F429164

General Info

Members Datasets Scaffolds Average Seq Length
382 197 382 279

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10000499|Ga0065712_100004996
Length 304
Sequence MAVSMSRPCPPGRAGPTARARRRVAVRIAFQGESGAYSEAAAIRFSDHADLLPCESFDDVFTAVATGKATHGILPVENSIGGSIHRNYDLLLEHDLPIVGEVVLDITHNLLVLPGTTMEQVKKIYSHPQALAQCERFLRSLPGVSVEATYDTAGSAKLVKEKGLKDAAAIASDRAAQVFGLEILKPEIQDFSDNITRFLIVSRTADSDLQADKTTVVFSLPNEPGSLFKALSVFALREIDLTKIESRPIRGRPWEYLFYVDLPVGRHDLRCARALVHLAEFARSMRTLGSYPSWKGRDAAQQAS

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 8.12
Rhizosphere 90.84
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10146053 3300005288 Bacteria 1137
2 Ga0065704_10089167 3300005289 Bacteria 2867
3 Ga0065712_10000499 3300005290 Bacteria 10768
4 Ga0065715_10091975 3300005293 Bacteria 5419
5 Ga0065715_10158174 3300005293 Bacteria 1648
6 Ga0065707_10003467 3300005295 Bacteria 7313
7 Ga0065707_10082698 3300005295 Bacteria 12670
8 Ga0065707_10104865 3300005295 Bacteria 2675
9 Ga0070676_10055507 3300005328 Bacteria 2338
10 Ga0070670_100012457 3300005331 Bacteria 7278
11 Ga0068869_100157943 3300005334 Bacteria 1763
12 Ga0070666_10154297 3300005335 Bacteria 1603
13 Ga0068868_100064474 3300005338 Bacteria 2908
14 Ga0070687_100215900 3300005343 Bacteria 1172
15 Ga0070668_100051417 3300005347 Bacteria 3175
16 Ga0070669_100181244 3300005353 Bacteria 1648
17 Ga0070669_100377381 3300005353 Unclassified 1156
18 Ga0070675_100000055 3300005354 Bacteria 68147
19 Ga0070675_100028939 3300005354 Bacteria 4464
20 Ga0070675_100103571 3300005354 Bacteria 2400
21 Ga0070674_100005939 3300005356 Bacteria 7099
22 Ga0070673_100043757 3300005364 Bacteria 3463
23 Ga0070673_100065379 3300005364 Bacteria 2901
24 Ga0070688_100083245 3300005365 Bacteria 2076
25 Ga0070688_100087175 3300005365 Bacteria 2033
26 Ga0070659_100222522 3300005366 Unclassified 1558
27 Ga0070709_10292108 3300005434 Unclassified 1188
28 Ga0070705_100086011 3300005440 Bacteria 1945
29 Ga0070700_100002552 3300005441 Bacteria 9292
30 Ga0070700_100065530 3300005441 Bacteria 2304
31 Ga0070694_100017695 3300005444 Bacteria 4505
32 Ga0070678_100055178 3300005456 Bacteria 2900
33 Ga0070662_100088024 3300005457 Bacteria 2327
34 Ga0068867_100012999 3300005459 Bacteria 5891
35 Ga0068867_100265147 3300005459 Bacteria 1402
36 Ga0068867_100276860 3300005459 Bacteria 1374
37 Ga0070706_100122217 3300005467 Bacteria 2427
38 Ga0070706_100172088 3300005467 Bacteria 2022
39 Ga0070706_100274823 3300005467 Bacteria 1572
40 Ga0070698_100120610 3300005471 Bacteria 2583
41 Ga0070698_100135947 3300005471 Bacteria 2412
42 Ga0070699_100122629 3300005518 Bacteria 2287
43 Ga0070697_100251062 3300005536 Bacteria 1513
44 Ga0068853_100149579 3300005539 Bacteria 2101
45 Ga0070672_100059519 3300005543 Bacteria 3006
46 Ga0070672_100074386 3300005543 Bacteria 2710
47 Ga0070672_100226642 3300005543 Bacteria 1569
48 Ga0070686_100278717 3300005544 Bacteria 1232
49 Ga0070695_100075267 3300005545 Bacteria 2220
50 Ga0070696_100047931 3300005546 Bacteria 2966
51 Ga0070696_100098744 3300005546 Bacteria 2089
52 Ga0070665_100039464 3300005548 Bacteria 4746
