ga0207654_10006665 3300025911 Bacteria 5813
208 Ga0207654_10021224 3300025911 Bacteria 3451
209 Ga0207707_10003579 3300025912 Bacteria 13773
210 Ga0207695_10007681 3300025913 Bacteria 13658
211 Ga0207695_10120712 3300025913 Bacteria 2589
212 Ga0207671_10002946 3300025914 Bacteria 17539
213 Ga0207671_10026310 3300025914 Bacteria 4363
214 Ga0207662_10001385 3300025918 Bacteria 11717
215 Ga0207657_10001071 3300025919 Bacteria 28958
216 Ga0207649_10044731 3300025920 Unclassified 2712
217 Ga0207652_10011141 3300025921 Bacteria 7247
218 Ga0207646_10038695 3300025922 Bacteria 4294
219 Ga0207646_10080325 3300025922 Bacteria 2916
220 Ga0207681_10022117 3300025923 Bacteria 4050
221 Ga0207650_10000491 3300025925 Bacteria 32900
222 Ga0207650_10003405 3300025925 Bacteria 10938
223 Ga0207650_10006450 3300025925 Bacteria 7991
224 Ga0207659_10000259 3300025926 Bacteria 32458
225 Ga0207706_10001046 3300025933 Bacteria 28083
226 Ga0207709_10023983 3300025935 Unclassified 3479
227 Ga0207670_10024021 3300025936 Unclassified 3804
228 Ga0207691_10001163 3300025940 Bacteria 26132
229 Ga0207691_10016926 3300025940 Bacteria 6917
230 Ga0207691_10080031 3300025940 Bacteria 2940
231 Ga0207711_10011099 3300025941 Bacteria 7489
232 Ga0207711_10011656 3300025941 Bacteria 7304
233 Ga0207711_10028576 3300025941 Bacteria 4694
234 Ga0207689_10000118 3300025942 Bacteria 65374
235 Ga0207689_10001567 3300025942 Bacteria 21687
236 Ga0207689_10035500 3300025942 Bacteria 4142
237 Ga0207667_10000049 3300025949 Bacteria 235027
238 Ga0207667_10040857 3300025949 Bacteria 4936
239 Ga0207651_10000941 3300025960 Bacteria 12816
240 Ga0207651_10029833 3300025960 Bacteria 3463
241 Ga0207712_10002194 3300025961 Bacteria 12717
242 Ga0207712_10009556 3300025961 Bacteria 6138
243 Ga0207712_10089324 3300025961 Bacteria 2265
244 Ga0207668_10006253 3300025972 Bacteria 7034
245 Ga0207640_10126850 3300025981 Unclassified 1838
246 Ga0207658_10005622 3300025986 Bacteria 8576
247 Ga0207658_10015756 3300025986 Bacteria 5190
248 Ga0207677_10001150 3300026023 Bacteria 14444
249 Ga0207677_10034362 3300026023 Bacteria 3282
250 Ga0207677_10107732 3300026023 Bacteria 2067
251 Ga0207703_10000837 3300026035 Bacteria 30296
252 Ga0207703_10003483 3300026035 Bacteria 13173
253 Ga0207639_10034431 3300026041 Bacteria 3743
254 Ga0207678_10009263 3300026067 Bacteria 8665
255 Ga0207708_10007499 3300026075 Bacteria 8063
256 Ga0207708_10020180 3300026075 Bacteria 5025
257 Ga0207708_10026367 3300026075 Unclassified 4397
258 Ga0207702_10041849 3300026078 Bacteria 3842
259 Ga0207641_10092030 3300026088 Bacteria 2655
260 Ga0207648_10001281 3300026089 Bacteria 28081
261 Ga0207648_10003761 3300026089 Bacteria 15854
262 Ga0207676_10003003 3300026095 Bacteria 12029
263 Ga0207676_10024124 3300026095 Bacteria 4498
264 Ga0207676_10113910 3300026095 Bacteria 2268
265 Ga0207674_10000738 3300026116 Bacteria 42793
266 Ga0207675_100000004 3300026118 Bacteria 210328
267 Ga0207675_100000975 3300026118 Bacteria 28412
268 Ga0207683_10026245 3300026121 Bacteria 5028
269 Ga0207683_10054307 3300026121 Bacteria 3513
270 Ga0207683_10092650 3300026121 Bacteria 2692
