F429094

General Info

Members Datasets Scaffolds Average Seq Length
381 226 762 251

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_28261_c1|nmdc:mga0k408_28261_c1_841_1674
Length 277
Sequence LYIAGSSVYKLINLLTYQLITSFMAKIIFITGATSGFGKATAEIFAVNGYDLILNGRRADRLEELCKTLVKKFNIAALTLPFDVRDEKAVFDSINHLPAEWKNIDILFNNAGLALGRDYFDEADLNDWNIMIDTNVKGFMYVAKAVSQLMVARKQGHIINMGSIAGKQVYEKGNAYCASKYAVDALNHAMRIDLLRHNIKVTGIHPGAAETEFSLVRFKGDGDTAKKIYDGLTPLTPEDVAGVIWYCASLPPHVCINDLTITCTRQADGIYFYRNSY

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
95 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
96 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
97 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
98 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
99 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
100 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
101 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
102 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
103 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
104 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
111 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
122 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
133 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
164 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
169 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
170 2547132181 Kosakonia sacchari SP1 Isolate Stem
171 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
172 2561511199 Enterobacter sp. R4-368 Isolate Nodule
173 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
174 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
175 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
176 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
177 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
178 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
179 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
180 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
181 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
182 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
183 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
184 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
185 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
186 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
187 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
188 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
189 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
190 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
191 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
192 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
193 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
194 2855730933 Achromobacter sp. HZ28 Isolate Nodule
195 2855767633 Achromobacter sp. HZ34 Isolate Nodule
196 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
197 2865014394 Pantoea sp. R-71966 Isolate Unclassified
198 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
199 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
200 2876601092 Pantoea endophytica 596 Isolate Unclassified
201 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
202 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
203 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
204 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
205 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
206 2932406140 Serratia sp. 2723 Isolate Rhizosphere
207 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
208 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
209 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
210 2939577877 Serratia sp. 509 Isolate Rhizosphere
211 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
212 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
213 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
214 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
215 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