53 Ga0070665_100074672 3300005548 Bacteria 3396
54 Ga0070665_100087855 3300005548 Bacteria 3114
55 Ga0070704_100196367 3300005549 Bacteria 1626
56 Ga0070664_100193685 3300005564 Bacteria 1812
57 Ga0068857_100487316 3300005577 Unclassified 1156
58 Ga0068854_100187781 3300005578 Bacteria 1618
59 Ga0068864_100010173 3300005618 Bacteria 7766
60 Ga0068864_100023531 3300005618 Bacteria 5174
61 Ga0068864_100844910 3300005618 Unclassified 902
62 Ga0068866_10141737 3300005718 Bacteria 1380
63 Ga0068861_100010150 3300005719 Bacteria 6531
64 Ga0068861_100065383 3300005719 Bacteria 2801
65 Ga0068861_100162426 3300005719 Unclassified 1844
66 Ga0068870_10034430 3300005840 Bacteria 2592
67 Ga0068863_100034633 3300005841 Bacteria 4809
68 Ga0068858_100088165 3300005842 Bacteria 2887
69 Ga0068858_100223044 3300005842 Bacteria 1786
70 Ga0068858_100342719 3300005842 Bacteria 1430
71 Ga0068860_100355723 3300005843 Bacteria 1442
72 Ga0068862_100011943 3300005844 Bacteria 7175
73 Ga0068862_100022261 3300005844 Bacteria 5300
74 Ga0068862_100081420 3300005844 Bacteria 2809
75 Ga0068862_100105072 3300005844 Bacteria 2475
76 Ga0081539_10006740 3300005985 Bacteria 10790
77 Ga0070717_10255229 3300006028 Bacteria 1550
78 Ga0097621_100005339 3300006237 Bacteria 9047
79 Ga0097621_100120978 3300006237 Bacteria 2220
80 Ga0097621_100188220 3300006237 Bacteria 1786
81 Ga0068871_100027187 3300006358 Bacteria 4472
82 Ga0068871_100027882 3300006358 Bacteria 4422
83 Ga0068871_100087360 3300006358 Bacteria 2592
84 Ga0075428_100000023 3300006844 Bacteria 127355
85 Ga0075428_100195667 3300006844 Bacteria 2186
86 Ga0075430_100266314 3300006846 Bacteria 1419
87 Ga0075431_100012779 3300006847 Bacteria 8476
88 Ga0075433_10073877 3300006852 Bacteria 3000
89 Ga0075433_10116441 3300006852 Bacteria 2371
90 Ga0075433_10200186 3300006852 Bacteria 1776
91 Ga0075433_10207426 3300006852 Bacteria 1742
92 Ga0075434_100044270 3300006871 Bacteria 4416
93 Ga0075429_100000776 3300006880 Bacteria 25168
94 Ga0075429_100001599 3300006880 Bacteria 18676
95 Ga0068865_100027675 3300006881 Bacteria 3747
96 Ga0068865_100601863 3300006881 Bacteria 929
97 Ga0075436_100026589 3300006914 Bacteria 3984
98 Ga0075436_100046415 3300006914 Bacteria 2995
99 Ga0075436_100162661 3300006914 Bacteria 1574
100 Ga0075436_100264502 3300006914 Bacteria 1227
101 Ga0075436_100347848 3300006914 Bacteria 1068
102 Ga0075435_100008984 3300007076 Bacteria 7207
103 Ga0111539_10000001 3300009094 Bacteria 1035431
104 Ga0111539_10034811 3300009094 Bacteria 6102
105 Ga0111539_10066177 3300009094 Unclassified 4268
106 Ga0105245_10279994 3300009098 Bacteria 1629
107 Ga0105245_10365608 3300009098 Bacteria 1433
108 Ga0105245_10898399 3300009098 Bacteria 927
109 Ga0105247_10145250 3300009101 Bacteria 1558
110 Ga0114129_10000824 3300009147 Bacteria 40007
111 Ga0114129_10010381 3300009147 Bacteria 13281
112 Ga0114129_10011848 3300009147 Bacteria 12402
113 Ga0114129_10046542 3300009147 Bacteria 6095
114 Ga0114129_10481596 3300009147 Bacteria 1623
115 Ga0114129_10766180 3300009147 Bacteria 1234
116 Ga0105243_10028030 3300009148 Bacteria 4320
117 Ga0105243_10154113 3300009148 Bacteria 1974