271 Ga0207698_10037440 3300026142 Bacteria 3573
272 Ga0209999_1003337 3300027543 Bacteria 2865
273 Ga0209971_1008936 3300027682 Bacteria 2377
274 Ga0209974_10003481 3300027876 Bacteria 5675
275 Ga0207428_10000035 3300027907 Bacteria 229100
276 Ga0207428_10004046 3300027907 Bacteria 14058
277 Ga0268266_10024075 3300028379 Bacteria 5182
278 Ga0268266_10070371 3300028379 Bacteria 3031
279 Ga0268265_10049064 3300028380 Bacteria 3173
280 Ga0268265_10096761 3300028380 Bacteria 2373
281 Ga0268264_10000740 3300028381 Bacteria 37012
282 Ga0268264_10079194 3300028381 Bacteria 2803
283 Ga0265337_1003139 3300028556 Bacteria 7278
284 Ga0307517_10015866 3300028786 Bacteria 9960
285 Ga0307515_10027866 3300028794 Bacteria 9631
286 Ga0307513_10010407 3300031456 Bacteria 11662
287 Ga0316576_10017214 3300031727 Bacteria 4905
288 Ga0307407_10006002 3300031903 Bacteria 5346
289 Ga0307414_10023477 3300032004 Bacteria 3913
290 Ga0307414_10043808 3300032004 Bacteria 3051
291 Ga0307411_10021021 3300032005 Bacteria 3808
292 Ga0373939_0004376 3300035114 Bacteria 3337
293 Ga0395900_0029218 3300037418 Bacteria 5654
294 Ga0395900_0126956 3300037418 Unclassified 2616
295 Ga0395905_0003623 3300037471 Bacteria 16409
296 Ga0395905_0010763 3300037471 Bacteria 8868
297 Ga0395901_0016608 3300038443 Bacteria 7501
298 Ga0439436_0012562 3300041404 Bacteria 2569
299 Ga0439439_0002764 3300041406 Bacteria 3780
300 Ga0439465_0010439 3300041413 Bacteria 2917
301 Ga0439462_0005941 3300042015 Bacteria 3023
302 Ga0453683_0000105 3300044673 Bacteria 124993
303 Ga0453683_0002438 3300044673 Bacteria 14409
304 Ga0451576_0002752 3300045051 Bacteria 25492
305 Ga0451576_0006968 3300045051 Bacteria 13680
306 Ga0451576_0035935 3300045051 Bacteria 5254
307 Ga0451576_0059510 3300045051 Unclassified 3987
308 Ga0451576_0067026 3300045051 Bacteria 3736
309 Ga0495592_0006376 3300046454 Bacteria 8789
310 Ga0495651_0045471 3300046462 Bacteria 3401
311 Ga0495650_0000127 3300046471 Bacteria 177276
312 Ga0495585_0000088 3300046492 Bacteria 96490
313 Ga0495606_0000033 3300046507 Bacteria 247739
314 Ga0495606_0030043 3300046507 Bacteria 3803
315 Ga0495648_0004419 3300046524 Bacteria 12013
316 Ga0495663_0004853 3300046525 Bacteria 3758
317 Ga0495587_0029806 3300046536 Bacteria 3311
318 Ga0495634_0020079 3300046642 Bacteria 4739
319 Ga0495599_0012471 3300046678 Bacteria 5240
320 Ga0495649_0034545 3300046694 Bacteria 2782
321 Ga0495600_0028038 3300046809 Bacteria 3642
322 Ga0495636_0005627 3300047318 Bacteria 4914
323 Ga0495636_0019716 3300047318 Bacteria 2713
324 Ga0495683_0050503 3300047323 Bacteria 2081
325 Ga0495684_0031989 3300047471 Bacteria 4038
326 Ga0496102_0058503 3300048905 Bacteria 3522
327 Ga0496104_0000384 3300048907 Bacteria 38678
328 Ga0496104_0006875 3300048907 Bacteria 10030
329 Ga0496105_0022046 3300048908 Bacteria 5157
330 Ga0496108_0024739 3300048911 Bacteria 4945
331 Ga0496108_0154614 3300048911 Bacteria 1980
332 Ga0496109_0002892 3300048912 Bacteria 14363
333 Ga0496110_0013933 3300048913 Bacteria 6661
334 Ga0496110_0035291 3300048913 Bacteria 4338
335 Ga0496111_0026467 3300048914 Bacteria 4097
