F429150

General Info

Members Datasets Scaffolds Average Seq Length
382 232 764 489

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1001247|JGI25159J45721_10012473
Length 513
Sequence MTAKCVMVLGTTSGAGKSWLTTALCRYYARQGLTVAPFKAQNMSNNARVVSPHAPPLRGSLPPEGANFSWGGPAENWVAQGEIGSAQYFQALAARAVPDVRMNPLLLKPEKDTQSQVVLMGQVNAELSRMEWRGRSASVWPVVSRALDELIANNDVVVMEGAGSPAEINLKASDIVNMRAAQHARANCLLVTDIDRGGAFAHLYGTWAMLDESERQLIKGFVLNKFRGDARLLAPGPQMLQDMTGVPTVATLPMWWQHGLPEEDGVFDDRSVTGSGGSVTRTVAVIAYPRISNLDEFQPLKNVPGVRLKWVRSPAELVDADWVILPGSKHTSGDLAWLRKQGLDEAVAAHAGRGGAVLGICGGLQMLGEALIDPHGIDGNAPGLGLLPVVTVFDEAKTVRHRQAAFTPLQGMWSALSGTEVKGYEIHHGQTAPHSAMAAAGDVAHAVMPEGLAWQNQAGNVLGLYLHGMFEDPRVLQALFGAAVPTLDSVFDGLADYIAEHFAPGVLQGLIAH