118 Ga0105243_10215974 3300009148 Bacteria 1692
119 Ga0105242_10113581 3300009176 Bacteria 2313
120 Ga0105242_10212851 3300009176 Bacteria 1723
121 Ga0105242_10258190 3300009176 Bacteria 1573
122 Ga0105242_10259190 3300009176 Bacteria 1570
123 Ga0105242_10301731 3300009176 Bacteria 1462
124 Ga0105248_10055164 3300009177 Bacteria 4457
125 Ga0105248_10061183 3300009177 Bacteria 4227
126 Ga0105248_10318092 3300009177 Bacteria 1753
127 Ga0105249_10085628 3300009553 Bacteria 2937
128 Ga0105249_10287579 3300009553 Bacteria 1644
129 Ga0105249_10917682 3300009553 Bacteria 943
130 Ga0157374_10147199 3300013296 Bacteria 2288
131 Ga0163162_10231573 3300013306 Bacteria 1978
132 Ga0163162_10267587 3300013306 Bacteria 1841
133 Ga0163162_10271698 3300013306 Bacteria 1827
134 Ga0157372_10068488 3300013307 Bacteria 3990
135 Ga0157375_10510283 3300013308 Bacteria 1366
136 Ga0163163_10004562 3300014325 Bacteria 11825
137 Ga0163163_10334065 3300014325 Bacteria 1570
138 Ga0157380_10031428 3300014326 Bacteria 4076
139 Ga0157380_10201326 3300014326 Bacteria 1767
140 Ga0157380_10454802 3300014326 Bacteria 1231
141 Ga0157379_10586599 3300014968 Unclassified 1039
142 Ga0157379_10688831 3300014968 Bacteria 959
143 Ga0157376_10052610 3300014969 Bacteria 3387
144 Ga0157376_10072558 3300014969 Bacteria 2929
145 Ga0157376_10167651 3300014969 Bacteria 1997
146 Ga0157376_10384260 3300014969 Bacteria 1353
147 Ga0163161_10025344 3300017792 Bacteria 4197
148 Ga0207642_10008723 3300025899 Bacteria 3495
149 Ga0207642_10050210 3300025899 Bacteria 1880
150 Ga0207642_10121157 3300025899 Bacteria 1349
151 Ga0207647_10097640 3300025904 Bacteria 1746
152 Ga0207699_10084070 3300025906 Bacteria 1981
153 Ga0207645_10005828 3300025907 Bacteria 8881
154 Ga0207645_10067925 3300025907 Bacteria 2279
155 Ga0207643_10028693 3300025908 Bacteria 3093
156 Ga0207654_10122716 3300025911 Bacteria 1634
157 Ga0207662_10133902 3300025918 Bacteria 1565
158 Ga0207681_10023489 3300025923 Bacteria 3944
159 Ga0207681_10056959 3300025923 Bacteria 2668
160 Ga0207681_10069791 3300025923 Bacteria 2445
161 Ga0207681_10093565 3300025923 Bacteria 2152
162 Ga0207681_10116388 3300025923 Bacteria 1953
163 Ga0207650_10014626 3300025925 Bacteria 5450
164 Ga0207650_10148831 3300025925 Bacteria 1846
165 Ga0207659_10001583 3300025926 Bacteria 13492
166 Ga0207659_10040945 3300025926 Bacteria 3243
167 Ga0207659_10283171 3300025926 Bacteria 1356
168 Ga0207687_10230781 3300025927 Bacteria 1462
169 Ga0207664_10124691 3300025929 Bacteria 2161
170 Ga0207644_10067061 3300025931 Bacteria 2615
171 Ga0207706_10074221 3300025933 Bacteria 2991
172 Ga0207706_10204943 3300025933 Unclassified 1729
173 Ga0207686_10075178 3300025934 Bacteria 2186
174 Ga0207686_10112514 3300025934 Bacteria 1839
175 Ga0207686_10194200 3300025934 Bacteria 1449
176 Ga0207686_10219569 3300025934 Bacteria 1372
177 Ga0207709_10004342 3300025935 Bacteria 8205
178 Ga0207709_10037191 3300025935 Bacteria 2891
179 Ga0207709_10199028 3300025935 Bacteria 1429
180 Ga0207670_10150790 3300025936 Bacteria 1725
181 Ga0207670_10213755 3300025936 Bacteria 1472
182 Ga0207669_10072170 3300025937 Bacteria 2172
