F429129

General Info

Members Datasets Scaffolds Average Seq Length
381 299 274 148

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8005395548|8005401449
Length 174
Sequence DAPPLGSVLIPAPNRLSSFREGATVDAVLRGLTIYFTLLVIIRLSGRRTLAQMTPFDLVIVLVISETTQQAMLGDDFSITNSVILILTLFTTDIGLSYVKRWWPRAGHVIDGVPTVLVTDGVYDERALKGARLQKEDVMEAARSQEGIESVTEIKFAILEVSGAISIIKKQKSD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
11 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
12 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
13 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
14 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
15 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
16 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
17 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
18 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
19 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
20 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
21 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
22 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
23 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
24 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
25 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
26 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
27 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
28 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
29 2718217927 Rhizobium sp. N324 Isolate Nodule
30 2718218423 Rhizobium sp. N941 Isolate Nodule
31 2721755809 Rhizobium sp. N541 Isolate Nodule
32 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
33 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
34 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
35 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
36 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
37 2791355261 Rhizobium sp. J15 Isolate Nodule
38 2791355267 Rhizobium sp. L18 Isolate Nodule
39 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
40 2802429634 Rhizobium anhuiense S10 Isolate Nodule
41 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
42 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
43 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
44 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
45 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
46 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
47 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
48 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
49 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
50 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
51 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
52 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
53 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
54 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
55 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
56 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
57 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
58 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
59 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
60 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
61 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
62 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
63 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
64 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
65 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
66 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
67 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
68 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
69 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
70 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
71 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
72 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
73 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
74 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
75 2865014394 Pantoea sp. R-71966 Isolate Unclassified
76 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
77 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
78 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
79 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
80 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
81 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
82 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
83 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
84 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
85 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
86 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
87 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
88 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
89 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
90 2996893221 Rhizobium sp. R635 Isolate Nodule
91 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
92 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
93 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
94 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
95 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
96 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
97 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
98 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
99 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
100 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