336 Ga0496112_0075247 3300048915 Bacteria 3339
337 Ga0496113_0006900 3300048916 Bacteria 7248
338 Ga0496113_0007479 3300048916 Bacteria 7035
339 Ga0496114_0170933 3300048917 Bacteria 1894
340 Ga0501034_0129422 3300049571 Bacteria 2508
341 Ga0501040_0122811 3300049576 Bacteria 1823
342 Ga0501047_0173203 3300049581 Bacteria 2027
343 Ga0501071_0130029 3300049587 Bacteria 1870
344 Ga0501076_0257490 3300049592 Bacteria 1428
345 Ga0501081_0057997 3300049743 Bacteria 2678
346 Ga0501266_003270 3300049763 Bacteria 2016
347 Ga0501035_0142215 3300049822 Bacteria 2085
348 Ga0501044_0058683 3300049823 Bacteria 3945
349 nmdc:mga00v17_10550_c1 3300050491 Bacteria 5048
350 nmdc:mga05p37_125099_c1 3300050507 Bacteria 3157
351 nmdc:mga05p37_34658_c1 3300050507 Bacteria 6184
352 nmdc:mga05p37_62039_c1 3300050507 Bacteria 4601
353 nmdc:mga05p37_64774_c1 3300050507 Bacteria 4497
354 nmdc:mga09592_17922_c1 3300050508 Bacteria 5801
355 nmdc:mga09592_22951_c1 3300050508 Bacteria 5149
356 nmdc:mga09592_6744_c1 3300050508 Bacteria 9342
357 nmdc:mga06r32_103024_c1 3300050510 Bacteria 2802
358 nmdc:mga06r32_138979_c1 3300050510 Bacteria 2405
359 nmdc:mga06r32_57661_c1 3300050510 Bacteria 3731
360 nmdc:mga08y16_113997_c1 3300050511 Bacteria 2814
361 nmdc:mga08y16_13462_c1 3300050511 Bacteria 8607
362 nmdc:mga08y16_29168_c1 3300050511 Bacteria 5815
363 nmdc:mga08y16_62541_c1 3300050511 Bacteria 3888
364 nmdc:mga0n895_104515_c1 3300050512 Bacteria 2845
365 nmdc:mga0n895_48728_c1 3300050512 Bacteria 4149
366 nmdc:mga0n895_64520_c1 3300050512 Bacteria 3623
367 nmdc:mga0rr50_22398_c1 3300050513 Bacteria 4336
368 nmdc:mga0rr50_644_c1 3300050513 Bacteria 18763
369 nmdc:mga0rr50_7048_c1 3300050513 Bacteria 6899
370 nmdc:mga0a205_382_c1 3300050515 Bacteria 33629
371 nmdc:mga0a205_85705_c1 3300050515 Bacteria 3042
372 Ga0495601_0102355 3300053077 Unclassified 1851
373 Ga0500616_0000226 3300053153 Bacteria 88101
374 2522548391 2522125168 Bacteria 7376607
375 2572256442 2571042365 Bacteria 3289345
376 2587749543 2585428060 Bacteria 5304711
377 2588446491 2588253712 Bacteria 5403181
378 2644530890 2643221695 Bacteria 3441323
379 2729198631 2728369107 Bacteria 5082720
380 2740057642 2739367874 Bacteria 4872888
381 2906000765 2905999023 Bacteria 4591259
382 Ga0495636_0003717
383 JGI25162J39368_1002955
384 JGI25164J39214_1002022
385 JGI25165J46597_1001838
386 rootH1_10051572
387 rootH2_10140398
388 rootH1_10004761
389 Ga0065715_10000537
390 Ga0070658_10000687
391 Ga0070690_100012987
392 Ga0070670_100005615
393 Ga0070670_100006030
394 Ga0070670_100023862
395 Ga0070670_100087074
396 Ga0070677_10000459
397 Ga0070677_10018715
398 Ga0068869_100001267
399 Ga0068869_100003769
400 Ga0068869_100059047
401 Ga0070666_10033928
402 Ga0070680_100007847
403 Ga0070680_100116558
404 Ga0068868_100036921
405 Ga0068868_100046196
406 Ga0070660_100013313
407 Ga0070689_100137314
408 Ga0070687_100001233
409 Ga0070661_100034640
410 Ga0070668_100108669
411 Ga0070668_100126502
412 Ga0070669_100027570
413 Ga0070669_100058583
414 Ga0070675_100061625
415 Ga0070675_100123967
416 Ga0070671_100053556
417 Ga0070671_100091415
418 Ga0070674_100064729
419 Ga0070673_100009309