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
67 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
135 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
136 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
137 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
138 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
178 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
179 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
180 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
181 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
182 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
183 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
184 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
185 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
186 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
189 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
190 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
191 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
192 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
193 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
194 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
195 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
196 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
197 2643221658 Variovorax sp. Root411 Isolate Unclassified
198 2643221672 Variovorax sp. Root434 Isolate Unclassified
199 2643221683 Variovorax sp. Root473 Isolate Unclassified
200 2738541277 Variovorax sp. GV051 Isolate Unclassified
201 2738541307 Variovorax sp. GV008 Isolate Unclassified
202 2738543019 Variovorax sp. GV040 Isolate Unclassified
203 2818991446 Variovorax sp. 1180 Isolate Unclassified
204 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
205 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
206 2842677519 Variovorax sp. R-72495 Isolate Unclassified
207 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
208 2842733646 Variovorax sp. R-72446 Isolate Unclassified
209 2842747753 Variovorax sp. R-72060 Isolate Unclassified
210 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
211 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
212 2885198086 Variovorax sp. 679 Isolate Unclassified
213 2885211737 Variovorax sp. 553 Isolate Unclassified
214 2899924645 Variovorax sp. 369 Isolate Unclassified
215 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
216 2904456579 Variovorax sp. 2002 Isolate Unclassified
217 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
218 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
219 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
220 2928037797 Variovorax sp. 1126 Isolate Unclassified
221 2928044640 Variovorax sp. 1128 Isolate Unclassified
222 2928051484 Variovorax sp. 1133 Isolate Unclassified
223 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
224 2928070936 Variovorax gossypii 1167 Isolate Unclassified
225 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
226 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
227 2929520902 Variovorax beijingensis 502 Isolate Unclassified
228 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
229 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
230 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
231 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
232 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.22
Metatranscriptomes 0.52
Isolates 11.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 44.5
Nodule 0.79
Rhizoplane 0.79
Rhizosphere 34.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1001247 3300002987 Bacteria 10718
2 JGI24740J21852_10014319 3300001979 Bacteria 2928
3 JGI25155J39150_1000152 3300002704 Bacteria 31050
4 JGI25156J39149_1000025 3300002705 Bacteria 136287
5 JGI25156J39149_1000260 3300002705 Bacteria 36113
6 JGI25154J39366_1000045 3300002738 Bacteria 136302
7 JGI25154J39366_1001047 3300002738 Bacteria 11011
8 JGI25157J39369_1000034 3300002741 Bacteria 136301
9 JGI25157J39369_1000056 3300002741 Bacteria 107681
10 JGI25157J39369_1000100 3300002741 Bacteria 73363
11 JGI25152J39213_1001084 3300002773 Bacteria 12801
12 JGI25150J39212_1005451 3300002774 Bacteria 2713
13 JGI25159J45721_1000218 3300002987 Bacteria 27082
14 JGI25151J46595_10001992 3300003187 Bacteria 12801
15 JGI25151J46595_10002875 3300003187 Bacteria 9891
16 JGI25151J46595_10003862 3300003187 Bacteria 8105
17 JGI25151J46595_10023534 3300003187 Bacteria 2535
18 JGI25153J46596_10001751 3300003215 Bacteria 12877
19 JGI25160J50197_1000296 3300003354 Bacteria 35674
20 JGI25161J50226_1000082 3300003374 Bacteria 78461
21 Ga0006562J51391_1060824 3300003578 Bacteria 2170
22 Ga0006562J51391_1099722 3300003578 Bacteria 2130
23 Ga0055539_1000710 3300003752 Bacteria 8492
24 Ga0055539_1002086 3300003752 Bacteria 3260
25 Ga0055533_1000080 3300003756 Bacteria 131291
26 Ga0055525_1002132 3300003759 Bacteria 2282
27 Ga0055535_1000198 3300003761 Bacteria 63889
28 Ga0055535_1000507 3300003761 Bacteria 34514