101 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
102 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
103 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
104 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
105 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
106 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
107 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
108 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
109 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
110 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
111 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
115 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
134 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
135 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
136 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
165 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
168 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
171 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
172 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
173 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
174 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
175 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
176 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
177 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
178 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
244 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
245 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
246 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
247 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
261 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
262 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
263 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
270 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
271 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
272 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
275 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
278 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
279 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
280 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
281 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 8005275841 Rhizobium sp. N4311 Isolate Nodule
285 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
286 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
287 8005382845 Rhizobium sp. R634 Isolate Nodule
288 8005395548 Rhizobium sp. R339 Isolate Nodule
289 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
290 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
291 8018176218 Rhizobium sp. N122 Isolate Nodule
292 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
293 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
294 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
295 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
296 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
297 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
298 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
299 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.92
Metatranscriptomes 0
Isolates 28.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.22
Nodule 22.05
Rhizoplane 1.05
Rhizosphere 46.98
Stem 0
Stem Tuber 0
Unclassified 14.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_28845 2162886007 Bacteria 1747
2 JGI25152J39213_1006740 3300002773 Bacteria 3062
3 JGI25151J46595_10047063 3300003187 Bacteria 1504
4 JGI25153J46596_10015751 3300003215 Bacteria 3062
5 rootH1_10256644 3300003323 Bacteria 1209
6 Ga0055524_1026250 3300003775 Bacteria 1805
7 Ga0055528_1007133 3300003790 Bacteria 4986
8 Ga0055540_1023271 3300003792 Bacteria 1563
9 Ga0058692_1019240 3300003856 Bacteria 1459
10 Ga0065714_10400414 3300005288 Unclassified 590
11 Ga0065704_10002405 3300005289 Bacteria 6794
12 Ga0065712_10365792 3300005290 Bacteria 769
13 Ga0065707_10552613 3300005295 Bacteria 720
14 Ga0070661_100155022 3300005344 Unclassified 1733
15 Ga0070692_10765183 3300005345 Bacteria 656
16 Ga0070668_100058076 3300005347 Bacteria 2992
17 Ga0070668_100652279 3300005347 Bacteria 925
18 Ga0070669_101120357 3300005353 Unclassified 678
19 Ga0070667_102277839 3300005367 Unclassified 510
20 Ga0070700_101007178 3300005441 Unclassified 685
21 Ga0070662_100023044 3300005457 Bacteria 4273
22 Ga0070679_100003051 3300005530 Bacteria 15302
23 Ga0070679_101526035 3300005530 Bacteria 615
24 Ga0070665_101206482 3300005548 Bacteria 767
25 Ga0070664_100672424 3300005564 Unclassified 963
26 Ga0075363_100075672 3300006048 Bacteria 1835
27 Ga0075364_10085742 3300006051 Bacteria 2086
28 Ga0075364_10846689 3300006051 Bacteria 623
29 Ga0075362_10262784 3300006177 Bacteria 851
30 Ga0075367_10137363 3300006178 Bacteria 1513
31 Ga0075367_10506872 3300006178 Bacteria 766
32 Ga0075370_10229752 3300006353 Bacteria 1098
33 Ga0068871_101074173 3300006358 Bacteria 752
34 Ga0075428_100000042 3300006844 Bacteria 102264
35 Ga0075428_102332295 3300006844 Bacteria 550
36 Ga0075430_100043081 3300006846 Bacteria 3815
37 Ga0075431_100171852 3300006847 Bacteria 2226
38 Ga0075429_100280501 3300006880 Unclassified 1459
39 Ga0079104_1057637 3300006946 Bacteria 846
40 Ga0105244_10383688 3300009036 Bacteria 647
41 Ga0111539_10000002 3300009094 Bacteria 983359
42 Ga0111539_10093990 3300009094 Bacteria 3522
43 Ga0114129_10434160 3300009147 Unclassified 1725
44 Ga0105239_11950634 3300010375 Bacteria 681