216 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
217 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
218 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
219 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
220 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
221 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
222 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
223 8018221730 Enterobacter sp. CM29 Isolate Unclassified
224 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
225 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
226 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.51
Metatranscriptomes 0
Isolates 15.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 4.46
Nodule 3.67
Rhizoplane 4.72
Rhizosphere 62.2
Stem 0.26
Stem Tuber 1.57
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_28261_c1 3300050493 Bacteria 3189
2 SwRhRL2b_contig_198135 2162886007 Bacteria 1467
3 SwRhRL2b_contig_333401 2162886007 Bacteria 2538
4 JGI24751J29686_10000693 3300002459 Bacteria 8367
5 JGI25152J39213_1000914 3300002773 Bacteria 14477
6 JGI25151J46595_10016125 3300003187 Bacteria 3274
7 rootH2_10034631 3300003320 Bacteria 31510
8 rootL2_10230917 3300003322 Bacteria 5745
9 Ga0058692_1000055 3300003856 Bacteria 105550
10 Ga0058692_1000094 3300003856 Bacteria 60087
11 Ga0058692_1000095 3300003856 Bacteria 59986
12 Ga0058692_1001146 3300003856 Bacteria 10274
13 Ga0065714_10004679 3300005288 Bacteria 7130
14 Ga0065704_10003369 3300005289 Bacteria 6310
15 Ga0065704_10003735 3300005289 Bacteria 9908
16 Ga0065712_10002866 3300005290 Bacteria 4096
17 Ga0065712_10003352 3300005290 Bacteria 7382
18 Ga0070676_10109522 3300005328 Bacteria 1718
19 Ga0070683_100007261 3300005329 Bacteria 9347
20 Ga0070670_100159831 3300005331 Bacteria 1952
21 Ga0068869_100006382 3300005334 Bacteria 7474
22 Ga0070668_100002673 3300005347 Bacteria 13105
23 Ga0070669_100004763 3300005353 Bacteria 9785
24 Ga0070675_100056921 3300005354 Bacteria 3223
25 Ga0070674_100027103 3300005356 Unclassified 3752
26 Ga0070674_100345460 3300005356 Bacteria 1200
27 Ga0070688_100013318 3300005365 Bacteria 4632
28 Ga0070701_10098517 3300005438 Bacteria 1615
29 Ga0070681_10189569 3300005458 Bacteria 1976
30 Ga0070684_100003266 3300005535 Bacteria 12142
31 Ga0068853_100150492 3300005539 Bacteria 2095
32 Ga0070672_100055335 3300005543 Bacteria 3108
33 Ga0070704_100124947 3300005549 Bacteria 1983
34 Ga0070664_100320000 3300005564 Bacteria 1405
35 Ga0068854_100088614 3300005578 Bacteria 2298
36 Ga0070702_100390359 3300005615 Unclassified 992
37 Ga0068859_100133796 3300005617 Bacteria 2551
38 Ga0068864_100013585 3300005618 Bacteria 6750
39 Ga0068861_100004091 3300005719 Bacteria 9776
40 Ga0068862_100093454 3300005844 Bacteria 2622
41 Ga0081540_1015970 3300005983 Bacteria 4729
42 Ga0075364_10011753 3300006051 Bacteria 5329
43 Ga0075364_10207044 3300006051 Bacteria 1330
44 Ga0075366_10010147 3300006195 Bacteria 5281
45 Ga0075366_10024480 3300006195 Bacteria 3521
46 Ga0097620_100133811 3300006931 Bacteria 2551
47 Ga0079104_1000049 3300006946 Bacteria 177499
48 Ga0079104_1000223 3300006946 Bacteria 78580
49 Ga0079104_1000486 3300006946 Bacteria 43595
50 Ga0079104_1001107 3300006946 Bacteria 19927
51 Ga0079104_1002044 3300006946 Bacteria 11716
52 Ga0105251_10000040 3300009011 Bacteria 115504
53 Ga0105251_10001043 3300009011 Bacteria 24296
54 Ga0105251_10007626 3300009011 Bacteria 6627
55 Ga0105251_10017106 3300009011 Bacteria 3895
56 Ga0105251_10017936 3300009011 Bacteria 3779
57 Ga0105251_10023364 3300009011 Bacteria 3192
58 Ga0105244_10000705 3300009036 Bacteria 28994
59 Ga0105244_10000960 3300009036 Bacteria 24197
60 Ga0105244_10001297 3300009036 Bacteria 20478
61 Ga0105244_10002861 3300009036 Bacteria 12790
62 Ga0105244_10053472 3300009036 Bacteria 2052
63 Ga0105250_10000264 3300009092 Bacteria 42668
64 Ga0105250_10000533 3300009092 Bacteria 26352
65 Ga0105250_10000837 3300009092 Bacteria 18280
66 Ga0105250_10004257 3300009092 Bacteria 6618
67 Ga0105250_10006430 3300009092 Bacteria 5131
68 Ga0105240_10000273 3300009093 Bacteria 102198