29 Ga0055542_1000004 3300003762 Bacteria 553532
30 Ga0055529_1000449 3300003763 Bacteria 40616
31 Ga0055526_1002148 3300003771 Bacteria 13523
32 Ga0055526_1002361 3300003771 Bacteria 12811
33 Ga0055526_1002372 3300003771 Bacteria 12760
34 Ga0055537_1000124 3300003773 Bacteria 58656
35 Ga0055537_1000321 3300003773 Bacteria 32655
36 Ga0055537_1001002 3300003773 Bacteria 12789
37 Ga0055524_1000156 3300003775 Bacteria 79669
38 Ga0055524_1001575 3300003775 Bacteria 12811
39 Ga0055524_1004865 3300003775 Bacteria 6110
40 Ga0055536_1000570 3300003781 Bacteria 25147
41 Ga0055536_1001439 3300003781 Bacteria 14357
42 Ga0055536_1003704 3300003781 Bacteria 8108
43 Ga0055534_1000117 3300003784 Bacteria 58656
44 Ga0055534_1000961 3300003784 Bacteria 12789
45 Ga0055528_1001705 3300003790 Bacteria 12789
46 Ga0055528_1002333 3300003790 Bacteria 10267
47 Ga0055528_1003137 3300003790 Bacteria 8479
48 Ga0055530_10000338 3300003791 Bacteria 42325
49 Ga0055530_10001450 3300003791 Bacteria 17322
50 Ga0055540_1000033 3300003792 Bacteria 172048
51 Ga0055540_1000950 3300003792 Bacteria 18814
52 Ga0055540_1002405 3300003792 Bacteria 9912
53 Ga0055540_1003326 3300003792 Bacteria 7830
54 Ga0055540_1004605 3300003792 Bacteria 6124
55 Ga0055531_10000556 3300003794 Bacteria 32839
56 Ga0055531_10000702 3300003794 Bacteria 28525
57 Ga0055531_10002296 3300003794 Bacteria 12924
58 Ga0055531_10003432 3300003794 Bacteria 10110
59 Ga0055531_10005034 3300003794 Bacteria 7834
60 Ga0055543_1000983 3300004625 Bacteria 12861
61 Ga0065165_1005782 3300005262 Bacteria 6762
62 Ga0065165_1006573 3300005262 Bacteria 6050
63 Ga0065165_1016336 3300005262 Bacteria 2785
64 Ga0065165_1019670 3300005262 Bacteria 2401
65 Ga0070658_10024518 3300005327 Bacteria 4838
66 Ga0070658_10049037 3300005327 Bacteria 3421
67 Ga0070662_100019069 3300005457 Bacteria 4652
68 Ga0068853_100056816 3300005539 Bacteria 3375
69 Ga0070665_100042322 3300005548 Bacteria 4578
70 Ga0068855_100032894 3300005563 Bacteria 6191
71 Ga0068855_100088386 3300005563 Bacteria 3580
72 Ga0068857_100002192 3300005577 Bacteria 15893
73 Ga0068854_100088160 3300005578 Bacteria 2303
74 Ga0068861_100071380 3300005719 Bacteria 2691
75 Ga0068863_100126888 3300005841 Bacteria 2435
76 Ga0075365_10001430 3300006038 Bacteria 10792
77 Ga0075365_10006005 3300006038 Bacteria 6629
78 Ga0075365_10082551 3300006038 Bacteria 2179
79 Ga0075363_100016270 3300006048 Bacteria 3672
80 Ga0075363_100030716 3300006048 Bacteria 2782
81 Ga0075364_10007713 3300006051 Bacteria 6404
82 Ga0075366_10008517 3300006195 Bacteria 5706
83 Ga0075366_10016340 3300006195 Bacteria 4265
84 Ga0075370_10001817 3300006353 Bacteria 9550
85 Ga0075370_10008614 3300006353 Bacteria 5258
86 Ga0075370_10013471 3300006353 Bacteria 4348
87 Ga0105244_10001326 3300009036 Bacteria 20208
88 Ga0105240_10077662 3300009093 Bacteria 4090
89 Ga0105240_10282392 3300009093 Bacteria 1907
90 Ga0105243_10012034 3300009148 Bacteria 6543
91 Ga0105243_10022200 3300009148 Bacteria 4821
92 Ga0105242_10194161 3300009176 Bacteria 1799
93 Ga0105237_10020228 3300009545 Bacteria 6868
94 Ga0105239_10062473 3300010375 Bacteria 4088
95 Ga0105239_10302835 3300010375 Bacteria 1800
96 Ga0105246_10112398 3300011119 Bacteria 2003
97 Ga0157369_10007777 3300013105 Bacteria 12334
98 Ga0157369_10131013 3300013105 Bacteria 2657
99 Ga0182008_10000088 3300014497 Bacteria 70248
100 Ga0182008_10007282 3300014497 Bacteria 6118
101 Ga0182008_10020986 3300014497 Bacteria 3359
102 Ga0182006_1004385 3300015261 Bacteria 6972
103 Ga0182006_1005441 3300015261 Bacteria 6075
104 Ga0182007_10000996 3300015262 Bacteria 15554
105 Ga0183362_10001 3300015683 Bacteria 2046624
106 Ga0163161_10000188 3300017792 Bacteria 56743
107 Ga0163161_10013515 3300017792 Bacteria 5684
108 Ga0213872_10005989 3300021361 Bacteria 6162
109 Ga0209435_100001 3300025206 Bacteria 1424171
110 Ga0209436_103961 3300025208 Bacteria 3758
111 Ga0209674_100003 3300025226 Bacteria 2196646
112 Ga0209672_100531 3300025228 Bacteria 20822
113 Ga0209147_101524 3300025229 Bacteria 8083
114 Ga0209563_100049 3300025230 Bacteria 358472
115 Ga0209258_100022 3300025242 Bacteria 553584
116 Ga0209258_100189 3300025242 Bacteria 128268
117 Ga0209258_100668 3300025242 Bacteria 24363
118 Ga0207425_1000154 3300025245 Bacteria 58601
119 Ga0207425_1001436 3300025245 Bacteria 9971
120 Ga0207425_1006101 3300025245 Bacteria 3337
121 Ga0209646_1000001 3300025246 Bacteria 3092932
122 Ga0209646_1000124 3300025246 Bacteria 138207
123 Ga0209026_1000003 3300025250 Bacteria 1060571
124 Ga0209026_1000085 3300025250 Bacteria 185778
125 Ga0209677_100228 3300025253 Bacteria 39841
126 Ga0209677_100365 3300025253 Bacteria 27793
127 Ga0209148_1000034 3300025254 Bacteria 553584
128 Ga0209148_1003003 3300025254 Bacteria 5048
129 Ga0209759_1000001 3300025256 Bacteria 2799452
130 Ga0209759_1000068 3300025256 Bacteria 183479
131 Ga0209759_1001077 3300025256 Bacteria 17870
132 Ga0209759_1002179 3300025256 Bacteria 8972
133 Ga0209129_1000023 3300025258 Bacteria 420646
134 Ga0209129_1001302 3300025258 Bacteria 14212