420 Ga0070673_100069066
421 Ga0070688_100005489
422 Ga0070659_100061407
423 Ga0070667_100001547
424 Ga0070667_100001782
425 Ga0070713_100001513
426 Ga0070701_10017071
427 Ga0070705_100010383
428 Ga0070663_100036288
429 Ga0070678_100129162
430 Ga0070662_100035757
431 Ga0070662_100073847
432 Ga0070681_10005874
433 Ga0068867_100023277
434 Ga0068867_100087141
435 Ga0070685_10006462
436 Ga0070685_10008730
437 Ga0070706_100037213
438 Ga0070707_100044872
439 Ga0070707_100077178
440 Ga0070698_100065089
441 Ga0070699_100055483
442 Ga0070679_100010095
443 Ga0068853_100040270
444 Ga0070672_100026411
445 Ga0070672_100096803
446 Ga0070695_100058093
447 Ga0070665_100062676
448 Ga0070665_100121840
449 Ga0070665_100167741
450 Ga0068855_100000014
451 Ga0068855_100001441
452 Ga0068855_100211365
453 Ga0068857_100036624
454 Ga0068854_100037291
455 Ga0068856_100025448
456 Ga0068856_100061029
457 Ga0070702_100035203
458 Ga0068852_100001885
459 Ga0068859_100075419
460 Ga0068864_100001699
461 Ga0068864_100002307
462 Ga0068864_100024943
463 Ga0068864_100025880
464 Ga0068864_100107834
465 Ga0068866_10005894
466 Ga0068870_10043193
467 Ga0068863_100006845
468 Ga0068863_100025123
469 Ga0068858_100043338
470 Ga0068858_100053246
471 Ga0068858_100070861
472 Ga0068860_100020396
473 Ga0068860_100066614
474 Ga0068862_100021820
475 Ga0068862_100120821
476 Ga0081540_1001624
477 Ga0081539_10030913
478 Ga0097621_100058572
479 Ga0097621_100185490
480 Ga0068871_100048570
481 Ga0075428_100069939
482 Ga0075428_100071383
483 Ga0075430_100011230
484 Ga0075431_100145321
485 Ga0075433_10000249
486 Ga0075433_10010575
487 Ga0075433_10019070
488 Ga0075433_10034312
489 Ga0075434_100000081
490 Ga0075434_100007448
491 Ga0075434_100089869
492 Ga0075429_100001267
493 Ga0075429_100021956
494 Ga0075429_100026972
495 Ga0075429_100030521
496 Ga0068865_100028596
497 Ga0068865_100082450
498 Ga0075436_100021214
499 Ga0097620_100075422
500 Ga0075435_100000874
501 Ga0075435_100034931
502 Ga0075435_100055363
503 Ga0099794_10011677
504 Ga0099794_10016768
505 Ga0105240_10039439
506 Ga0111539_10023506
507 Ga0111539_10025756
508 Ga0111539_10076961
509 Ga0111539_10107963
510 Ga0111539_10151895
511 Ga0105245_10003693
512 Ga0105245_10013132
513 Ga0105245_10082093
514 Ga0105247_10019510
515 Ga0105247_10022462
516 Ga0114129_10000207
517 Ga0114129_10000366
518 Ga0114129_10022632
519 Ga0114129_10023532
520 Ga0114129_10043938
521 Ga0114129_10182913
522 Ga0105243_10040847
523 Ga0105241_10073551
524 Ga0105241_10073840
525 Ga0105242_10052398
526 Ga0105242_10127362
527 Ga0105248_10001705
528 Ga0105248_10002702
529 Ga0105248_10255308
530 Ga0105237_10008911
531 Ga0105237_10010465
532 Ga0105237_10075661
533 Ga0105238_10001975
534 Ga0105238_10043564
535 Ga0105249_10007881
536 Ga0105249_10031351
537 Ga0105239_10021016
538 Ga0105239_10273512
539 Ga0105246_10129761
540 Ga0157373_10000045
541 Ga0157373_10005334
542 Ga0157371_10001039
543 Ga0157369_10000125
544 Ga0157369_10081638
545 Ga0157374_10006184
546 Ga0157374_10083331
547 Ga0157374_10120149
548 Ga0157378_10001109
549 Ga0157378_10167061
550 Ga0157378_10196825
551 Ga0163162_10009071