69 Ga0111539_10018813 3300009094 Bacteria 8546
70 Ga0105243_10233004 3300009148 Bacteria 1635
71 Ga0105243_10335973 3300009148 Bacteria 1382
72 Ga0105249_10005287 3300009553 Bacteria 11145
73 Ga0105239_10253726 3300010375 Unclassified 1976
74 Ga0105246_10146663 3300011119 Bacteria 1781
75 Ga0157373_10000469 3300013100 Bacteria 31979
76 Ga0157371_10000782 3300013102 Bacteria 36580
77 Ga0157371_10001758 3300013102 Bacteria 21966
78 Ga0157370_10052182 3300013104 Bacteria 3904
79 Ga0157370_10180237 3300013104 Bacteria 1963
80 Ga0157369_10002617 3300013105 Bacteria 21518
81 Ga0157369_10003245 3300013105 Bacteria 19370
82 Ga0157369_10022428 3300013105 Bacteria 7044
83 Ga0163162_10058691 3300013306 Bacteria 3878
84 Ga0163162_10073850 3300013306 Bacteria 3467
85 Ga0157372_10003680 3300013307 Bacteria 16478
86 Ga0157372_10013672 3300013307 Bacteria 8674
87 Ga0157372_10014587 3300013307 Bacteria 8406
88 Ga0157372_10044379 3300013307 Bacteria 4926
89 Ga0157372_10075170 3300013307 Bacteria 3811
90 Ga0157375_10630818 3300013308 Bacteria 1229
91 Ga0163163_10301399 3300014325 Unclassified 1655
92 Ga0163163_10492771 3300014325 Bacteria 1287
93 Ga0157380_10861228 3300014326 Bacteria 929
94 Ga0182008_10069716 3300014497 Bacteria 1730
95 Ga0157377_10045598 3300014745 Bacteria 2450
96 Ga0182006_1004446 3300015261 Bacteria 6915
97 Ga0163161_10048512 3300017792 Bacteria 3067
98 Ga0163161_10072204 3300017792 Bacteria 2527
99 Ga0163161_10085760 3300017792 Bacteria 2323
100 Ga0209437_100073 3300025233 Bacteria 302948
101 Ga0207425_1010822 3300025245 Bacteria 2204
102 Ga0209129_1000004 3300025258 Bacteria 884499
103 Ga0209025_1000003 3300025294 Bacteria 1366495
104 Ga0207697_10015216 3300025315 Bacteria 3181
105 Ga0207696_1000005 3300025711 Bacteria 642078
106 Ga0207696_1000042 3300025711 Bacteria 307256
107 Ga0207696_1000432 3300025711 Bacteria 38094
108 Ga0207696_1000858 3300025711 Bacteria 19072
109 Ga0207696_1001101 3300025711 Bacteria 15838
110 Ga0207696_1002965 3300025711 Bacteria 7946
111 Ga0207696_1005899 3300025711 Bacteria 5011
112 Ga0207655_1000001 3300025728 Bacteria 1866413
113 Ga0207655_1000069 3300025728 Bacteria 239968
114 Ga0207655_1000774 3300025728 Bacteria 35660
115 Ga0207655_1005188 3300025728 Bacteria 8961
116 Ga0207655_1014021 3300025728 Bacteria 4561
117 Ga0207655_1027418 3300025728 Bacteria 2714
118 Ga0207655_1057203 3300025728 Bacteria 1533
119 Ga0207713_1000001 3300025735 Bacteria 2295391
120 Ga0207713_1000002 3300025735 Bacteria 1061749
121 Ga0207713_1000003 3300025735 Bacteria 860698
122 Ga0207713_1017140 3300025735 Bacteria 3646
123 Ga0207713_1019422 3300025735 Bacteria 3325
124 Ga0207713_1026645 3300025735 Bacteria 2643
125 Ga0207643_10009119 3300025908 Bacteria 5329
126 Ga0207707_10160943 3300025912 Bacteria 1963
127 Ga0207695_10000130 3300025913 Bacteria 224214
128 Ga0207650_10116815 3300025925 Bacteria 2072
129 Ga0207659_10008616 3300025926 Bacteria 6344
130 Ga0207706_10049254 3300025933 Bacteria 3724
131 Ga0207709_10238878 3300025935 Bacteria 1320
132 Ga0207670_10017047 3300025936 Bacteria 4382
133 Ga0207704_10119133 3300025938 Bacteria 1802
134 Ga0207691_10170653 3300025940 Bacteria 1905
135 Ga0207689_10007546 3300025942 Bacteria 9538
136 Ga0207668_10109002 3300025972 Bacteria 2073
137 Ga0207640_10073280 3300025981 Bacteria 2314
138 Ga0207703_10252133 3300026035 Bacteria 1591
139 Ga0207676_10019528 3300026095 Bacteria 4946
140 Ga0207674_10003317 3300026116 Bacteria 19789
141 Ga0207675_100001235 3300026118 Bacteria 25524
142 Ga0207683_10311312 3300026121 Bacteria 1441
143 Ga0209281_1000001 3300027111 Bacteria 1933496
144 Ga0209281_1000004 3300027111 Bacteria 1253949
145 Ga0209281_1000006 3300027111 Bacteria 1170244
146 Ga0209281_1000012 3300027111 Bacteria 684886
147 Ga0209281_1001189 3300027111 Bacteria 17837
148 Ga0209281_1003086 3300027111 Bacteria 5819
149 Ga0209371_1000002 3300027312 Bacteria 1551985
150 Ga0209371_1000041 3300027312 Bacteria 340377
151 Ga0209371_1000075 3300027312 Bacteria 196676
152 Ga0209371_1000077 3300027312 Bacteria 191208