135 Ga0209129_1006868 3300025258 Bacteria 3545
136 Ga0209565_1000004 3300025263 Bacteria 983150
137 Ga0209565_1000114 3300025263 Bacteria 116078
138 Ga0209565_1000125 3300025263 Bacteria 110485
139 Ga0209565_1000341 3300025263 Bacteria 41247
140 Ga0209455_1000092 3300025272 Bacteria 220516
141 Ga0209673_1000192 3300025273 Bacteria 123155
142 Ga0209673_1000572 3300025273 Bacteria 58687
143 Ga0209673_1000583 3300025273 Bacteria 57643
144 Ga0209673_1000824 3300025273 Bacteria 40796
145 Ga0209673_1006681 3300025273 Bacteria 5506
146 Ga0209130_1000041 3300025284 Bacteria 261078
147 Ga0209130_1000069 3300025284 Bacteria 179177
148 Ga0209130_1000431 3300025284 Bacteria 44964
149 Ga0209130_1000479 3300025284 Bacteria 41174
150 Ga0209675_1000029 3300025291 Bacteria 281053
151 Ga0209675_1000427 3300025291 Bacteria 34021
152 Ga0209675_1001230 3300025291 Bacteria 15418
153 Ga0209675_1003531 3300025291 Bacteria 7383
154 Ga0209675_1013919 3300025291 Bacteria 2480
155 Ga0209676_1000005 3300025292 Bacteria 1076001
156 Ga0209676_1000029 3300025292 Bacteria 520536
157 Ga0209676_1000285 3300025292 Bacteria 104459
158 Ga0209676_1000418 3300025292 Bacteria 75214
159 Ga0209676_1000614 3300025292 Bacteria 52075
160 Ga0209676_1009562 3300025292 Bacteria 4169
161 Ga0209025_1000316 3300025294 Bacteria 107447
162 Ga0209025_1000435 3300025294 Bacteria 82663
163 Ga0209025_1000652 3300025294 Bacteria 60620
164 Ga0209025_1001996 3300025294 Bacteria 23371
165 Ga0209025_1005216 3300025294 Bacteria 10722
166 Ga0209025_1013742 3300025294 Bacteria 5057
167 Ga0209025_1014708 3300025294 Bacteria 4786
168 Ga0209564_1000270 3300025295 Bacteria 108503
169 Ga0209564_1000789 3300025295 Bacteria 43729
170 Ga0209564_1001048 3300025295 Bacteria 33826
171 Ga0209564_1002285 3300025295 Bacteria 15623
172 Ga0209758_1000064 3300025297 Bacteria 311812
173 Ga0209758_1006858 3300025297 Bacteria 7965
174 Ga0209050_1000003 3300025298 Bacteria 1609245
175 Ga0209050_1000007 3300025298 Bacteria 1187891
176 Ga0209050_1001291 3300025298 Bacteria 28402
177 Ga0209050_1008926 3300025298 Bacteria 5235
178 Ga0209256_1000001 3300025299 Bacteria 2166974
179 Ga0209256_1000020 3300025299 Bacteria 542402
180 Ga0209256_1000022 3300025299 Bacteria 481843
181 Ga0207426_1000001 3300025302 Bacteria 1341301
182 Ga0207426_1000031 3300025302 Bacteria 460699
183 Ga0207426_1000061 3300025302 Bacteria 362507
184 Ga0209051_1000003 3300025303 Bacteria 1609245
185 Ga0209051_1000009 3300025303 Bacteria 706778
186 Ga0209051_1000327 3300025303 Bacteria 71493
187 Ga0209051_1000363 3300025303 Bacteria 66432
188 Ga0209051_1004144 3300025303 Bacteria 9064
189 Ga0209257_1000011 3300025304 Bacteria 1112630
190 Ga0209257_1000012 3300025304 Bacteria 1111138
191 Ga0209257_1000018 3300025304 Bacteria 836016
192 Ga0209257_1000045 3300025304 Bacteria 484429
193 Ga0209257_1000502 3300025304 Bacteria 69204
194 Ga0209257_1003803 3300025304 Bacteria 12417
195 Ga0209257_1008800 3300025304 Bacteria 5599
196 Ga0207705_10069629 3300025909 Bacteria 2549
197 Ga0207695_10043409 3300025913 Bacteria 4792
198 Ga0207650_10073178 3300025925 Bacteria 2581
199 Ga0207700_10068986 3300025928 Bacteria 2712
200 Ga0207706_10014657 3300025933 Bacteria 7099
201 Ga0207709_10000529 3300025935 Bacteria 33218
202 Ga0207709_10000794 3300025935 Bacteria 24616
203 Ga0207691_10055621 3300025940 Bacteria 3605
204 Ga0207667_10003340 3300025949 Bacteria 19799
205 Ga0207667_10144082 3300025949 Bacteria 2453
206 Ga0207651_10030389 3300025960 Bacteria 3439
207 Ga0207640_10018467 3300025981 Bacteria 4099
208 Ga0207639_10022086 3300026041 Bacteria 4580
209 Ga0207702_10039838 3300026078 Bacteria 3939
210 Ga0207674_10054256 3300026116 Bacteria 4081
211 Ga0207675_100151558 3300026118 Bacteria 2207
212 Ga0209970_1000261 3300027614 Bacteria 8663
213 Ga0209282_1002851 3300027666 Bacteria 10135
214 Ga0209282_1037315 3300027666 Bacteria 2923
215 Ga0207428_10022652 3300027907 Bacteria 5298
216 Ga0268266_10009257 3300028379 Bacteria 8689
217 Ga0265336_10000006 3300028666 Bacteria 348453
218 Ga0307517_10000805 3300028786 Bacteria 53822
219 Ga0307515_10000028 3300028794 Bacteria 368467
220 Ga0307515_10000702 3300028794 Bacteria 77364
221 Ga0316178_1149122 3300030735 Bacteria 2862
222 Ga0265330_10000247 3300031235 Bacteria 40775
223 Ga0265332_10000002 3300031238 Bacteria 709510
224 Ga0265340_10004829 3300031247 Bacteria 7499
225 Ga0265327_10016966 3300031251 Bacteria 4593
226 Ga0307513_10000012 3300031456 Bacteria 328865
227 Ga0307513_10000514 3300031456 Bacteria 55608
228 Ga0307513_10022422 3300031456 Bacteria 7425
229 Ga0307509_10002654 3300031507 Bacteria 28588
230 Ga0307509_10006788 3300031507 Bacteria 15234
231 Ga0307509_10084250 3300031507 Bacteria 3275
232 Ga0307408_100018642 3300031548 Bacteria 4662
233 Ga0307408_100035800 3300031548 Bacteria 3485
234 Ga0307408_100081801 3300031548 Bacteria 2415
235 Ga0307408_100089859 3300031548 Bacteria 2316
236 Ga0307508_10000078 3300031616 Bacteria 113416
237 Ga0307508_10003819 3300031616 Bacteria 15025
238 Ga0307508_10061494 3300031616 Bacteria 3318