45 Ga0157373_10076838 3300013100 Bacteria 2356
46 Ga0157373_10094716 3300013100 Bacteria 2102
47 Ga0157371_10005848 3300013102 Bacteria 10280
48 Ga0157370_10000155 3300013104 Bacteria 84680
49 Ga0157370_11812167 3300013104 Unclassified 548
50 Ga0163163_11595573 3300014325 Bacteria 713
51 Ga0214544_1000063 3300021320 Bacteria 129929
52 Ga0214542_1000095 3300021321 Bacteria 116012
53 Ga0214542_1040220 3300021321 Bacteria 1210
54 Ga0214543_1000018 3300021327 Bacteria 272335
55 Ga0214543_1000026 3300021327 Bacteria 220652
56 Ga0207425_1016723 3300025245 Bacteria 1624
57 Ga0209129_1003947 3300025258 Bacteria 6136
58 Ga0209129_1012695 3300025258 Bacteria 1909
59 Ga0209673_1002723 3300025273 Bacteria 11657
60 Ga0209025_1011274 3300025294 Bacteria 5914
61 Ga0209564_1016581 3300025295 Bacteria 2920
62 Ga0209758_1000749 3300025297 Bacteria 47284
63 Ga0209758_1001555 3300025297 Bacteria 26337
64 Ga0209050_1003685 3300025298 Bacteria 11049
65 Ga0209256_1005955 3300025299 Bacteria 6702
66 Ga0209051_1000070 3300025303 Bacteria 215616
67 Ga0209051_1028484 3300025303 Bacteria 2205
68 Ga0209257_1011502 3300025304 Bacteria 4253
69 Ga0207660_10814786 3300025917 Bacteria 762
70 Ga0207649_10132672 3300025920 Unclassified 1694
71 Ga0207652_10047762 3300025921 Bacteria 3657
72 Ga0207650_10000125 3300025925 Bacteria 96107
73 Ga0207651_11117150 3300025960 Unclassified 707
74 Ga0207668_10112208 3300025972 Bacteria 2048
75 Ga0209371_1000580 3300027312 Bacteria 32894
76 Ga0209371_1005301 3300027312 Bacteria 5185
77 Ga0209974_10004667 3300027876 Bacteria 4870
78 Ga0209974_10103690 3300027876 Unclassified 996
79 Ga0207428_10000004 3300027907 Bacteria 727800
80 Ga0268266_11005304 3300028379 Bacteria 807
81 Ga0268256_1002730 3300030500 Bacteria 8628
82 Ga0268256_1005175 3300030500 Bacteria 5185
83 Ga0307413_10023682 3300031824 Plasmid 3331
84 Ga0307413_10204659 3300031824 Bacteria 1428
85 Ga0307413_11770149 3300031824 Bacteria 552
86 Ga0307406_10192935 3300031901 Bacteria 1493
87 Ga0307407_10344134 3300031903 Bacteria 1054
88 Ga0307416_100271595 3300032002 Bacteria 1665
89 Ga0307414_10050495 3300032004 Viruses 2881
90 Ga0307414_10287541 3300032004 Bacteria 1384
91 Ga0307414_10474684 3300032004 Bacteria 1102
92 Ga0307414_10823133 3300032004 Bacteria 848
93 Ga0395898_0046159 3300037466 Bacteria 4279
94 Ga0395901_0037730 3300038443 Bacteria 4997
95 Ga0439438_000020 3300041405 Bacteria 111381
96 Ga0439438_005383 3300041405 Bacteria 4719
97 Ga0439447_000561 3300041407 Bacteria 13808
98 Ga0439447_004392 3300041407 Bacteria 4862
99 Ga0439465_0010392 3300041413 Bacteria 2924
100 Ga0439465_0021824 3300041413 Bacteria 2010
101 Ga0451791_1436861 3300041451 Bacteria 1043
102 Ga0451798_0567132 3300041458 Bacteria 1651
103 Ga0451807_0418682 3300041486 Bacteria 768
104 Ga0451833_0082307 3300041491 Bacteria 3076
105 Ga0451833_0651323 3300041491 Bacteria 850
106 Ga0451835_0083258 3300041492 Bacteria 1306
107 Ga0451837_0229831 3300041494 Bacteria 2032
108 Ga0451837_1620162 3300041494 Bacteria 2103
109 Ga0451839_0240335 3300041496 Bacteria 1996
110 Ga0451845_0336321 3300041501 Bacteria 1315
111 Ga0451847_0561852 3300041503 Bacteria 1453
112 Ga0451847_0634815 3300041503 Bacteria 2029
113 Ga0451849_0570927 3300041505 Bacteria 1966
114 Ga0451849_0930439 3300041505 Bacteria 1943
115 Ga0451849_1036258 3300041505 Bacteria 2437
116 Ga0451843_0294544 3300041509 Bacteria 6537
117 Ga0451843_0443435 3300041509 Bacteria 976
118 Ga0451855_0161294 3300041511 Bacteria 1753
119 Ga0451855_1974264 3300041511 Bacteria 967
120 Ga0439445_0026769 3300042004 Bacteria 1478
121 Ga0439432_001067 3300042006 Bacteria 10427
122 Ga0439432_017045 3300042006 Bacteria 2440
123 Ga0439449_0070418 3300042007 Bacteria 1289
124 Ga0451577_0060214 3300042876 Bacteria 3384
125 Ga0451577_0809250 3300042876 Bacteria 846
126 Ga0453684_0160841 3300044712 Bacteria 2656
127 Ga0451576_0025657 3300045051 Bacteria 6349
128 Ga0495638_0000120 3300046460 Bacteria 127382
129 Ga0495638_0022810 3300046460 Bacteria 4104
130 Ga0495650_0046412 3300046471 Bacteria 1823
131 Ga0495585_0004930 3300046492 Bacteria 8538
132 Ga0495585_0046099 3300046492 Bacteria 2432
133 Ga0495596_0060640 3300046500 Bacteria 1474
134 Ga0495607_0066653 3300046501 Bacteria 2025
135 Ga0495607_0067597 3300046501 Bacteria 2007
136 Ga0495583_0148460 3300046506 Bacteria 973
137 Ga0495583_0158611 3300046506 Bacteria 934
138 Ga0495606_0000144 3300046507 Bacteria 122857
139 Ga0495606_0000286 3300046507 Bacteria 87736
140 Ga0495606_0014184 3300046507 Bacteria 6237
141 Ga0495606_0642815 3300046507 Bacteria 514
142 Ga0495610_0013902 3300046512 Bacteria 4756
143 Ga0495620_0006859 3300046515 Bacteria 6225
144 Ga0495620_0191290 3300046515 Bacteria 789
145 Ga0495631_0274811 3300046518 Bacteria 717
146 Ga0495632_0073051 3300046519 Bacteria 1645
147 Ga0495632_0085271 3300046519 Bacteria 1503
148 Ga0495632_0188306 3300046519 Bacteria 943
149 Ga0495643_0007279 3300046522 Bacteria 7154
150 Ga0495643_0013119 3300046522 Bacteria 4975
151 Ga0495643_0094280 3300046522 Bacteria 1541
152 Ga0495648_0042778 3300046524 Bacteria 2847
153 Ga0495654_0140458 3300046530 Unclassified 1077
154 Ga0495654_0179695 3300046530 Bacteria 917
155 Ga0495609_0056160 3300046538 Bacteria 1745
156 Ga0495597_0005557 3300046542 Bacteria 6659
157 Ga0495668_0101273 3300046616 Bacteria 1576
158 Ga0495611_0262606 3300046648 Bacteria 799
159 Ga0495625_0130119 3300046660 Bacteria 1705
160 Ga0495661_0113457 3300046665 Bacteria 1507
161 Ga0495671_0102389 3300046692 Bacteria 1399