153 Ga0209371_1000271 3300027312 Bacteria 60423
154 Ga0209371_1000436 3300027312 Bacteria 42413
155 Ga0209371_1002538 3300027312 Bacteria 10103
156 Ga0209371_1006199 3300027312 Bacteria 4502
157 Ga0209371_1014229 3300027312 Bacteria 2191
158 Ga0207428_10187581 3300027907 Bacteria 1560
159 Ga0268256_1000002 3300030500 Bacteria 1535763
160 Ga0268256_1000003 3300030500 Bacteria 1289401
161 Ga0268256_1000033 3300030500 Bacteria 420973
162 Ga0268256_1000068 3300030500 Bacteria 196676
163 Ga0268256_1000317 3300030500 Bacteria 47947
164 Ga0268256_1000376 3300030500 Bacteria 42413
165 Ga0268256_1006407 3300030500 Bacteria 4384
166 Ga0268256_1009605 3300030500 Bacteria 3191
167 Ga0268256_1013609 3300030500 Bacteria 2454
168 Ga0265327_10000219 3300031251 Bacteria 116606
169 Ga0436365_0693472 3300039437 Bacteria 1626
170 Ga0436363_1379572 3300039450 Bacteria 2830
171 Ga0439438_000001 3300041405 Bacteria 1263568
172 Ga0439439_0024904 3300041406 Bacteria 1504
173 Ga0439447_002339 3300041407 Bacteria 6931
174 Ga0439447_007808 3300041407 Bacteria 3359
175 Ga0439466_0000009 3300041411 Bacteria 232657
176 Ga0451843_1721864 3300041509 Bacteria 3231
177 Ga0439442_017726 3300042002 Unclassified 1470
178 Ga0439432_009362 3300042006 Bacteria 3418
179 Ga0439452_000028 3300042010 Bacteria 204513
180 Ga0439452_023625 3300042010 Bacteria 1580
181 Ga0439452_040894 3300042010 Bacteria 1092
182 Ga0450894_008246 3300042131 Bacteria 1346
183 Ga0450898_003819 3300042134 Bacteria 2188
184 Ga0450907_000172 3300042146 Bacteria 23725
185 Ga0451577_0233991 3300042876 Unclassified 1662
186 Ga0453684_0601509 3300044712 Unclassified 1205
187 Ga0495591_000003 3300046458 Bacteria 449825
188 Ga0495591_000007 3300046458 Bacteria 366385
189 Ga0495591_001918 3300046458 Bacteria 12207
190 Ga0495638_0002827 3300046460 Bacteria 13907
191 Ga0495638_0111152 3300046460 Bacteria 1628
192 Ga0495585_0030732 3300046492 Bacteria 3054
193 Ga0495596_0021461 3300046500 Bacteria 2636
194 Ga0495620_0002310 3300046515 Bacteria 11044
195 Ga0495648_0001677 3300046524 Bacteria 21423
196 Ga0495654_0000007 3300046530 Bacteria 403529
197 Ga0495654_0012677 3300046530 Bacteria 4526
198 Ga0495654_0023563 3300046530 Bacteria 3187
199 Ga0495597_0000396 3300046542 Bacteria 37594
200 Ga0495668_0012466 3300046616 Bacteria 5040
201 Ga0495588_0006734 3300046674 Bacteria 5194
202 Ga0495671_0056232 3300046692 Bacteria 1948
203 Ga0495649_0000229 3300046694 Bacteria 48965
204 Ga0495649_0000261 3300046694 Bacteria 46982
205 Ga0495649_0099474 3300046694 Bacteria 1546
206 Ga0495660_0030834 3300046810 Bacteria 3018
207 Ga0495672_0000034 3300047320 Bacteria 290832
208 Ga0495672_0000053 3300047320 Bacteria 233823
209 Ga0495679_000005 3300047446 Bacteria 455007
210 Ga0495679_000484 3300047446 Bacteria 28480
211 Ga0495679_010848 3300047446 Bacteria 3554
212 Ga0495679_064285 3300047446 Bacteria 1069
213 Ga0495679_087308 3300047446 Bacteria 878
214 Ga0495673_0000070 3300047469 Bacteria 217453
215 Ga0495686_0025667 3300047472 Bacteria 3862
216 Ga0495686_0054141 3300047472 Bacteria 2513
217 Ga0496100_0100068 3300048903 Bacteria 1996
218 Ga0496101_0000083 3300048904 Bacteria 104105
219 Ga0496101_0615800 3300048904 Bacteria 858
220 Ga0496102_0000807 3300048905 Bacteria 30477
221 Ga0496104_0004356 3300048907 Bacteria 12311
222 Ga0496104_0218281 3300048907 Bacteria 1819
223 Ga0496105_0023364 3300048908 Bacteria 5013
224 Ga0496105_0059894 3300048908 Bacteria 3141
225 Ga0496116_0029594 3300048919 Bacteria 3945
226 Ga0496116_0032443 3300048919 Bacteria 3721
227 Ga0496116_0118833 3300048919 Bacteria 1535
228 Ga0496116_0222211 3300048919 Bacteria 966
229 Ga0496117_0000022 3300048920 Bacteria 439512
230 Ga0496117_0000268 3300048920 Bacteria 98537
231 Ga0496117_0003107 3300048920 Bacteria 19847
232 Ga0496117_0006104 3300048920 Bacteria 12338
233 Ga0496117_0017399 3300048920 Bacteria 6002
234 Ga0496117_0028484 3300048920 Bacteria 4324
235 Ga0496117_0037724 3300048920 Bacteria 3595
236 Ga0496117_0073944 3300048920 Bacteria 2272
237 Ga0496118_0000007 3300048921 Bacteria 650986
238 Ga0496118_0000774 3300048921 Bacteria 51332