239 Ga0307508_10093005 3300031616 Bacteria 2605
240 Ga0307514_10000983 3300031649 Bacteria 42321
241 Ga0307514_10062248 3300031649 Bacteria 2839
242 Ga0307514_10099375 3300031649 Bacteria 2094
243 Ga0265314_10000012 3300031711 Bacteria 415184
244 Ga0307516_10001786 3300031730 Bacteria 29553
245 Ga0307405_10031429 3300031731 Bacteria 3126
246 Ga0307414_10083918 3300032004 Bacteria 2341
247 Ga0307510_10030353 3300033180 Bacteria 6128
248 Ga0373934_0033619 3300035086 Bacteria 2013
249 Ga0373932_0006308 3300035112 Bacteria 2803
250 Ga0373931_0016147 3300035691 Bacteria 3671
251 Ga0395899_0033598 3300037312 Bacteria 3851
252 Ga0395900_0146351 3300037418 Bacteria 2415
253 Ga0395898_0009633 3300037466 Bacteria 10141
254 Ga0395898_0075769 3300037466 Bacteria 3249
255 Ga0395901_0015996 3300038443 Bacteria 7644
256 Ga0395901_0107983 3300038443 Bacteria 2921
257 Ga0395901_0140605 3300038443 Bacteria 2537
258 Ga0436361_0624839 3300039447 Bacteria 27823
259 Ga0439465_0003195 3300041413 Bacteria 5342
260 Ga0439445_0002011 3300042004 Bacteria 4489
261 Ga0439449_0000488 3300042007 Bacteria 14867
262 Ga0439449_0017923 3300042007 Bacteria 2657
263 Ga0439449_0041298 3300042007 Bacteria 1714
264 Ga0439452_002047 3300042010 Bacteria 7666
265 Ga0450911_000241 3300042115 Bacteria 20702
266 Ga0450920_003011 3300042122 Bacteria 2904
267 Ga0450918_001332 3300042531 Bacteria 4961
268 Ga0450918_006411 3300042531 Bacteria 2100
269 Ga0450893_0001676 3300042532 Bacteria 3408
270 Ga0451577_0000257 3300042876 Bacteria 104746
271 Ga0453683_0004287 3300044673 Bacteria 10174
272 Ga0466965_0035973 3300044683 Bacteria 2428
273 Ga0466965_0064771 3300044683 Bacteria 1830
274 Ga0466961_0084305 3300044693 Bacteria 2010
275 Ga0453684_0001024 3300044712 Bacteria 89721
276 Ga0466970_0008328 3300044765 Bacteria 5216
277 Ga0466970_0095060 3300044765 Bacteria 1620
278 Ga0451576_0000798 3300045051 Bacteria 61660
279 Ga0451576_0018903 3300045051 Bacteria 7532
280 Ga0451576_0117894 3300045051 Bacteria 2764
281 Ga0495627_006515 3300046453 Bacteria 4572
282 Ga0495650_0026277 3300046471 Bacteria 2711
283 Ga0495583_0001495 3300046506 Bacteria 23341
284 Ga0495606_0005658 3300046507 Bacteria 11845
285 Ga0495631_0001641 3300046518 Bacteria 13312
286 Ga0495637_0007080 3300046520 Bacteria 5585
287 Ga0495643_0021994 3300046522 Bacteria 3647
288 Ga0495656_0000088 3300046615 Bacteria 40432
289 Ga0495625_0001807 3300046660 Bacteria 24546
290 Ga0495625_0056113 3300046660 Bacteria 2805
291 Ga0495670_0060103 3300046691 Bacteria 1909
292 Ga0495671_0015826 3300046692 Bacteria 4037
293 Ga0495649_0003033 3300046694 Bacteria 11525
294 Ga0495589_0022780 3300046794 Bacteria 3194
295 Ga0495660_0055075 3300046810 Bacteria 2154
296 Ga0495686_0008817 3300047472 Bacteria 7344
297 Ga0495614_0019390 3300048089 Bacteria 2942
298 Ga0496116_0025126 3300048919 Bacteria 4387
299 Ga0496117_0060456 3300048920 Bacteria 2610
300 Ga0496118_0012621 3300048921 Bacteria 8084
301 Ga0496118_0027154 3300048921 Bacteria 4852
302 Ga0496121_0001731 3300048924 Bacteria 35624
303 Ga0496121_0122883 3300048924 Bacteria 1957
304 Ga0496122_0003061 3300048925 Bacteria 22565
305 Ga0496123_0000600 3300048926 Bacteria 61187
306 Ga0496123_0046882 3300048926 Bacteria 2926
307 Ga0496124_0106203 3300048927 Bacteria 2267
308 Ga0496125_0008502 3300048928 Bacteria 10735
309 Ga0496125_0012193 3300048928 Bacteria 8553
310 Ga0496125_0021265 3300048928 Bacteria 6059
311 Ga0496125_0082059 3300048928 Bacteria 2459
312 Ga0501262_001345 3300049759 Bacteria 2750
313 nmdc:mga03683_1517_c1 3300050489 Bacteria 6918
314 nmdc:mga03n38_39363_c1 3300050490 Bacteria 2050
315 nmdc:mga00v17_8727_c1 3300050491 Bacteria 5458
316 nmdc:mga0yw44_35748_c1 3300050492 Bacteria 2922
317 nmdc:mga0yw44_75776_c1 3300050492 Bacteria 2098
318 nmdc:mga0k408_18673_c1 3300050493 Bacteria 3873
319 nmdc:mga07m45_18721_c1 3300050496 Bacteria 3745
320 nmdc:mga07m45_37770_c1 3300050496 Bacteria 2694
321 nmdc:mga07m45_4964_c1 3300050496 Bacteria 6564
322 nmdc:mga07m45_7661_c1 3300050496 Bacteria 5523
323 Ga0500610_0005653 3300053079 Bacteria 5155
324 Ga0500610_0008605 3300053079 Bacteria 4458
325 Ga0500635_0000105 3300053080 Bacteria 50250
326 Ga0500643_028220 3300053087 Bacteria 1738
327 Ga0500651_0000259 3300053093 Bacteria 31610
328 Ga0500650_0081655 3300053098 Bacteria 1512
329 Ga0500571_000563 3300053110 Bacteria 15366
330 Ga0500593_001670 3300053117 Bacteria 7999
331 Ga0500594_0006263 3300053118 Bacteria 2670
332 Ga0500608_023883 3300053122 Bacteria 2849
333 Ga0500658_0000792 3300053134 Bacteria 13101
334 Ga0500658_0000795 3300053134 Bacteria 13078
335 Ga0500559_0006015 3300053136 Bacteria 5509
336 Ga0500636_0051668 3300053177 Bacteria 2416
337 Ga0500645_000228 3300053730 Bacteria 42875
338 Ga0500645_000878 3300053730 Bacteria 17506
339 Ga0500645_003176 3300053730 Bacteria 6830
340 2511246043 2511231002 Bacteria 5042903
341 2513231016 2513020051 Bacteria 6053213
342 2599624460 2599185214 Bacteria 8209958
343 2599672678 2599185226 Bacteria 8233575
344 2599683678 2599185227 Bacteria 8246414