162 Ga0495649_0000188 3300046694 Bacteria 54294
163 Ga0495660_0028429 3300046810 Bacteria 3159
164 Ga0495672_0009877 3300047320 Bacteria 6861
165 Ga0495683_0018039 3300047323 Bacteria 3653
166 Ga0495687_129075 3300047443 Bacteria 898
167 Ga0495677_0252224 3300047445 Bacteria 690
168 Ga0495685_119915 3300047447 Bacteria 864
169 Ga0495681_0042402 3300047470 Bacteria 2202
170 Ga0495686_0004530 3300047472 Bacteria 11387
171 Ga0495686_0028275 3300047472 Bacteria 3652
172 Ga0495615_0020494 3300048090 Bacteria 1482
173 Ga0496106_0000125 3300048909 Bacteria 59031
174 Ga0496118_0024502 3300048921 Bacteria 5204
175 Ga0496119_0233042 3300048922 Unclassified 936
176 Ga0496121_0000115 3300048924 Bacteria 178411
177 Ga0496121_0002299 3300048924 Bacteria 29642
178 Ga0496121_0014938 3300048924 Bacteria 8180
179 Ga0496121_0027242 3300048924 Bacteria 5353
180 Ga0496121_0033053 3300048924 Bacteria 4690
181 Ga0496121_0450821 3300048924 Bacteria 829
182 Ga0496121_0475746 3300048924 Bacteria 799
183 Ga0496121_0510415 3300048924 Bacteria 761
184 Ga0496121_0825707 3300048924 Unclassified 542
185 Ga0496122_0036200 3300048925 Bacteria 3997
186 Ga0496123_0015545 3300048926 Bacteria 6236
187 Ga0496123_0308761 3300048926 Unclassified 751
188 Ga0496124_0012547 3300048927 Bacteria 8352
189 Ga0496124_0045108 3300048927 Bacteria 3780
190 Ga0496124_0279865 3300048927 Bacteria 1217
191 Ga0496125_0031962 3300048928 Bacteria 4681
192 Ga0496125_0207065 3300048928 Bacteria 1278
193 Ga0496125_0596517 3300048928 Unclassified 604
194 Ga0495678_147320 3300049459 Bacteria 764
195 Ga0495682_0295318 3300049460 Bacteria 572
196 Ga0501031_0028346 3300049568 Bacteria 3650
197 Ga0501031_0059108 3300049568 Bacteria 2499
198 Ga0501033_0526238 3300049570 Bacteria 816
199 Ga0501034_0520379 3300049571 Bacteria 1101
200 Ga0501036_0020022 3300049572 Bacteria 5618
201 Ga0501036_0076958 3300049572 Bacteria 2823
202 Ga0501037_0286892 3300049573 Bacteria 1146
203 Ga0501038_0243954 3300049574 Bacteria 1425
204 Ga0501039_0352630 3300049575 Bacteria 1156
205 Ga0501040_0077661 3300049576 Unclassified 2297
206 Ga0501040_1054836 3300049576 Unclassified 589
207 Ga0501042_1424570 3300049578 Bacteria 505
208 Ga0501043_0611866 3300049579 Bacteria 804
209 Ga0501043_1261495 3300049579 Bacteria 517
210 Ga0501047_0494736 3300049581 Bacteria 1050
211 Ga0501048_0091105 3300049582 Bacteria 2151
212 Ga0501048_0469878 3300049582 Bacteria 901
213 Ga0501067_0016842 3300049583 Bacteria 4036
214 Ga0501068_0006486 3300049584 Bacteria 6454
215 Ga0501072_0058561 3300049588 Unclassified 3037
216 Ga0501072_0589879 3300049588 Bacteria 876
217 Ga0501075_0000349 3300049591 Bacteria 26247
218 Ga0501075_0062271 3300049591 Unclassified 2812
219 Ga0501075_0147379 3300049591 Bacteria 1794
220 Ga0501077_0001165 3300049593 Bacteria 15872
221 Ga0501077_0925345 3300049593 Bacteria 561
222 Ga0501223_000100 3300049663 Bacteria 24668
223 Ga0501224_000002 3300049664 Bacteria 229331
224 Ga0501233_009311 3300049668 Bacteria 1913
225 Ga0501225_0000120 3300049705 Bacteria 24331
226 Ga0501234_000923 3300049707 Bacteria 4644
227 Ga0501079_0033597 3300049741 Bacteria 3946
228 Ga0501079_0113861 3300049741 Bacteria 2103
229 Ga0501079_0433069 3300049741 Unclassified 1032
230 Ga0501080_0029863 3300049742 Bacteria 5074
231 Ga0501081_0016555 3300049743 Bacteria 4875
232 Ga0501081_0058557 3300049743 Unclassified 2666
233 Ga0501035_0202235 3300049822 Bacteria 1703
234 Ga0501045_0047812 3300049824 Bacteria 3117
235 Ga0501226_000089 3300049853 Bacteria 25215
236 nmdc:mga03n38_205298_c1 3300050490 Bacteria 1022
237 nmdc:mga03n38_267308_c1 3300050490 Bacteria 908
238 nmdc:mga00v17_128825_c1 3300050491 Bacteria 1616
239 nmdc:mga00v17_800674_c1 3300050491 Bacteria 600
240 nmdc:mga06z11_602424_c1 3300050494 Bacteria 668
241 nmdc:mga09592_192481_c1 3300050508 Bacteria 1765
242 nmdc:mga0qj67_33909_c1 3300050509 Bacteria 3985
243 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
244 Ga0495655_0013652 3300053083 Bacteria 1685
245 Ga0500578_0046800 3300053086 Bacteria 2775
246 Ga0500644_0193663 3300053088 Bacteria 838
247 Ga0500583_0033317 3300053092 Bacteria 2279
248 Ga0500651_0223348 3300053093 Bacteria 1104
249 Ga0500651_0289079 3300053093 Bacteria 943
250 Ga0500641_0010837 3300053096 Bacteria 3304
251 Ga0500562_086119 3300053108 Bacteria 851
252 Ga0500594_0180577 3300053118 Bacteria 688
253 Ga0500618_000098 3300053125 Bacteria 71763
254 Ga0500628_087233 3300053129 Bacteria 808
255 Ga0500652_205949 3300053131 Bacteria 796
256 Ga0500658_0000376 3300053134 Bacteria 19620
257 Ga0500658_0002500 3300053134 Bacteria 7116
258 Ga0500658_0035446 3300053134 Bacteria 1975
259 Ga0500659_0226120 3300053135 Bacteria 883
260 Ga0500568_0000101 3300053139 Bacteria 78689
261 Ga0500568_0003503 3300053139 Bacteria 8713
262 Ga0500577_0282778 3300053142 Bacteria 723
263 Ga0500604_0015909 3300053151 Bacteria 2066
264 Ga0500616_0000473 3300053153 Bacteria 52175
265 Ga0500616_0026069 3300053153 Bacteria 3239
266 Ga0500616_0042681 3300053153 Bacteria 2427
267 Ga0500620_164999 3300053155 Bacteria 767
268 Ga0500622_0154985 3300053156 Bacteria 1079
269 Ga0500627_0022961 3300053158 Bacteria 2538
270 Ga0500633_0003205 3300053160 Bacteria 3522
271 Ga0500633_0184510 3300053160 Bacteria 782
272 Ga0590071_044464 3300059421 Bacteria 1071
273 Ga0590074_109364 3300059423 Bacteria 544
274 Ga0590077_129169 3300059426 Bacteria 600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0077661 Ga0501040_0077661_1786_2247 129
2 3300049591 Ga0501075_0062271 Ga0501075_0062271_1759_2220 129