239 Ga0496118_0021689 3300048921 Bacteria 5644
240 Ga0496118_0045695 3300048921 Bacteria 3414
241 Ga0496118_0057492 3300048921 Bacteria 2914
242 Ga0496118_0066498 3300048921 Bacteria 2630
243 Ga0496118_0072804 3300048921 Bacteria 2465
244 Ga0496118_0117571 3300048921 Bacteria 1743
245 Ga0496119_0000001 3300048922 Bacteria 789520
246 Ga0496119_0000015 3300048922 Bacteria 312979
247 Ga0496119_0000145 3300048922 Bacteria 99245
248 Ga0496119_0001348 3300048922 Bacteria 30016
249 Ga0496119_0003462 3300048922 Bacteria 16377
250 Ga0496119_0004216 3300048922 Bacteria 14439
251 Ga0496119_0011723 3300048922 Bacteria 7213
252 Ga0496119_0117137 3300048922 Bacteria 1469
253 Ga0496120_0000029 3300048923 Bacteria 229859
254 Ga0496120_0000051 3300048923 Bacteria 186239
255 Ga0496120_0000107 3300048923 Bacteria 139739
256 Ga0496120_0000417 3300048923 Bacteria 67929
257 Ga0496120_0001248 3300048923 Bacteria 32026
258 Ga0496120_0001605 3300048923 Bacteria 26234
259 Ga0496120_0007780 3300048923 Bacteria 7916
260 Ga0496120_0015319 3300048923 Bacteria 5063
261 Ga0496120_0194053 3300048923 Bacteria 988
262 Ga0496121_0000103 3300048924 Bacteria 194818
263 Ga0496121_0018360 3300048924 Bacteria 7056
264 Ga0496121_0022171 3300048924 Bacteria 6178
265 Ga0496122_0000005 3300048925 Bacteria 630659
266 Ga0496122_0003310 3300048925 Bacteria 21316
267 Ga0496122_0015090 3300048925 Bacteria 7410
268 Ga0496122_0019457 3300048925 Bacteria 6200
269 Ga0496122_0059563 3300048925 Bacteria 2818
270 Ga0496122_0094368 3300048925 Bacteria 2025
271 Ga0496123_0000008 3300048926 Bacteria 630628
272 Ga0496123_0001296 3300048926 Bacteria 35611
273 Ga0496123_0014551 3300048926 Bacteria 6512
274 Ga0496123_0025107 3300048926 Bacteria 4502
275 Ga0496123_0048871 3300048926 Bacteria 2842
276 Ga0496124_0000195 3300048927 Bacteria 119909
277 Ga0496124_0000199 3300048927 Bacteria 118647
278 Ga0496124_0000216 3300048927 Bacteria 112485
279 Ga0496124_0003316 3300048927 Bacteria 19842
280 Ga0496124_0040118 3300048927 Bacteria 4052
281 Ga0496124_0059254 3300048927 Bacteria 3217
282 Ga0496124_0171205 3300048927 Bacteria 1681
283 Ga0496125_0000009 3300048928 Bacteria 677678
284 Ga0496125_0032878 3300048928 Bacteria 4600
285 Ga0496125_0034566 3300048928 Bacteria 4453
286 Ga0496125_0068487 3300048928 Bacteria 2791
287 Ga0496126_0013944 3300048929 Bacteria 8152
288 Ga0496126_0030235 3300048929 Bacteria 5134
289 Ga0496126_0079214 3300048929 Bacteria 2909
290 Ga0496126_0252678 3300048929 Bacteria 1468
291 Ga0496126_0335132 3300048929 Bacteria 1240
292 Ga0501032_0000402 3300049569 Bacteria 35659
293 Ga0501034_0025965 3300049571 Bacteria 5966
294 Ga0501036_0019016 3300049572 Bacteria 5763
295 Ga0501037_0042593 3300049573 Bacteria 3336
296 Ga0501038_0233768 3300049574 Bacteria 1462
297 Ga0501039_0052536 3300049575 Bacteria 3153
298 Ga0501043_0026951 3300049579 Bacteria 4509
299 Ga0501046_0003635 3300049580 Bacteria 14129
300 Ga0501047_0018906 3300049581 Bacteria 6607
301 Ga0501048_0032411 3300049582 Bacteria 3776
302 Ga0501067_0018156 3300049583 Bacteria 3896
303 Ga0501068_0183420 3300049584 Bacteria 1324
304 Ga0501070_0029460 3300049586 Bacteria 4602
305 Ga0501074_0000785 3300049590 Bacteria 20059
306 Ga0501077_0091554 3300049593 Bacteria 1927
307 Ga0501219_000078 3300049703 Bacteria 16680
308 Ga0501225_0009606 3300049705 Bacteria 2748
309 Ga0501080_0108593 3300049742 Bacteria 2571
310 Ga0501083_0021187 3300049744 Bacteria 4518
311 Ga0501035_0000392 3300049822 Bacteria 50188
312 Ga0501035_0003849 3300049822 Bacteria 14305
313 Ga0501284_00008 3300050005 Bacteria 143517
314 nmdc:mga00v17_24502_c1 3300050491 Bacteria 3501
315 nmdc:mga00v17_638_c1 3300050491 Bacteria 19381
316 nmdc:mga0k408_1677_c1 3300050493 Bacteria 11956
317 nmdc:mga08y16_31668_c1 3300050511 Bacteria 5560
318 Ga0500639_133725 3300053163 Bacteria 1171
319 Ga0500611_000002 3300053727 Bacteria 345991
320 Ga0500645_019478 3300053730 Bacteria 2110
321 Ga0501084_0207985 3300054114 Bacteria 1651
322 Ga0501082_0125244 3300060353 Bacteria 2229
323 2511379551 2511231025 Bacteria 5324661