345 2599694287 2599185229 Bacteria 8216126
346 2644159482 2643221628 Bacteria 5745828
347 2644328030 2643221658 Bacteria 6064537
348 2644398663 2643221672 Bacteria 6322190
349 2644468540 2643221683 Bacteria 5749203
350 2738720239 2738541277 Bacteria 7458140
351 2738881779 2738541307 Bacteria 8606193
352 2739279438 2738543019 Bacteria 7459457
353 2819595874 2818991446 Bacteria 7757362
354 2831266977 2831265667 Bacteria 7184833
355 2838057036 2838054893 Bacteria 7451788
356 2842678840 2842677519 Bacteria 5615038
357 2842720229 2842718218 Bacteria 4560148
358 2842735479 2842733646 Bacteria 5716726
359 2842751426 2842747753 Bacteria 5578255
360 2881102719 2881101125 Bacteria 4590519
361 2885192814 2885192300 Bacteria 5882526
362 2885198965 2885198086 Bacteria 7212419
363 2885212772 2885211737 Bacteria 7212420
364 2899925222 2899924645 Bacteria 7487985
365 2904454545 2904449895 Bacteria 6927402
366 2904461012 2904456579 Bacteria 6819253
367 2904544619 2904541872 Bacteria 8915136
368 2919465891 2919462493 Bacteria 5817112
369 2919704669 2919704043 Bacteria 5560311
370 2928038655 2928037797 Bacteria 7273642
371 2928045740 2928044640 Bacteria 7271509
372 2928053357 2928051484 Bacteria 7773759
373 2928066962 2928064002 Bacteria 7419480
374 2928071140 2928070936 Bacteria 8062541
375 2928084917 2928084124 Bacteria 7159212
376 2929163709 2929160207 Bacteria 9075316
377 2929526896 2929520902 Bacteria 6765052
378 2945912380 2945909444 Bacteria 7065066
379 2945948303 2945945610 Bacteria 5951079
380 2945977054 2945972063 Bacteria 6086495
381 2945985305 2945984333 Bacteria 7358892
382 2954772429 2954767861 Bacteria 5535784
383 JGI25159J45721_1001247
384 JGI24740J21852_10014319
385 JGI25155J39150_1000152
386 JGI25156J39149_1000025
387 JGI25156J39149_1000260
388 JGI25154J39366_1000045
389 JGI25154J39366_1001047
390 JGI25157J39369_1000034
391 JGI25157J39369_1000056
392 JGI25157J39369_1000100
393 JGI25152J39213_1001084
394 JGI25150J39212_1005451
395 JGI25159J45721_1000218
396 JGI25151J46595_10001992
397 JGI25151J46595_10002875
398 JGI25151J46595_10003862
399 JGI25151J46595_10023534
400 JGI25153J46596_10001751
401 JGI25160J50197_1000296
402 JGI25161J50226_1000082
403 Ga0006562J51391_1060824
404 Ga0006562J51391_1099722
405 Ga0055539_1000710
406 Ga0055539_1002086
407 Ga0055533_1000080
408 Ga0055525_1002132
409 Ga0055535_1000198
410 Ga0055535_1000507
411 Ga0055542_1000004
412 Ga0055529_1000449
413 Ga0055526_1002148
414 Ga0055526_1002361
415 Ga0055526_1002372
416 Ga0055537_1000124
417 Ga0055537_1000321
418 Ga0055537_1001002
419 Ga0055524_1000156
420 Ga0055524_1001575
421 Ga0055524_1004865
422 Ga0055536_1000570
423 Ga0055536_1001439
424 Ga0055536_1003704
425 Ga0055534_1000117
426 Ga0055534_1000961
427 Ga0055528_1001705
428 Ga0055528_1002333
429 Ga0055528_1003137
430 Ga0055530_10000338
431 Ga0055530_10001450
432 Ga0055540_1000033
433 Ga0055540_1000950
434 Ga0055540_1002405
435 Ga0055540_1003326
436 Ga0055540_1004605
437 Ga0055531_10000556
438 Ga0055531_10000702
439 Ga0055531_10002296
440 Ga0055531_10003432
441 Ga0055531_10005034
442 Ga0055543_1000983
443 Ga0065165_1005782
444 Ga0065165_1006573
445 Ga0065165_1016336
446 Ga0065165_1019670
447 Ga0070658_10024518
448 Ga0070658_10049037
449 Ga0070662_100019069
450 Ga0068853_100056816
451 Ga0070665_100042322
452 Ga0068855_100032894
453 Ga0068855_100088386
454 Ga0068857_100002192
455 Ga0068854_100088160
456 Ga0068861_100071380
457 Ga0068863_100126888
458 Ga0075365_10001430
459 Ga0075365_10006005
460 Ga0075365_10082551
461 Ga0075363_100016270
462 Ga0075363_100030716
463 Ga0075364_10007713
464 Ga0075366_10008517
465 Ga0075366_10016340
466 Ga0075370_10001817
467 Ga0075370_10008614
468 Ga0075370_10013471
469 Ga0105244_10001326
470 Ga0105240_10077662
471 Ga0105240_10282392
472 Ga0105243_10012034
473 Ga0105243_10022200
474 Ga0105242_10194161
475 Ga0105237_10020228
476 Ga0105239_10062473
477 Ga0105239_10302835
478 Ga0105246_10112398
479 Ga0157369_10007777
480 Ga0157369_10131013
481 Ga0182008_10000088
482 Ga0182008_10007282
483 Ga0182008_10020986
484 Ga0182006_1004385
485 Ga0182006_1005441
486 Ga0182007_10000996
487 Ga0183362_10001
488 Ga0163161_10000188
489 Ga0163161_10013515
490 Ga0213872_10005989
491 Ga0209435_100001
492 Ga0209436_103961
493 Ga0209674_100003
494 Ga0209672_100531
495 Ga0209147_101524
496 Ga0209563_100049
497 Ga0209258_100022
498 Ga0209258_100189
499 Ga0209258_100668
500 Ga0207425_1000154
501 Ga0207425_1001436
502 Ga0207425_1006101
503 Ga0209646_1000001
504 Ga0209646_1000124
505 Ga0209026_1000003
506 Ga0209026_1000085
507 Ga0209677_100228
508 Ga0209677_100365
509 Ga0209148_1000034
510 Ga0209148_1003003
511 Ga0209759_1000001
512 Ga0209759_1000068
513 Ga0209759_1001077
514 Ga0209759_1002179
515 Ga0209129_1000023
516 Ga0209129_1001302
517 Ga0209129_1006868
518 Ga0209565_1000004
519 Ga0209565_1000114
520 Ga0209565_1000125
521 Ga0209565_1000341
522 Ga0209455_1000092
523 Ga0209673_1000192
524 Ga0209673_1000572
525 Ga0209673_1000583
526 Ga0209673_1000824
527 Ga0209673_1006681
528 Ga0209130_1000041