552 Ga0163162_10078951
553 Ga0163162_10144831
554 Ga0163162_10217537
555 Ga0157372_10001766
556 Ga0157372_10046546
557 Ga0157372_10185485
558 Ga0157375_10021319
559 Ga0157375_10077242
560 Ga0157375_10082472
561 Ga0163163_10025948
562 Ga0163163_10030866
563 Ga0163163_10059204
564 Ga0157380_10005334
565 Ga0157380_10027635
566 Ga0157380_10033604
567 Ga0157377_10021236
568 Ga0157376_10001295
569 Ga0157376_10004409
570 Ga0157376_10180046
571 Ga0163161_10046524
572 Ga0209563_101367
573 Ga0207427_100110
574 Ga0209437_100093
575 Ga0209233_1000089
576 Ga0209025_1011493
577 Ga0207682_10000652
578 Ga0207682_10004596
579 Ga0207680_10011398
580 Ga0207680_10055643
581 Ga0207647_10025276
582 Ga0207645_10000844
583 Ga0207645_10038142
584 Ga0207645_10040732
585 Ga0207643_10000011
586 Ga0207643_10057450
587 Ga0207705_10005657
588 Ga0207654_10006665
589 Ga0207654_10021224
590 Ga0207707_10003579
591 Ga0207695_10007681
592 Ga0207695_10120712
593 Ga0207671_10002946
594 Ga0207671_10026310
595 Ga0207662_10001385
596 Ga0207657_10001071
597 Ga0207649_10044731
598 Ga0207652_10011141
599 Ga0207646_10038695
600 Ga0207646_10080325
601 Ga0207681_10022117
602 Ga0207650_10000491
603 Ga0207650_10003405
604 Ga0207650_10006450
605 Ga0207659_10000259
606 Ga0207706_10001046
607 Ga0207709_10023983
608 Ga0207670_10024021
609 Ga0207691_10001163
610 Ga0207691_10016926
611 Ga0207691_10080031
612 Ga0207711_10011099
613 Ga0207711_10011656
614 Ga0207711_10028576
615 Ga0207689_10000118
616 Ga0207689_10001567
617 Ga0207689_10035500
618 Ga0207667_10000049
619 Ga0207667_10040857
620 Ga0207651_10000941
621 Ga0207651_10029833
622 Ga0207712_10002194
623 Ga0207712_10009556
624 Ga0207712_10089324
625 Ga0207668_10006253
626 Ga0207640_10126850
627 Ga0207658_10005622
628 Ga0207658_10015756
629 Ga0207677_10001150
630 Ga0207677_10034362
631 Ga0207677_10107732
632 Ga0207703_10000837
633 Ga0207703_10003483
634 Ga0207639_10034431
635 Ga0207678_10009263
636 Ga0207708_10007499
637 Ga0207708_10020180
638 Ga0207708_10026367
639 Ga0207702_10041849
640 Ga0207641_10092030
641 Ga0207648_10001281
642 Ga0207648_10003761
643 Ga0207676_10003003
644 Ga0207676_10024124
645 Ga0207676_10113910
646 Ga0207674_10000738
647 Ga0207675_100000004
648 Ga0207675_100000975
649 Ga0207683_10026245
650 Ga0207683_10054307
651 Ga0207683_10092650
652 Ga0207698_10037440
653 Ga0209999_1003337
654 Ga0209971_1008936
655 Ga0209974_10003481
656 Ga0207428_10000035
657 Ga0207428_10004046
658 Ga0268266_10024075
659 Ga0268266_10070371
660 Ga0268265_10049064
661 Ga0268265_10096761
662 Ga0268264_10000740
663 Ga0268264_10079194
664 Ga0265337_1003139
665 Ga0307517_10015866
666 Ga0307515_10027866
667 Ga0307513_10010407
668 Ga0316576_10017214
669 Ga0307407_10006002
670 Ga0307414_10023477
671 Ga0307414_10043808
672 Ga0307411_10021021
673 Ga0373939_0004376
674 Ga0395900_0029218
675 Ga0395900_0126956
676 Ga0395905_0003623
677 Ga0395905_0010763
678 Ga0395901_0016608
679 Ga0439436_0012562
680 Ga0439439_0002764
681 Ga0439465_0010439
682 Ga0439462_0005941
683 Ga0453683_0000105
684 Ga0453683_0002438
685 Ga0451576_0002752
686 Ga0451576_0006968
687 Ga0451576_0035935
688 Ga0451576_0059510