183 Ga0207704_10004287 3300025938 Bacteria 6517
184 Ga0207704_10064095 3300025938 Bacteria 2294
185 Ga0207691_10203695 3300025940 Bacteria 1721
186 Ga0207711_10012271 3300025941 Bacteria 7124
187 Ga0207711_10134276 3300025941 Bacteria 2221
188 Ga0207711_10245186 3300025941 Bacteria 1644
189 Ga0207711_10287765 3300025941 Bacteria 1514
190 Ga0207711_10527926 3300025941 Bacteria 1101
191 Ga0207689_10078486 3300025942 Bacteria 2713
192 Ga0207679_10078152 3300025945 Bacteria 2520
193 Ga0207679_10286348 3300025945 Bacteria 1415
194 Ga0207651_10005977 3300025960 Bacteria 6307
195 Ga0207651_10058661 3300025960 Bacteria 2661
196 Ga0207651_10165934 3300025960 Bacteria 1736
197 Ga0207712_10032625 3300025961 Bacteria 3515
198 Ga0207712_10127230 3300025961 Bacteria 1936
199 Ga0207712_10294422 3300025961 Bacteria 1330
200 Ga0207668_10146215 3300025972 Bacteria 1824
201 Ga0207703_10044937 3300026035 Bacteria 3552
202 Ga0207703_10136516 3300026035 Bacteria 2124
203 Ga0207703_10163908 3300026035 Bacteria 1949
204 Ga0207703_10372200 3300026035 Bacteria 1320
205 Ga0207639_10079638 3300026041 Bacteria 2590
206 Ga0207678_10079314 3300026067 Bacteria 2812
207 Ga0207708_10004696 3300026075 Bacteria 10049
208 Ga0207708_10112907 3300026075 Bacteria 2111
209 Ga0207708_10225644 3300026075 Bacteria 1502
210 Ga0207641_10052788 3300026088 Bacteria 3444
211 Ga0207641_10192265 3300026088 Bacteria 1876
212 Ga0207641_10395692 3300026088 Bacteria 1326
213 Ga0207648_10018612 3300026089 Bacteria 6284
214 Ga0207648_10054597 3300026089 Bacteria 3489
215 Ga0207648_10157980 3300026089 Bacteria 2002
216 Ga0207648_10390508 3300026089 Bacteria 1259
217 Ga0207676_10006059 3300026095 Bacteria 8532
218 Ga0207676_10015116 3300026095 Bacteria 5566
219 Ga0207676_10059047 3300026095 Bacteria 3028
220 Ga0207676_10073193 3300026095 Bacteria 2757
221 Ga0207675_100022777 3300026118 Bacteria 5829
222 Ga0207675_100069427 3300026118 Bacteria 3293
223 Ga0207675_100129740 3300026118 Bacteria 2390
224 Ga0207675_100196269 3300026118 Bacteria 1937
225 Ga0207683_10152271 3300026121 Bacteria 2087
226 Ga0209971_1001642 3300027682 Bacteria 5536
227 Ga0207428_10000002 3300027907 Bacteria 854851
228 Ga0268266_10029291 3300028379 Bacteria 4681
229 Ga0268266_10058985 3300028379 Bacteria 3306
230 Ga0268266_10061775 3300028379 Bacteria 3231
231 Ga0268266_10293598 3300028379 Bacteria 1514
232 Ga0268265_10030955 3300028380 Bacteria 3860
233 Ga0268265_10070879 3300028380 Bacteria 2712
234 Ga0268265_10170512 3300028380 Bacteria 1859
235 Ga0268264_10200751 3300028381 Bacteria 1824
236 Ga0265322_10024113 3300028654 Bacteria 1739
237 Ga0307408_100206662 3300031548 Bacteria 1593
238 Ga0316578_10113871 3300031728 Bacteria 1625
239 Ga0307405_10020102 3300031731 Bacteria 3725
240 Ga0307407_10063832 3300031903 Bacteria 2162
241 Ga0307409_100220826 3300031995 Bacteria 1711
242 Ga0307409_100387369 3300031995 Bacteria 1331
243 Ga0307416_100011098 3300032002 Bacteria 5991
244 Ga0307416_100166099 3300032002 Bacteria 2047
245 Ga0307416_100362948 3300032002 Bacteria 1471
246 Ga0307411_10231786 3300032005 Bacteria 1440