3 3300049741 Ga0501079_0033597 Ga0501079_0033597_2431_2892 129
4 3300049743 Ga0501081_0058557 Ga0501081_0058557_409_870 129
5 3300049593 Ga0501077_0925345 Ga0501077_0925345_54_515 130
6 3300003856 Ga0058692_1019240 Ga0058692_10192402 135
7 3300013100 Ga0157373_10094716 Ga0157373_100947162 135
8 3300027312 Ga0209371_1000580 Ga0209371_10005802 135
9 3300030500 Ga0268256_1002730 Ga0268256_10027302 135
10 3300041405 Ga0439438_005383 Ga0439438_005383_817_1260 135
11 3300041407 Ga0439447_004392 Ga0439447_004392_4024_4467 135
12 3300042876 Ga0451577_0060214 Ga0451577_0060214_1559_2011 138
13 3300044712 Ga0453684_0160841 Ga0453684_0160841_1607_2059 138
14 3300045051 Ga0451576_0025657 Ga0451576_0025657_1842_2294 138
15 3300046507 Ga0495606_0642815 Ga0495606_0642815_70_501 139
16 iso_pu_bacteria 2857516855 2857522699 141
17 iso_pu_bacteria 2508501122 2509109974 142
18 iso_pu_bacteria 2509276019 2509378407 142
19 iso_pu_bacteria 2509276021 2509386358 142
20 iso_pu_bacteria 2509276033 2509441573 142
21 iso_pu_bacteria 2510065019 2510137661 142
22 iso_pu_bacteria 2510461076 2510893509 142
23 iso_pu_bacteria 2513237084 2513571717 142
24 iso_pu_bacteria 2513237085 2513575787 142
25 iso_pu_bacteria 2513237144 2513912942 142
26 iso_pu_bacteria 2513237162 2514019040 142
27 iso_pu_bacteria 2513237351 2514586390 142
28 iso_pu_bacteria 2515075009 2515109236 142
29 iso_pu_bacteria 2515154107 2515612548 142
30 iso_pu_bacteria 2515154113 2515633453 142
31 iso_pu_bacteria 2515154116 2515659058 142
32 iso_pu_bacteria 2515154134 2515743826 142
33 iso_pu_bacteria 2516653077 2517042370 142
34 iso_pu_bacteria 2516653085 2517081242 142
35 iso_pu_bacteria 2517287029 2517411712 142
36 iso_pu_bacteria 2524023207 2524449793 142
37 iso_pu_bacteria 2558860100 2558861789 142
38 iso_pu_bacteria 2582581294 2585205794 142
39 iso_pu_bacteria 2585427526 2585526334 142
40 iso_pu_bacteria 2585427591 2585827994 142
41 iso_pu_bacteria 2585427592 2585834924 142
42 iso_pu_bacteria 2643221634 2644195109 142
43 iso_pu_bacteria 2657244999 2657683998 142
44 iso_pu_bacteria 2718217927 2719388788 142
45 iso_pu_bacteria 2718218423 2721402513 142
46 iso_pu_bacteria 2721755809 2724034579 142
47 iso_pu_bacteria 2724679232 2725948049 142
48 iso_pu_bacteria 2738541333 2739033876 142
49 iso_pu_bacteria 2739367756 2739791054 142
50 iso_pu_bacteria 2739367756 2739791099 142
51 iso_pu_bacteria 2791355082 2792582562 142
52 iso_pu_bacteria 2791355259 2793317881 142
53 iso_pu_bacteria 2791355261 2793328580 142
54 iso_pu_bacteria 2791355267 2793368362 142
55 iso_pu_bacteria 2802429268 2804753310 142
56 iso_pu_bacteria 2802429634 2806053361 142
57 iso_pu_bacteria 2802429635 2806062402 142
58 iso_pu_bacteria 2811994881 2812366758 142
59 iso_pu_bacteria 2818991453 2819644267 142
60 iso_pu_bacteria 2838661181 2838668348 142
61 iso_pu_bacteria 2838680041 2838685667 142
62 iso_pu_bacteria 2838686498 2838688261 142
63 iso_pu_bacteria 2838694306 2838700249 142
64 iso_pu_bacteria 2838707686 2838713708 142
65 iso_pu_bacteria 2838729681 2838732440 142
66 iso_pu_bacteria 2838742623 2838745142 142
67 iso_pu_bacteria 2841851746 2841852001 142
68 iso_pu_bacteria 2841864319 2841869538 142
69 iso_pu_bacteria 2842077413 2842082879 142
70 iso_pu_bacteria 2842118031 2842123997 142
71 iso_pu_bacteria 2842156927 2842158923 142
72 iso_pu_bacteria 2842163707 2842166355 142
73 iso_pu_bacteria 2842180545 2842182537 142
74 iso_pu_bacteria 2842229732 2842232900 142
75 iso_pu_bacteria 2842237096 2842243111 142
76 iso_pu_bacteria 2842243621 2842247316 142
77 iso_pu_bacteria 2842257432 2842261593 142
78 iso_pu_bacteria 2842271015 2842272789 142
79 iso_pu_bacteria 2842291075 2842297194 142
80 iso_pu_bacteria 2842304105 2842307767 142
81 iso_pu_bacteria 2842341865 2842346246 142
82 iso_pu_bacteria 2842363717 2842368071 142
83 iso_pu_bacteria 2842370503 2842377142 142
84 iso_pu_bacteria 2842377471 2842383557 142
85 iso_pu_bacteria 2842384541 2842390550 142
86 iso_pu_bacteria 2842395702 2842399312 142
87 iso_pu_bacteria 2842805378 2842806395 142
88 iso_pu_bacteria 2844454524 2844461687 142
89 iso_pu_bacteria 2850079185 2850084163 142
90 iso_pu_bacteria 2865014394 2865017539 142
91 iso_pu_bacteria 2889914905 2889916450 142
92 iso_pu_bacteria 2898795034 2898798233 142
93 iso_pu_bacteria 2913295892 2913299829 142
94 iso_pu_bacteria 2920760137 2920764963 142
95 iso_pu_bacteria 2923519811 2923520792 142
96 iso_pu_bacteria 2929138655 2929143094 142
97 iso_pu_bacteria 2933016740 2933019610 142
98 iso_pu_bacteria 2933570622 2933574218 142
99 iso_pu_bacteria 2935894831 2935900317 142
100 iso_pu_bacteria 2935901341 2935908305 142
101 iso_pu_bacteria 2936367885 2936373780 142
102 iso_pu_bacteria 2936375103 2936377306 142
103 iso_pu_bacteria 2936996657 2937001932 142
104 iso_pu_bacteria 2996893221 2996895439 142
105 iso_pu_bacteria 3005445848 3005447516 142
106 iso_pu_bacteria 8005275841 8005276199 142
107 iso_pu_bacteria 8005307578 8005311841 142
108 iso_pu_bacteria 8005376324 8005382295 142
109 iso_pu_bacteria 8005382845 8005384350 142
110 iso_pu_bacteria 8005460587 8005466344 142
111 iso_pu_bacteria 8005695170 8005700404 142
112 iso_pu_bacteria 8018176218 8018179360 142
113 iso_pu_bacteria 8023680758 8023685849 142
114 iso_pu_bacteria 8024479707 8024486318 142
115 iso_pu_bacteria 8049293176 8049295925 142
116 iso_pu_bacteria 8054844752 8054848800 142
117 iso_pu_bacteria 8054849141 8054849364 142
118 iso_pu_bacteria 8056131705 8056134634 142
119 iso_pu_bacteria 8056375014 8056376485 142