324 2538424781 2537561728 Bacteria 5149301
325 2547695295 2547132181 Bacteria 4945084
326 2555257659 2554235234 Bacteria 5762085
327 2562462834 2561511199 Bacteria 5155034
328 2599925733 2599185299 Bacteria 4854625
329 2601532523 2600255256 Bacteria 5597742
330 2601537893 2600255257 Bacteria 5597196
331 2601756451 2600255310 Bacteria 5600903
332 2601763068 2600255311 Bacteria 5598766
333 2603638026 2602042046 Bacteria 5483348
334 2603866673 2602042109 Bacteria 5152801
335 2608669496 2608642108 Bacteria 4104624
336 2650899066 2648501693 Bacteria 5069560
337 2686353451 2684622997 Bacteria 4624240
338 2707099135 2706794495 Bacteria 4536932
339 2712468582 2711768156 Bacteria 4471618
340 2793405608 2791355275 Bacteria 4429597
341 2809123493 2808606414 Bacteria 4917181
342 2813729034 2811995292 Bacteria 5303342
343 2814696577 2814123068 Bacteria 5687681
344 2844530959 2844528606 Bacteria 4733806
345 2847799759 2847797336 Bacteria 5176640
346 2852104557 2852103415 Bacteria 5193810
347 2854604076 2854601825 Bacteria 4797592
348 2855197278 2855195626 Bacteria 4927512
349 2855734550 2855730933 Bacteria 7047938
350 2855770140 2855767633 Bacteria 7049357
351 2858468577 2858466076 Bacteria 4722413
352 2865015332 2865014394 Bacteria 4764573
353 2871272902 2871272651 Bacteria 5042015
354 2871283547 2871282230 Bacteria 4917173
355 2876604153 2876601092 Bacteria 5114497
356 2881612635 2881609920 Bacteria 4405319
357 2888378112 2888373701 Bacteria 5098052
358 2891670980 2891670763 Bacteria 4967099
359 2900051898 2900051742 Bacteria 4985156
360 2919108861 2919108558 Bacteria 5897419
361 2932408094 2932406140 Bacteria 5134491
362 2935626750 2935625433 Bacteria 5042964
363 2939569080 2939568625 Bacteria 4542555
364 2939573670 2939573065 Bacteria 4926053
365 2939578551 2939577877 Bacteria 5132791
366 2939619471 2939617950 Bacteria 4820956
367 2939643872 2939642701 Bacteria 4475280
368 2945952917 2945951305 Bacteria 4918162
369 2969082450 2969079654 Bacteria 5439582
370 2971823427 2971820967 Bacteria 5823634
371 2974438348 2974435778 Bacteria 4876478
372 2978979482 2978975091 Bacteria 4704313
373 2984496739 2984494565 Bacteria 5000175
374 2990262156 2990261002 Bacteria 4919493
375 3000378896 3000376612 Bacteria 4705565
376 8015398161 8015394850 Bacteria 5064660
377 8016735839 8016733728 Bacteria 5274317
378 8018221921 8018221730 Bacteria 4616064
379 8019500761 8019499862 Bacteria 5169538
380 8019506355 8019504834 Bacteria 4819156
381 8057308551 8057304971 Bacteria 4649742
382 nmdc:mga0k408_28261_c1
383 SwRhRL2b_contig_198135
384 SwRhRL2b_contig_333401
385 JGI24751J29686_10000693
386 JGI25152J39213_1000914
387 JGI25151J46595_10016125
388 rootH2_10034631
389 rootL2_10230917
390 Ga0058692_1000055
391 Ga0058692_1000094
392 Ga0058692_1000095
393 Ga0058692_1001146
394 Ga0065714_10004679
395 Ga0065704_10003369
396 Ga0065704_10003735
397 Ga0065712_10002866
398 Ga0065712_10003352
399 Ga0070676_10109522
400 Ga0070683_100007261
401 Ga0070670_100159831
402 Ga0068869_100006382
403 Ga0070668_100002673
404 Ga0070669_100004763
405 Ga0070675_100056921
406 Ga0070674_100027103
407 Ga0070674_100345460
408 Ga0070688_100013318
409 Ga0070701_10098517
410 Ga0070681_10189569
411 Ga0070684_100003266
412 Ga0068853_100150492
413 Ga0070672_100055335
414 Ga0070704_100124947
415 Ga0070664_100320000
416 Ga0068854_100088614
417 Ga0070702_100390359
418 Ga0068859_100133796
419 Ga0068864_100013585
420 Ga0068861_100004091
421 Ga0068862_100093454
422 Ga0081540_1015970
423 Ga0075364_10011753
424 Ga0075364_10207044
425 Ga0075366_10010147
426 Ga0075366_10024480
427 Ga0097620_100133811
428 Ga0079104_1000049
429 Ga0079104_1000223
430 Ga0079104_1000486
431 Ga0079104_1001107
432 Ga0079104_1002044
433 Ga0105251_10000040
434 Ga0105251_10001043
435 Ga0105251_10007626
436 Ga0105251_10017106
437 Ga0105251_10017936
438 Ga0105251_10023364
439 Ga0105244_10000705
440 Ga0105244_10000960
441 Ga0105244_10001297
442 Ga0105244_10002861
443 Ga0105244_10053472
444 Ga0105250_10000264
445 Ga0105250_10000533
446 Ga0105250_10000837
447 Ga0105250_10004257