529 Ga0209130_1000069
530 Ga0209130_1000431
531 Ga0209130_1000479
532 Ga0209675_1000029
533 Ga0209675_1000427
534 Ga0209675_1001230
535 Ga0209675_1003531
536 Ga0209675_1013919
537 Ga0209676_1000005
538 Ga0209676_1000029
539 Ga0209676_1000285
540 Ga0209676_1000418
541 Ga0209676_1000614
542 Ga0209676_1009562
543 Ga0209025_1000316
544 Ga0209025_1000435
545 Ga0209025_1000652
546 Ga0209025_1001996
547 Ga0209025_1005216
548 Ga0209025_1013742
549 Ga0209025_1014708
550 Ga0209564_1000270
551 Ga0209564_1000789
552 Ga0209564_1001048
553 Ga0209564_1002285
554 Ga0209758_1000064
555 Ga0209758_1006858
556 Ga0209050_1000003
557 Ga0209050_1000007
558 Ga0209050_1001291
559 Ga0209050_1008926
560 Ga0209256_1000001
561 Ga0209256_1000020
562 Ga0209256_1000022
563 Ga0207426_1000001
564 Ga0207426_1000031
565 Ga0207426_1000061
566 Ga0209051_1000003
567 Ga0209051_1000009
568 Ga0209051_1000327
569 Ga0209051_1000363
570 Ga0209051_1004144
571 Ga0209257_1000011
572 Ga0209257_1000012
573 Ga0209257_1000018
574 Ga0209257_1000045
575 Ga0209257_1000502
576 Ga0209257_1003803
577 Ga0209257_1008800
578 Ga0207705_10069629
579 Ga0207695_10043409
580 Ga0207650_10073178
581 Ga0207700_10068986
582 Ga0207706_10014657
583 Ga0207709_10000529
584 Ga0207709_10000794
585 Ga0207691_10055621
586 Ga0207667_10003340
587 Ga0207667_10144082
588 Ga0207651_10030389
589 Ga0207640_10018467
590 Ga0207639_10022086
591 Ga0207702_10039838
592 Ga0207674_10054256
593 Ga0207675_100151558
594 Ga0209970_1000261
595 Ga0209282_1002851
596 Ga0209282_1037315
597 Ga0207428_10022652
598 Ga0268266_10009257
599 Ga0265336_10000006
600 Ga0307517_10000805
601 Ga0307515_10000028
602 Ga0307515_10000702
603 Ga0316178_1149122
604 Ga0265330_10000247
605 Ga0265332_10000002
606 Ga0265340_10004829
607 Ga0265327_10016966
608 Ga0307513_10000012
609 Ga0307513_10000514
610 Ga0307513_10022422
611 Ga0307509_10002654
612 Ga0307509_10006788
613 Ga0307509_10084250
614 Ga0307408_100018642
615 Ga0307408_100035800
616 Ga0307408_100081801
617 Ga0307408_100089859
618 Ga0307508_10000078
619 Ga0307508_10003819
620 Ga0307508_10061494
621 Ga0307508_10093005
622 Ga0307514_10000983
623 Ga0307514_10062248
624 Ga0307514_10099375
625 Ga0265314_10000012
626 Ga0307516_10001786
627 Ga0307405_10031429
628 Ga0307414_10083918
629 Ga0307510_10030353
630 Ga0373934_0033619
631 Ga0373932_0006308
632 Ga0373931_0016147
633 Ga0395899_0033598
634 Ga0395900_0146351
635 Ga0395898_0009633
636 Ga0395898_0075769
637 Ga0395901_0015996
638 Ga0395901_0107983
639 Ga0395901_0140605
640 Ga0436361_0624839
641 Ga0439465_0003195
642 Ga0439445_0002011
643 Ga0439449_0000488
644 Ga0439449_0017923
645 Ga0439449_0041298
646 Ga0439452_002047
647 Ga0450911_000241
648 Ga0450920_003011
649 Ga0450918_001332
650 Ga0450918_006411
651 Ga0450893_0001676
652 Ga0451577_0000257
653 Ga0453683_0004287
654 Ga0466965_0035973
655 Ga0466965_0064771
656 Ga0466961_0084305
657 Ga0453684_0001024
658 Ga0466970_0008328
659 Ga0466970_0095060
660 Ga0451576_0000798
661 Ga0451576_0018903
662 Ga0451576_0117894
663 Ga0495627_006515
664 Ga0495650_0026277
665 Ga0495583_0001495
666 Ga0495606_0005658
667 Ga0495631_0001641
668 Ga0495637_0007080
669 Ga0495643_0021994
670 Ga0495656_0000088
671 Ga0495625_0001807
672 Ga0495625_0056113
673 Ga0495670_0060103
674 Ga0495671_0015826
675 Ga0495649_0003033
676 Ga0495589_0022780
677 Ga0495660_0055075
678 Ga0495686_0008817
679 Ga0495614_0019390
680 Ga0496116_0025126
681 Ga0496117_0060456
682 Ga0496118_0012621
683 Ga0496118_0027154
684 Ga0496121_0001731
685 Ga0496121_0122883
686 Ga0496122_0003061
687 Ga0496123_0000600
688 Ga0496123_0046882
689 Ga0496124_0106203
690 Ga0496125_0008502
691 Ga0496125_0012193
692 Ga0496125_0021265
693 Ga0496125_0082059
694 Ga0501262_001345
695 nmdc:mga03683_1517_c1
696 nmdc:mga03n38_39363_c1
697 nmdc:mga00v17_8727_c1
698 nmdc:mga0yw44_35748_c1
699 nmdc:mga0yw44_75776_c1
700 nmdc:mga0k408_18673_c1
701 nmdc:mga07m45_18721_c1
702 nmdc:mga07m45_37770_c1
703 nmdc:mga07m45_4964_c1
704 nmdc:mga07m45_7661_c1
705 Ga0500610_0005653
706 Ga0500610_0008605
707 Ga0500635_0000105
708 Ga0500643_028220
709 Ga0500651_0000259
710 Ga0500650_0081655
711 Ga0500571_000563
712 Ga0500593_001670
713 Ga0500594_0006263
714 Ga0500608_023883
715 Ga0500658_0000792
716 Ga0500658_0000795
717 Ga0500559_0006015
718 Ga0500636_0051668
719 Ga0500645_000228
720 Ga0500645_000878
721 Ga0500645_003176
722 2511246043
723 2513231016
724 2599624460
725 2599672678
726 2599683678
727 2599694287
728 2644159482
729 2644328030
730 2644398663
731 2644468540
732 2738720239
733 2738881779
734 2739279438
735 2819595874
736 2831266977
737 2838057036
738 2842678840
739 2842720229
740 2842735479
741 2842751426
742 2881102719
743 2885192814
744 2885198965
745 2885212772
746 2899925222
747 2904454545
748 2904461012
749 2904544619
750 2919465891
751 2919704669
752 2928038655
753 2928045740
754 2928053357
755 2928066962
756 2928071140
757 2928084917
758 2929163709
759 2929526896
760 2945912380
761 2945948303
762 2945977054
763 2945985305
764 2954772429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