120 iso_pu_bacteria 8057874678 8057878273 142
121 iso_pu_bacteria 2923556063 2923562485 143
122 2162886007 SwRhRL2b_contig_28845 SwRhRL2b_0860.00007090 146
123 3300002773 JGI25152J39213_1006740 JGI25152J39213_10067402 146
124 3300003187 JGI25151J46595_10047063 JGI25151J46595_100470633 146
125 3300003215 JGI25153J46596_10015751 JGI25153J46596_100157512 146
126 3300003323 rootH1_10256644 rootH1_102566442 146
127 3300003775 Ga0055524_1026250 Ga0055524_10262501 146
128 3300003790 Ga0055528_1007133 Ga0055528_10071334 146
129 3300003792 Ga0055540_1023271 Ga0055540_10232712 146
130 3300005288 Ga0065714_10400414 Ga0065714_104004141 146
131 3300005289 Ga0065704_10002405 Ga0065704_100024054 146
132 3300005290 Ga0065712_10365792 Ga0065712_103657922 146
133 3300005295 Ga0065707_10552613 Ga0065707_105526131 146
134 3300005344 Ga0070661_100155022 Ga0070661_1001550222 146
135 3300005345 Ga0070692_10765183 Ga0070692_107651831 146
136 3300005347 Ga0070668_100058076 Ga0070668_1000580762 146
137 3300005347 Ga0070668_100652279 Ga0070668_1006522791 146
138 3300005353 Ga0070669_101120357 Ga0070669_1011203571 146
139 3300005367 Ga0070667_102277839 Ga0070667_1022778391 146
140 3300005441 Ga0070700_101007178 Ga0070700_1010071781 146
141 3300005457 Ga0070662_100023044 Ga0070662_1000230444 146
142 3300005530 Ga0070679_100003051 Ga0070679_1000030512 146
143 3300005530 Ga0070679_101526035 Ga0070679_1015260352 146
144 3300005548 Ga0070665_101206482 Ga0070665_1012064821 146
145 3300005564 Ga0070664_100672424 Ga0070664_1006724242 146
146 3300006048 Ga0075363_100075672 Ga0075363_1000756722 146
147 3300006051 Ga0075364_10085742 Ga0075364_100857422 146
148 3300006051 Ga0075364_10846689 Ga0075364_108466891 146
149 3300006177 Ga0075362_10262784 Ga0075362_102627842 146
150 3300006178 Ga0075367_10137363 Ga0075367_101373632 146
151 3300006178 Ga0075367_10506872 Ga0075367_105068722 146
152 3300006353 Ga0075370_10229752 Ga0075370_102297521 146
153 3300006358 Ga0068871_101074173 Ga0068871_1010741732 146
154 3300006844 Ga0075428_100000042 Ga0075428_10000004268 146
155 3300006844 Ga0075428_102332295 Ga0075428_1023322951 146
156 3300006846 Ga0075430_100043081 Ga0075430_1000430812 146
157 3300006847 Ga0075431_100171852 Ga0075431_1001718522 146
158 3300006880 Ga0075429_100280501 Ga0075429_1002805012 146
159 3300006946 Ga0079104_1057637 Ga0079104_10576371 146
160 3300009036 Ga0105244_10383688 Ga0105244_103836882 146
161 3300009094 Ga0111539_10000002 Ga0111539_1000000268 146
162 3300009094 Ga0111539_10093990 Ga0111539_100939905 146
163 3300009147 Ga0114129_10434160 Ga0114129_104341603 146
164 3300010375 Ga0105239_11950634 Ga0105239_119506341 146
165 3300013100 Ga0157373_10076838 Ga0157373_100768383 146
166 3300013102 Ga0157371_10005848 Ga0157371_1000584811 146
167 3300013104 Ga0157370_10000155 Ga0157370_1000015538 146
168 3300013104 Ga0157370_11812167 Ga0157370_118121671 146
169 3300014325 Ga0163163_11595573 Ga0163163_115955731 146
170 3300021320 Ga0214544_1000063 Ga0214544_100006317 146
171 3300021321 Ga0214542_1000095 Ga0214542_10000957 146
172 3300021321 Ga0214542_1040220 Ga0214542_10402201 146
173 3300021327 Ga0214543_1000018 Ga0214543_1000018102 146
174 3300021327 Ga0214543_1000026 Ga0214543_10000267 146
175 3300025245 Ga0207425_1016723 Ga0207425_10167232 146
176 3300025258 Ga0209129_1003947 Ga0209129_10039477 146
177 3300025258 Ga0209129_1012695 Ga0209129_10126952 146
178 3300025273 Ga0209673_1002723 Ga0209673_10027236 146
179 3300025294 Ga0209025_1011274 Ga0209025_10112745 146
180 3300025295 Ga0209564_1016581 Ga0209564_10165812 146
181 3300025297 Ga0209758_1000749 Ga0209758_100074910 146
182 3300025297 Ga0209758_1001555 Ga0209758_10015552 146
183 3300025298 Ga0209050_1003685 Ga0209050_10036856 146
184 3300025299 Ga0209256_1005955 Ga0209256_10059557 146
185 3300025303 Ga0209051_1000070 Ga0209051_100007095 146
186 3300025303 Ga0209051_1028484 Ga0209051_10284842 146
187 3300025304 Ga0209257_1011502 Ga0209257_10115022 146
188 3300025917 Ga0207660_10814786 Ga0207660_108147862 146
189 3300025920 Ga0207649_10132672 Ga0207649_101326722 146
190 3300025921 Ga0207652_10047762 Ga0207652_100477622 146
191 3300025925 Ga0207650_10000125 Ga0207650_1000012564 146
192 3300025960 Ga0207651_11117150 Ga0207651_111171501 146
193 3300025972 Ga0207668_10112208 Ga0207668_101122083 146
194 3300027312 Ga0209371_1005301 Ga0209371_10053011 146
195 3300027876 Ga0209974_10004667 Ga0209974_100046674 146
196 3300027876 Ga0209974_10103690 Ga0209974_101036902 146
197 3300027907 Ga0207428_10000004 Ga0207428_10000004589 146
198 3300028379 Ga0268266_11005304 Ga0268266_110053042 146
199 3300030500 Ga0268256_1005175 Ga0268256_10051751 146
200 3300031824 Ga0307413_10023682 Ga0307413_100236822 146
201 3300031824 Ga0307413_10204659 Ga0307413_102046593 146
202 3300031824 Ga0307413_11770149 Ga0307413_117701491 146
203 3300031901 Ga0307406_10192935 Ga0307406_101929353 146
204 3300031903 Ga0307407_10344134 Ga0307407_103441342 146
205 3300032002 Ga0307416_100271595 Ga0307416_1002715951 146
206 3300032004 Ga0307414_10050495 Ga0307414_100504952 146
207 3300032004 Ga0307414_10287541 Ga0307414_102875411 146
208 3300032004 Ga0307414_10474684 Ga0307414_104746842 146
209 3300032004 Ga0307414_10823133 Ga0307414_108231332 146
210 3300037466 Ga0395898_0046159 Ga0395898_0046159_178_627 146
211 3300038443 Ga0395901_0037730 Ga0395901_0037730_4434_4883 146
212 3300041405 Ga0439438_000020 Ga0439438_000020_41589_42032 146
213 3300041407 Ga0439447_000561 Ga0439447_000561_12937_13380 146