448 Ga0105250_10006430
449 Ga0105240_10000273
450 Ga0111539_10018813
451 Ga0105243_10233004
452 Ga0105243_10335973
453 Ga0105249_10005287
454 Ga0105239_10253726
455 Ga0105246_10146663
456 Ga0157373_10000469
457 Ga0157371_10000782
458 Ga0157371_10001758
459 Ga0157370_10052182
460 Ga0157370_10180237
461 Ga0157369_10002617
462 Ga0157369_10003245
463 Ga0157369_10022428
464 Ga0163162_10058691
465 Ga0163162_10073850
466 Ga0157372_10003680
467 Ga0157372_10013672
468 Ga0157372_10014587
469 Ga0157372_10044379
470 Ga0157372_10075170
471 Ga0157375_10630818
472 Ga0163163_10301399
473 Ga0163163_10492771
474 Ga0157380_10861228
475 Ga0182008_10069716
476 Ga0157377_10045598
477 Ga0182006_1004446
478 Ga0163161_10048512
479 Ga0163161_10072204
480 Ga0163161_10085760
481 Ga0209437_100073
482 Ga0207425_1010822
483 Ga0209129_1000004
484 Ga0209025_1000003
485 Ga0207697_10015216
486 Ga0207696_1000005
487 Ga0207696_1000042
488 Ga0207696_1000432
489 Ga0207696_1000858
490 Ga0207696_1001101
491 Ga0207696_1002965
492 Ga0207696_1005899
493 Ga0207655_1000001
494 Ga0207655_1000069
495 Ga0207655_1000774
496 Ga0207655_1005188
497 Ga0207655_1014021
498 Ga0207655_1027418
499 Ga0207655_1057203
500 Ga0207713_1000001
501 Ga0207713_1000002
502 Ga0207713_1000003
503 Ga0207713_1017140
504 Ga0207713_1019422
505 Ga0207713_1026645
506 Ga0207643_10009119
507 Ga0207707_10160943
508 Ga0207695_10000130
509 Ga0207650_10116815
510 Ga0207659_10008616
511 Ga0207706_10049254
512 Ga0207709_10238878
513 Ga0207670_10017047
514 Ga0207704_10119133
515 Ga0207691_10170653
516 Ga0207689_10007546
517 Ga0207668_10109002
518 Ga0207640_10073280
519 Ga0207703_10252133
520 Ga0207676_10019528
521 Ga0207674_10003317
522 Ga0207675_100001235
523 Ga0207683_10311312
524 Ga0209281_1000001
525 Ga0209281_1000004
526 Ga0209281_1000006
527 Ga0209281_1000012
528 Ga0209281_1001189
529 Ga0209281_1003086
530 Ga0209371_1000002
531 Ga0209371_1000041
532 Ga0209371_1000075
533 Ga0209371_1000077
534 Ga0209371_1000271
535 Ga0209371_1000436
536 Ga0209371_1002538
537 Ga0209371_1006199
538 Ga0209371_1014229
539 Ga0207428_10187581
540 Ga0268256_1000002
541 Ga0268256_1000003
542 Ga0268256_1000033
543 Ga0268256_1000068
544 Ga0268256_1000317
545 Ga0268256_1000376
546 Ga0268256_1006407
547 Ga0268256_1009605
548 Ga0268256_1013609
549 Ga0265327_10000219
550 Ga0436365_0693472
551 Ga0436363_1379572
552 Ga0439438_000001
553 Ga0439439_0024904
554 Ga0439447_002339
555 Ga0439447_007808
556 Ga0439466_0000009
557 Ga0451843_1721864
558 Ga0439442_017726
559 Ga0439432_009362
560 Ga0439452_000028
561 Ga0439452_023625
562 Ga0439452_040894
563 Ga0450894_008246
564 Ga0450898_003819
565 Ga0450907_000172
566 Ga0451577_0233991
567 Ga0453684_0601509
568 Ga0495591_000003
569 Ga0495591_000007
570 Ga0495591_001918
571 Ga0495638_0002827
572 Ga0495638_0111152
573 Ga0495585_0030732
574 Ga0495596_0021461
575 Ga0495620_0002310
576 Ga0495648_0001677
577 Ga0495654_0000007
578 Ga0495654_0012677
579 Ga0495654_0023563
580 Ga0495597_0000396
581 Ga0495668_0012466
582 Ga0495588_0006734
583 Ga0495671_0056232
584 Ga0495649_0000229
585 Ga0495649_0000261
586 Ga0495649_0099474
587 Ga0495660_0030834
588 Ga0495672_0000034
589 Ga0495672_0000053
590 Ga0495679_000005
591 Ga0495679_000484
592 Ga0495679_010848
593 Ga0495679_064285
594 Ga0495679_087308
595 Ga0495673_0000070
596 Ga0495686_0025667
597 Ga0495686_0054141
598 Ga0496100_0100068
599 Ga0496101_0000083
600 Ga0496101_0615800
601 Ga0496102_0000807
602 Ga0496104_0004356
603 Ga0496104_0218281
604 Ga0496105_0023364
605 Ga0496105_0059894
606 Ga0496116_0029594
607 Ga0496116_0032443
608 Ga0496116_0118833
609 Ga0496116_0222211
610 Ga0496117_0000022
611 Ga0496117_0000268
612 Ga0496117_0003107
613 Ga0496117_0006104
614 Ga0496117_0017399
615 Ga0496117_0028484
616 Ga0496117_0037724
617 Ga0496117_0073944
618 Ga0496118_0000007
619 Ga0496118_0000774
620 Ga0496118_0021689
621 Ga0496118_0045695
622 Ga0496118_0057492
623 Ga0496118_0066498
624 Ga0496118_0072804
625 Ga0496118_0117571
626 Ga0496119_0000001
627 Ga0496119_0000015
628 Ga0496119_0000145
629 Ga0496119_0001348
630 Ga0496119_0003462