247 Ga0307415_100072822 3300032126 Bacteria 2421
248 Ga0373945_0038512 3300035116 Bacteria 1720
249 Ga0373957_0196344 3300035120 Bacteria 840
250 Ga0373943_0026948 3300035170 Bacteria 2696
251 Ga0373943_0045416 3300035170 Bacteria 2141
252 Ga0316574_0152224 3300035398 Bacteria 1490
253 Ga0373947_0007317 3300035725 Bacteria 6393
254 Ga0316584_0308213 3300036712 Bacteria 1145
255 Ga0373925_0002833 3300037068 Bacteria 13683
256 Ga0373925_0109503 3300037068 Bacteria 2132
257 Ga0436363_0908313 3300039450 Bacteria 3468
258 Ga0450895_000635 3300042132 Bacteria 2123
259 Ga0439434_0097348 3300042435 Bacteria 946
260 Ga0450918_023613 3300042531 Unclassified 1075
261 Ga0451577_0008835 3300042876 Bacteria 9756
262 Ga0451577_0358250 3300042876 Unclassified 1323
263 Ga0453683_0000448 3300044673 Bacteria 47323
264 Ga0453683_0011648 3300044673 Bacteria 5792
265 Ga0453684_0000007 3300044712 Bacteria 1301482
266 Ga0453684_0000797 3300044712 Bacteria 107625
267 Ga0453684_0006052 3300044712 Bacteria 23377
268 Ga0453684_0014626 3300044712 Bacteria 12526
269 Ga0453684_0044884 3300044712 Bacteria 5905
270 Ga0453684_0181042 3300044712 Bacteria 2474
271 Ga0453684_0296548 3300044712 Bacteria 1839
272 Ga0453684_0354950 3300044712 Bacteria 1652
273 Ga0453684_0724813 3300044712 Unclassified 1078
274 Ga0466959_0299598 3300045049 Unclassified 1101
275 Ga0451576_0005261 3300045051 Bacteria 16335
276 Ga0451576_0025131 3300045051 Bacteria 6422
277 Ga0451576_0059035 3300045051 Bacteria 4006
278 Ga0451576_0185512 3300045051 Bacteria 2172
279 Ga0466958_0116683 3300045836 Bacteria 1669
280 Ga0466967_0332720 3300045976 Bacteria 1467
281 Ga0495603_0271873 3300046455 Bacteria 975
282 Ga0495586_0089266 3300046535 Bacteria 1701
283 Ga0495634_0127554 3300046642 Bacteria 1625
284 Ga0495634_0135529 3300046642 Bacteria 1567
285 Ga0495634_0148001 3300046642 Bacteria 1487
286 Ga0495658_0049973 3300046683 Unclassified 2364
287 Ga0495680_0329176 3300047322 Bacteria 1068
288 Ga0496101_0087340 3300048904 Bacteria 2315
289 Ga0496104_0001478 3300048907 Bacteria 20272
290 Ga0496104_0003893 3300048907 Bacteria 12924
291 Ga0496104_0141448 3300048907 Bacteria 2312
292 Ga0496105_0094130 3300048908 Bacteria 2474
293 Ga0496105_0108195 3300048908 Bacteria 2295
294 Ga0496106_0026201 3300048909 Bacteria 4339
295 Ga0496106_0155390 3300048909 Bacteria 1806
296 Ga0496107_0083450 3300048910 Bacteria 2330
297 Ga0496108_0008779 3300048911 Bacteria 8194
298 Ga0496108_0011716 3300048911 Bacteria 7133
299 Ga0496108_0264635 3300048911 Bacteria 1496
300 Ga0496108_0317125 3300048911 Bacteria 1359
301 Ga0496108_0333062 3300048911 Bacteria 1324
302 Ga0496109_0013742 3300048912 Bacteria 7034
303 Ga0496109_0309952 3300048912 Bacteria 1489
304 Ga0496110_0028487 3300048913 Bacteria 4798
305 Ga0496110_0275864 3300048913 Bacteria 1531
306 Ga0496110_0285543 3300048913 Bacteria 1503
307 Ga0496111_0054724 3300048914 Bacteria 2885
308 Ga0496112_0006594 3300048915 Bacteria 10214
309 Ga0496112_0123275 3300048915 Bacteria 2562
310 Ga0496113_0022414 3300048916 Bacteria 4467
311 Ga0496113_0049273 3300048916 Bacteria 3136
312 Ga0496113_0205256 3300048916 Bacteria 1567