214 3300041413 Ga0439465_0010392 Ga0439465_0010392_1474_1923 146
215 3300041413 Ga0439465_0021824 Ga0439465_0021824_1433_1876 146
216 3300041451 Ga0451791_1436861 Ga0451791_1436861_461_913 146
217 3300041458 Ga0451798_0567132 Ga0451798_0567132_124_576 146
218 3300041486 Ga0451807_0418682 Ga0451807_0418682_45_500 146
219 3300041491 Ga0451833_0082307 Ga0451833_0082307_1033_1485 146
220 3300041491 Ga0451833_0651323 Ga0451833_0651323_233_736 146
221 3300041492 Ga0451835_0083258 Ga0451835_0083258_519_971 146
222 3300041494 Ga0451837_0229831 Ga0451837_0229831_436_888 146
223 3300041494 Ga0451837_1620162 Ga0451837_1620162_1187_1639 146
224 3300041496 Ga0451839_0240335 Ga0451839_0240335_895_1347 146
225 3300041501 Ga0451845_0336321 Ga0451845_0336321_749_1201 146
226 3300041503 Ga0451847_0561852 Ga0451847_0561852_836_1339 146
227 3300041503 Ga0451847_0634815 Ga0451847_0634815_964_1416 146
228 3300041505 Ga0451849_0570927 Ga0451849_0570927_664_1116 146
229 3300041505 Ga0451849_0930439 Ga0451849_0930439_215_718 146
230 3300041505 Ga0451849_1036258 Ga0451849_1036258_1735_2187 146
231 3300041509 Ga0451843_0294544 Ga0451843_0294544_5736_6188 146
232 3300041509 Ga0451843_0443435 Ga0451843_0443435_241_693 146
233 3300041511 Ga0451855_0161294 Ga0451855_0161294_1025_1477 146
234 3300041511 Ga0451855_1974264 Ga0451855_1974264_82_534 146
235 3300042004 Ga0439445_0026769 Ga0439445_0026769_971_1414 146
236 3300042006 Ga0439432_001067 Ga0439432_001067_767_1210 146
237 3300042006 Ga0439432_017045 Ga0439432_017045_277_720 146
238 3300042007 Ga0439449_0070418 Ga0439449_0070418_681_1124 146
239 3300042876 Ga0451577_0809250 Ga0451577_0809250_195_635 146
240 3300046460 Ga0495638_0000120 Ga0495638_0000120_44241_44690 146
241 3300046460 Ga0495638_0022810 Ga0495638_0022810_1410_1862 146
242 3300046471 Ga0495650_0046412 Ga0495650_0046412_159_611 146
243 3300046492 Ga0495585_0004930 Ga0495585_0004930_6753_7205 146
244 3300046492 Ga0495585_0046099 Ga0495585_0046099_1037_1480 146
245 3300046500 Ga0495596_0060640 Ga0495596_0060640_551_1003 146
246 3300046501 Ga0495607_0066653 Ga0495607_0066653_666_1118 146
247 3300046501 Ga0495607_0067597 Ga0495607_0067597_1527_1979 146
248 3300046506 Ga0495583_0148460 Ga0495583_0148460_160_603 146
249 3300046506 Ga0495583_0158611 Ga0495583_0158611_330_782 146
250 3300046507 Ga0495606_0000144 Ga0495606_0000144_29868_30317 146
251 3300046507 Ga0495606_0000286 Ga0495606_0000286_16713_17159 146
252 3300046507 Ga0495606_0014184 Ga0495606_0014184_5398_5850 146
253 3300046512 Ga0495610_0013902 Ga0495610_0013902_68_520 146
254 3300046515 Ga0495620_0006859 Ga0495620_0006859_4680_5132 146
255 3300046515 Ga0495620_0191290 Ga0495620_0191290_206_649 146
256 3300046518 Ga0495631_0274811 Ga0495631_0274811_118_570 146
257 3300046519 Ga0495632_0073051 Ga0495632_0073051_585_1037 146
258 3300046519 Ga0495632_0085271 Ga0495632_0085271_334_783 146
259 3300046519 Ga0495632_0188306 Ga0495632_0188306_111_563 146
260 3300046522 Ga0495643_0007279 Ga0495643_0007279_6029_6481 146
261 3300046522 Ga0495643_0013119 Ga0495643_0013119_1123_1572 146
262 3300046522 Ga0495643_0094280 Ga0495643_0094280_543_992 146
263 3300046524 Ga0495648_0042778 Ga0495648_0042778_653_1105 146
264 3300046530 Ga0495654_0140458 Ga0495654_0140458_402_851 146
265 3300046530 Ga0495654_0179695 Ga0495654_0179695_409_861 146
266 3300046538 Ga0495609_0056160 Ga0495609_0056160_817_1269 146
267 3300046542 Ga0495597_0005557 Ga0495597_0005557_5750_6202 146
268 3300046616 Ga0495668_0101273 Ga0495668_0101273_1077_1520 146
269 3300046648 Ga0495611_0262606 Ga0495611_0262606_74_526 146
270 3300046660 Ga0495625_0130119 Ga0495625_0130119_313_765 146
271 3300046665 Ga0495661_0113457 Ga0495661_0113457_897_1349 146
272 3300046692 Ga0495671_0102389 Ga0495671_0102389_466_918 146
273 3300046694 Ga0495649_0000188 Ga0495649_0000188_28591_29040 146
274 3300046810 Ga0495660_0028429 Ga0495660_0028429_2354_2806 146
275 3300047320 Ga0495672_0009877 Ga0495672_0009877_399_848 146
276 3300047323 Ga0495683_0018039 Ga0495683_0018039_1559_2011 146
277 3300047443 Ga0495687_129075 Ga0495687_129075_138_590 146
278 3300047445 Ga0495677_0252224 Ga0495677_0252224_61_513 146
279 3300047447 Ga0495685_119915 Ga0495685_119915_67_519 146
280 3300047470 Ga0495681_0042402 Ga0495681_0042402_246_698 146
281 3300047472 Ga0495686_0004530 Ga0495686_0004530_6296_6748 146
282 3300047472 Ga0495686_0028275 Ga0495686_0028275_228_671 146
283 3300048090 Ga0495615_0020494 Ga0495615_0020494_480_932 146
284 3300048909 Ga0496106_0000125 Ga0496106_0000125_57276_57719 146
285 3300048921 Ga0496118_0024502 Ga0496118_0024502_1106_1549 146
286 3300048922 Ga0496119_0233042 Ga0496119_0233042_201_650 146
287 3300048924 Ga0496121_0000115 Ga0496121_0000115_138925_139368 146
288 3300048924 Ga0496121_0002299 Ga0496121_0002299_57_500 146
289 3300048924 Ga0496121_0014938 Ga0496121_0014938_5345_5788 146
290 3300048924 Ga0496121_0027242 Ga0496121_0027242_4483_4929 146
291 3300048924 Ga0496121_0033053 Ga0496121_0033053_260_712 146
292 3300048924 Ga0496121_0450821 Ga0496121_0450821_50_493 146
293 3300048924 Ga0496121_0475746 Ga0496121_0475746_74_526 146
294 3300048924 Ga0496121_0510415 Ga0496121_0510415_165_608 146
295 3300048924 Ga0496121_0825707 Ga0496121_0825707_55_504 146
296 3300048925 Ga0496122_0036200 Ga0496122_0036200_2977_3426 146
297 3300048926 Ga0496123_0015545 Ga0496123_0015545_546_989 146
298 3300048926 Ga0496123_0308761 Ga0496123_0308761_168_617 146
299 3300048927 Ga0496124_0012547 Ga0496124_0012547_1047_1493 146
300 3300048927 Ga0496124_0045108 Ga0496124_0045108_223_669 146