689 Ga0451576_0067026
690 Ga0495592_0006376
691 Ga0495651_0045471
692 Ga0495650_0000127
693 Ga0495585_0000088
694 Ga0495606_0000033
695 Ga0495606_0030043
696 Ga0495648_0004419
697 Ga0495663_0004853
698 Ga0495587_0029806
699 Ga0495634_0020079
700 Ga0495599_0012471
701 Ga0495649_0034545
702 Ga0495600_0028038
703 Ga0495636_0005627
704 Ga0495636_0019716
705 Ga0495683_0050503
706 Ga0495684_0031989
707 Ga0496102_0058503
708 Ga0496104_0000384
709 Ga0496104_0006875
710 Ga0496105_0022046
711 Ga0496108_0024739
712 Ga0496108_0154614
713 Ga0496109_0002892
714 Ga0496110_0013933
715 Ga0496110_0035291
716 Ga0496111_0026467
717 Ga0496112_0075247
718 Ga0496113_0006900
719 Ga0496113_0007479
720 Ga0496114_0170933
721 Ga0501034_0129422
722 Ga0501040_0122811
723 Ga0501047_0173203
724 Ga0501071_0130029
725 Ga0501076_0257490
726 Ga0501081_0057997
727 Ga0501266_003270
728 Ga0501035_0142215
729 Ga0501044_0058683
730 nmdc:mga00v17_10550_c1
731 nmdc:mga05p37_125099_c1
732 nmdc:mga05p37_34658_c1
733 nmdc:mga05p37_62039_c1
734 nmdc:mga05p37_64774_c1
735 nmdc:mga09592_17922_c1
736 nmdc:mga09592_22951_c1
737 nmdc:mga09592_6744_c1
738 nmdc:mga06r32_103024_c1
739 nmdc:mga06r32_138979_c1
740 nmdc:mga06r32_57661_c1
741 nmdc:mga08y16_113997_c1
742 nmdc:mga08y16_13462_c1
743 nmdc:mga08y16_29168_c1
744 nmdc:mga08y16_62541_c1
745 nmdc:mga0n895_104515_c1
746 nmdc:mga0n895_48728_c1
747 nmdc:mga0n895_64520_c1
748 nmdc:mga0rr50_22398_c1
749 nmdc:mga0rr50_644_c1
750 nmdc:mga0rr50_7048_c1
751 nmdc:mga0a205_382_c1
752 nmdc:mga0a205_85705_c1
753 Ga0495601_0102355
754 Ga0500616_0000226
755 2522548391
756 2572256442
757 2587749543
758 2588446491
759 2644530890
760 2729198631
761 2740057642
762 2906000765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

91

538

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ac3-assembly1.cif.gz_A crystal structure of pam12a 0.961 3 420
1m21-assembly2.cif.gz_B crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin 0.9605 3 418
5ac3-assembly1.cif.gz_A crystal structure of pam12a 0.9432 3 420
1m21-assembly2.cif.gz_B crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin 0.9383 3 418
1m22-assembly2.cif.gz_B x-ray structure of native peptide amidase from stenotrophomonas maltophilia at 1.4 a 0.9248 3 420
ID Description Score Start End Superfamily
1m22A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9248 3 420 3.90.1300.10
af_A0A0P0XRM7_54_372_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9114 2 225 3.90.1300.10
af_A0A0P0WV09_96_533_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9105 13 418 3.90.1300.10
af_A0A1D6EEQ3_1_311_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9097 110 418 3.90.1300.10
1m22A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9078 3 420 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A519XXY2-F1-model_v4 Amidase (EC 3.5.1.4) 0.982 65 422 GO:0004040
AF-A0A519JYR7-F1-model_v4 Amidase (EC 3.5.1.4) 0.982 223 420 GO:0004040
AF-A0A519ZWR6-F1-model_v4 Amidase (EC 3.5.1.4) 0.9802 2 423 GO:0004040
AF-A0A2N1XM56-F1-model_v4 deleted 0.9798 249 420
AF-A0A841RFV6-F1-model_v4 Amidase (EC 3.5.1.4) 0.9793 3 418 GO:0016787

Map