313 Ga0496114_0000416 3300048917 Bacteria 31603
314 Ga0496114_0001537 3300048917 Bacteria 17479
315 Ga0496114_0074115 3300048917 Bacteria 2865
316 Ga0496115_0021424 3300048918 Bacteria 4994
317 Ga0496115_0270451 3300048918 Bacteria 1396
318 Ga0496115_0456069 3300048918 Bacteria 1032
319 Ga0495682_0096083 3300049460 Bacteria 1064
320 Ga0501033_0141515 3300049570 Bacteria 1739
321 Ga0501036_0054175 3300049572 Bacteria 3397
322 Ga0501037_0227577 3300049573 Bacteria 1310
323 Ga0501039_0075900 3300049575 Bacteria 2613
324 Ga0501040_0001751 3300049576 Bacteria 13950
325 Ga0501042_0027700 3300049578 Bacteria 3986
326 Ga0501042_0230695 3300049578 Bacteria 1335
327 Ga0501046_0008978 3300049580 Bacteria 8680
328 Ga0501068_0243948 3300049584 Bacteria 1144
329 Ga0501072_0010677 3300049588 Bacteria 6993
330 Ga0501072_0052243 3300049588 Bacteria 3218
331 Ga0501075_0152986 3300049591 Bacteria 1758
332 Ga0501075_0299620 3300049591 Bacteria 1225
333 Ga0501076_0005355 3300049592 Bacteria 9215
334 Ga0501076_0067452 3300049592 Unclassified 2857
335 Ga0501076_0268277 3300049592 Bacteria 1398
336 Ga0501076_0434962 3300049592 Bacteria 1080
337 Ga0501076_0515950 3300049592 Unclassified 985
338 Ga0501077_0089240 3300049593 Bacteria 1954
339 Ga0501079_0008095 3300049741 Bacteria 7963
340 Ga0501079_0125957 3300049741 Bacteria 1993
341 Ga0501079_0147371 3300049741 Bacteria 1835
342 Ga0501080_0071556 3300049742 Unclassified 3225
343 Ga0501081_0000624 3300049743 Bacteria 20161
344 Ga0501083_0052446 3300049744 Bacteria 2740
345 Ga0501045_0008022 3300049824 Bacteria 7353
346 Ga0501045_0138577 3300049824 Bacteria 1809
347 Ga0501045_0167390 3300049824 Unclassified 1637
348 Ga0501045_0184432 3300049824 Bacteria 1555
349 nmdc:mga05p37_139245_c1 3300050507 Bacteria 2974
350 nmdc:mga05p37_15317_c1 3300050507 Bacteria 9211
351 nmdc:mga05p37_269_c1 3300050507 Bacteria 53887
352 nmdc:mga05p37_465499_c1 3300050507 Bacteria 1460
353 nmdc:mga05p37_561250_c1 3300050507 Bacteria 1297
354 nmdc:mga05p37_7530_c1 3300050507 Bacteria 12835
355 nmdc:mga09592_851_c1 3300050508 Bacteria 23765
356 nmdc:mga0qj67_196135_c1 3300050509 Unclassified 1641
357 nmdc:mga06r32_325288_c1 3300050510 Unclassified 1523
358 nmdc:mga08y16_13913_c1 3300050511 Bacteria 8468
359 nmdc:mga08y16_172029_c1 3300050511 Bacteria 2250
360 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
361 nmdc:mga0n895_254345_c1 3300050512 Bacteria 1782
362 nmdc:mga08x19_107982_c1 3300050514 Bacteria 1853
363 nmdc:mga08x19_144937_c1 3300050514 Viruses 1606
364 nmdc:mga08x19_149275_c1 3300050514 Bacteria 1582
365 nmdc:mga08x19_24026_c1 3300050514 Bacteria 3784
366 nmdc:mga08x19_268270_c1 3300050514 Bacteria 1181
367 nmdc:mga0a205_214694_c1 3300050515 Bacteria 1811
368 nmdc:mga0a205_56534_c1 3300050515 Bacteria 3788
369 nmdc:mga0a205_79833_c1 3300050515 Bacteria 3162
370 Ga0495595_0016336 3300053084 Bacteria 3174
371 Ga0500555_000674 3300053103 Bacteria 13064
372 Ga0500616_0000234 3300053153 Bacteria 86819
373 Ga0500645_000508 3300053730 Bacteria 26218
374 Ga0501084_0004571 3300054114 Bacteria 11311
375 Ga0501084_0106581 3300054114 Unclassified 2355