301 3300048927 Ga0496124_0279865 Ga0496124_0279865_74_520 146
302 3300048928 Ga0496125_0031962 Ga0496125_0031962_3580_4023 146
303 3300048928 Ga0496125_0207065 Ga0496125_0207065_387_839 146
304 3300048928 Ga0496125_0596517 Ga0496125_0596517_92_538 146
305 3300049459 Ga0495678_147320 Ga0495678_147320_134_583 146
306 3300049460 Ga0495682_0295318 Ga0495682_0295318_36_485 146
307 3300049568 Ga0501031_0028346 Ga0501031_0028346_2090_2536 146
308 3300049568 Ga0501031_0059108 Ga0501031_0059108_16_468 146
309 3300049570 Ga0501033_0526238 Ga0501033_0526238_322_774 146
310 3300049571 Ga0501034_0520379 Ga0501034_0520379_291_734 146
311 3300049572 Ga0501036_0020022 Ga0501036_0020022_4026_4469 146
312 3300049572 Ga0501036_0076958 Ga0501036_0076958_67_519 146
313 3300049573 Ga0501037_0286892 Ga0501037_0286892_14_457 146
314 3300049574 Ga0501038_0243954 Ga0501038_0243954_72_515 146
315 3300049575 Ga0501039_0352630 Ga0501039_0352630_382_825 146
316 3300049576 Ga0501040_1054836 Ga0501040_1054836_99_548 146
317 3300049578 Ga0501042_1424570 Ga0501042_1424570_18_470 146
318 3300049579 Ga0501043_0611866 Ga0501043_0611866_132_575 146
319 3300049579 Ga0501043_1261495 Ga0501043_1261495_34_486 146
320 3300049581 Ga0501047_0494736 Ga0501047_0494736_425_868 146
321 3300049582 Ga0501048_0091105 Ga0501048_0091105_387_830 146
322 3300049582 Ga0501048_0469878 Ga0501048_0469878_306_758 146
323 3300049583 Ga0501067_0016842 Ga0501067_0016842_2689_3129 146
324 3300049584 Ga0501068_0006486 Ga0501068_0006486_4445_4885 146
325 3300049588 Ga0501072_0058561 Ga0501072_0058561_641_1102 146
326 3300049588 Ga0501072_0589879 Ga0501072_0589879_396_848 146
327 3300049591 Ga0501075_0000349 Ga0501075_0000349_16287_16727 146
328 3300049591 Ga0501075_0147379 Ga0501075_0147379_426_875 146
329 3300049593 Ga0501077_0001165 Ga0501077_0001165_9839_10279 146
330 3300049663 Ga0501223_000100 Ga0501223_000100_7471_7917 146
331 3300049664 Ga0501224_000002 Ga0501224_000002_193698_194144 146
332 3300049668 Ga0501233_009311 Ga0501233_009311_1301_1747 146
333 3300049705 Ga0501225_0000120 Ga0501225_0000120_7602_8048 146
334 3300049707 Ga0501234_000923 Ga0501234_000923_3534_3980 146
335 3300049741 Ga0501079_0113861 Ga0501079_0113861_1522_1974 146
336 3300049741 Ga0501079_0433069 Ga0501079_0433069_535_984 146
337 3300049742 Ga0501080_0029863 Ga0501080_0029863_113_553 146
338 3300049743 Ga0501081_0016555 Ga0501081_0016555_1290_1742 146
339 3300049822 Ga0501035_0202235 Ga0501035_0202235_835_1278 146
340 3300049824 Ga0501045_0047812 Ga0501045_0047812_168_620 146
341 3300049853 Ga0501226_000089 Ga0501226_000089_3456_3902 146
342 3300050490 nmdc:mga03n38_205298_c1 nmdc:mga03n38_205298_c1_88_540 146
343 3300050490 nmdc:mga03n38_267308_c1 nmdc:mga03n38_267308_c1_317_769 146
344 3300050491 nmdc:mga00v17_128825_c1 nmdc:mga00v17_128825_c1_411_854 146
345 3300050491 nmdc:mga00v17_800674_c1 nmdc:mga00v17_800674_c1_55_498 146
346 3300050494 nmdc:mga06z11_602424_c1 nmdc:mga06z11_602424_c1_76_528 146
347 3300050508 nmdc:mga09592_192481_c1 nmdc:mga09592_192481_c1_507_959 146
348 3300050509 nmdc:mga0qj67_33909_c1 nmdc:mga0qj67_33909_c1_500_952 146
349 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_895091_895543 146
350 3300053083 Ga0495655_0013652 Ga0495655_0013652_753_1208 146
351 3300053086 Ga0500578_0046800 Ga0500578_0046800_349_801 146
352 3300053088 Ga0500644_0193663 Ga0500644_0193663_108_551 146
353 3300053092 Ga0500583_0033317 Ga0500583_0033317_621_1067 146
354 3300053093 Ga0500651_0223348 Ga0500651_0223348_644_1087 146
355 3300053093 Ga0500651_0289079 Ga0500651_0289079_291_743 146
356 3300053096 Ga0500641_0010837 Ga0500641_0010837_113_562 146
357 3300053108 Ga0500562_086119 Ga0500562_086119_53_502 146
358 3300053118 Ga0500594_0180577 Ga0500594_0180577_43_495 146
359 3300053125 Ga0500618_000098 Ga0500618_000098_24955_25401 146
360 3300053129 Ga0500628_087233 Ga0500628_087233_25_477 146
361 3300053131 Ga0500652_205949 Ga0500652_205949_79_528 146
362 3300053134 Ga0500658_0000376 Ga0500658_0000376_9318_9770 146
363 3300053134 Ga0500658_0002500 Ga0500658_0002500_112_555 146
364 3300053134 Ga0500658_0035446 Ga0500658_0035446_1224_1676 146
365 3300053135 Ga0500659_0226120 Ga0500659_0226120_199_651 146
366 3300053139 Ga0500568_0000101 Ga0500568_0000101_24514_24963 146
367 3300053139 Ga0500568_0003503 Ga0500568_0003503_5134_5577 146
368 3300053142 Ga0500577_0282778 Ga0500577_0282778_137_586 146
369 3300053151 Ga0500604_0015909 Ga0500604_0015909_507_950 146
370 3300053153 Ga0500616_0000473 Ga0500616_0000473_44307_44756 146
371 3300053153 Ga0500616_0026069 Ga0500616_0026069_1679_2167 146
372 3300053153 Ga0500616_0042681 Ga0500616_0042681_1174_1626 146
373 3300053155 Ga0500620_164999 Ga0500620_164999_146_589 146
374 3300053156 Ga0500622_0154985 Ga0500622_0154985_75_518 146
375 3300053158 Ga0500627_0022961 Ga0500627_0022961_631_1080 146
376 3300053160 Ga0500633_0003205 Ga0500633_0003205_3060_3503 146
377 3300053160 Ga0500633_0184510 Ga0500633_0184510_239_691 146
378 3300059421 Ga0590071_044464 Ga0590071_044464_428_874 146
379 3300059423 Ga0590074_109364 Ga0590074_109364_59_505 146
380 3300059426 Ga0590077_129169 Ga0590077_129169_34_480 146
381 iso_pu_bacteria 8005395548 8005401449 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04239

DUF421

YetF C-terminal domain

101

174

0.93

PF20730

YetF_N

YetF N-terminal transmembrane domain

25

98

0.89

Feature Viewer

pLDDT pTM Quality
70.91 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map