6

258

0.94

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

282

475

0.92

PF13500

AAA_26

AAA domain

85

259

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a82-assembly1.cif.gz_A dethiobiotin synthetase from escherichia coli, complex with substrates atp and diaminopelargonic acid 0.7652 30 255
5gq1-assembly1.cif.gz_F crystal structure of 2c helicase from enterovirus 71 (ev71) 0.764 29 62
1dts-assembly1.cif.gz_A-2 crystal structure of an atp dependent carboxylase, dethiobiotin synthase, at 1.65 angstroms resolution 0.7549 30 256
3l4e-assembly1.cif.gz_A 1.5a crystal structure of a putative peptidase e protein from listeria monocytogenes egd-e 0.7539 272 384
1dae-assembly1.cif.gz_A dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid 0.7508 30 254
ID Description Score Start End Superfamily
af_Q57908_3_246_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.958 31 264 3.40.50.300
af_P9WP95_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9344 32 263 3.40.50.300
af_Q57908_3_246_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.916 31 264 3.40.50.300
af_P9WP95_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9043 32 263 3.40.50.300
af_P9WP95_251_442_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8607 275 479 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7X6DED3-F1-model_v4 CobB/CobQ-like glutamine amidotransferase domain-containing protein 0.9843 278 475 GO:0003824
GO:0006541
GO:0009236
AF-A0A2T7SRX1-F1-model_v4 Cobyric acid synthase 0.9783 28 506 GO:0003824
GO:0006541
GO:0009236
GO:0015420
AF-A0A2M7FSP3-F1-model_v4 Cobyric acid synthase CobQ 0.9765 28 158 GO:0009236
AF-A0A382IBL4-F1-model_v4 CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein 0.9581 37 124 GO:0009236
AF-A0A2J1DV17-F1-model_v4 Cobyric acid synthase CobQ 0.9576 30 161 GO:0009236

Map