631 Ga0496119_0004216
632 Ga0496119_0011723
633 Ga0496119_0117137
634 Ga0496120_0000029
635 Ga0496120_0000051
636 Ga0496120_0000107
637 Ga0496120_0000417
638 Ga0496120_0001248
639 Ga0496120_0001605
640 Ga0496120_0007780
641 Ga0496120_0015319
642 Ga0496120_0194053
643 Ga0496121_0000103
644 Ga0496121_0018360
645 Ga0496121_0022171
646 Ga0496122_0000005
647 Ga0496122_0003310
648 Ga0496122_0015090
649 Ga0496122_0019457
650 Ga0496122_0059563
651 Ga0496122_0094368
652 Ga0496123_0000008
653 Ga0496123_0001296
654 Ga0496123_0014551
655 Ga0496123_0025107
656 Ga0496123_0048871
657 Ga0496124_0000195
658 Ga0496124_0000199
659 Ga0496124_0000216
660 Ga0496124_0003316
661 Ga0496124_0040118
662 Ga0496124_0059254
663 Ga0496124_0171205
664 Ga0496125_0000009
665 Ga0496125_0032878
666 Ga0496125_0034566
667 Ga0496125_0068487
668 Ga0496126_0013944
669 Ga0496126_0030235
670 Ga0496126_0079214
671 Ga0496126_0252678
672 Ga0496126_0335132
673 Ga0501032_0000402
674 Ga0501034_0025965
675 Ga0501036_0019016
676 Ga0501037_0042593
677 Ga0501038_0233768
678 Ga0501039_0052536
679 Ga0501043_0026951
680 Ga0501046_0003635
681 Ga0501047_0018906
682 Ga0501048_0032411
683 Ga0501067_0018156
684 Ga0501068_0183420
685 Ga0501070_0029460
686 Ga0501074_0000785
687 Ga0501077_0091554
688 Ga0501219_000078
689 Ga0501225_0009606
690 Ga0501080_0108593
691 Ga0501083_0021187
692 Ga0501035_0000392
693 Ga0501035_0003849
694 Ga0501284_00008
695 nmdc:mga00v17_24502_c1
696 nmdc:mga00v17_638_c1
697 nmdc:mga0k408_1677_c1
698 nmdc:mga08y16_31668_c1
699 Ga0500639_133725
700 Ga0500611_000002
701 Ga0500645_019478
702 Ga0501084_0207985
703 Ga0501082_0125244
704 2511379551
705 2538424781
706 2547695295
707 2555257659
708 2562462834
709 2599925733
710 2601532523
711 2601537893
712 2601756451
713 2601763068
714 2603638026
715 2603866673
716 2608669496
717 2650899066
718 2686353451
719 2707099135
720 2712468582
721 2793405608
722 2809123493
723 2813729034
724 2814696577
725 2844530959
726 2847799759
727 2852104557
728 2854604076
729 2855197278
730 2855734550
731 2855770140
732 2858468577
733 2865015332
734 2871272902
735 2871283547
736 2876604153
737 2881612635
738 2888378112
739 2891670980
740 2900051898
741 2919108861
742 2932408094
743 2935626750
744 2939569080
745 2939573670
746 2939578551
747 2939619471
748 2939643872
749 2945952917
750 2969082450
751 2971823427
752 2974438348
753 2978979482
754 2984496739
755 2990262156
756 3000378896
757 8015398161
758 8016735839
759 8018221921
760 8019500761
761 8019506355
762 8057308551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

26

220

0.98

PF08659

KR

KR domain

27

206

0.91

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

32

251

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9889 1 239
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9874 1 239
3asv-assembly1.cif.gz_A the closed form of serine dehydrogenase complexed with nadp+ 0.9873 1 248
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9798 1 239
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9784 1 239
ID Description Score Start End Superfamily
3asvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9866 1 248 3.40.50.720
af_O15744_2_259_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9703 3 239 3.40.50.720
af_P9WGR5_6_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9702 2 239 3.40.50.720
3rkuD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9665 2 239 3.40.50.720
af_Q9P7B4_1_257_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9619 3 239 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A705WUA1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 1.002 1 160 GO:0005829
GO:0016491
AF-A0A6L7A4L5-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9993 1 182 GO:0005829
GO:0016491
AF-A0A705WUA1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9955 1 160 GO:0005829
GO:0016491
AF-A0A0A2W3N6-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9948 1 236 GO:0003677
GO:0003700
GO:0005829
GO:0016491
AF-A0A6L7A4L5-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9938 1 182 GO:0005829
GO:0016491

Map