376 Ga0501084_0169099 3300054114 Unclassified 1845
377 Ga0590071_017635 3300059421 Unclassified 1677
378 Ga0590075_017199 3300059424 Unclassified 1782
379 Ga0501082_0252019 3300060353 Bacteria 1536
380 Ga0501082_0415432 3300060353 Unclassified 1175
381 Ga0530510_0023316 3300061734 Bacteria 4409
382 Ga0530510_0030245 3300061734 Bacteria 3889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0724813 Ga0453684_0724813_386_1054 222
2 3300044712 Ga0453684_0044884 Ga0453684_0044884_5194_5871 225
3 3300048911 Ga0496108_0317125 Ga0496108_0317125_28_807 245
4 3300006914 Ga0075436_100026589 Ga0075436_1000265892 249
5 3300025929 Ga0207664_10124691 Ga0207664_101246913 249
6 3300035725 Ga0373947_0007317 Ga0373947_0007317_3947_4696 249
7 3300037068 Ga0373925_0109503 Ga0373925_0109503_345_1094 249
8 3300045049 Ga0466959_0299598 Ga0466959_0299598_340_1089 249
9 3300049824 Ga0501045_0167390 Ga0501045_0167390_746_1561 251
10 3300035120 Ga0373957_0196344 Ga0373957_0196344_13_786 252
11 3300049570 Ga0501033_0141515 Ga0501033_0141515_898_1692 257
12 3300049575 Ga0501039_0075900 Ga0501039_0075900_1382_2176 257
13 3300049576 Ga0501040_0001751 Ga0501040_0001751_7980_8774 257
14 3300049580 Ga0501046_0008978 Ga0501046_0008978_6684_7478 257
15 3300049588 Ga0501072_0010677 Ga0501072_0010677_5221_6015 257
16 3300049593 Ga0501077_0089240 Ga0501077_0089240_1095_1889 257
17 3300049742 Ga0501080_0071556 Ga0501080_0071556_1201_1995 257
18 3300049743 Ga0501081_0000624 Ga0501081_0000624_10130_10924 257
19 3300048916 Ga0496113_0205256 Ga0496113_0205256_104_904 260
20 3300046642 Ga0495634_0135529 Ga0495634_0135529_251_1105 265
21 3300005434 Ga0070709_10292108 Ga0070709_102921081 268
22 3300006028 Ga0070717_10255229 Ga0070717_102552293 268
23 3300006914 Ga0075436_100264502 Ga0075436_1002645021 268
24 3300009553 Ga0105249_10917682 Ga0105249_109176821 268
25 3300013307 Ga0157372_10068488 Ga0157372_100684882 268
26 3300025906 Ga0207699_10084070 Ga0207699_100840702 268
27 3300045836 Ga0466958_0116683 Ga0466958_0116683_806_1612 268
28 3300045976 Ga0466967_0332720 Ga0466967_0332720_445_1251 268
29 3300050514 nmdc:mga08x19_144937_c1 nmdc:mga08x19_144937_c1_189_995 268
30 3300050514 nmdc:mga08x19_24026_c1 nmdc:mga08x19_24026_c1_2332_3138 268
31 3300054114 Ga0501084_0169099 Ga0501084_0169099_93_977 268
32 3300060353 Ga0501082_0252019 Ga0501082_0252019_270_1136 268
33 3300060353 Ga0501082_0415432 Ga0501082_0415432_38_922 268
34 3300005289 Ga0065704_10089167 Ga0065704_100891672 269
35 3300005295 Ga0065707_10082698 Ga0065707_100826988 269
36 3300005440 Ga0070705_100086011 Ga0070705_1000860111 269
37 3300005441 Ga0070700_100065530 Ga0070700_1000655303 269
38 3300005467 Ga0070706_100172088 Ga0070706_1001720882 269
39 3300005844 Ga0068862_100022261 Ga0068862_1000222615 269
40 3300005985 Ga0081539_10006740 Ga0081539_100067405 269
41 3300006846 Ga0075430_100266314 Ga0075430_1002663141 269
42 3300006847 Ga0075431_100012779 Ga0075431_1000127793 269
43 3300006880 Ga0075429_100000776 Ga0075429_1000007767 269
44 3300006880 Ga0075429_100001599 Ga0075429_10000159923 269
45 3300009147 Ga0114129_10000824 Ga0114129_100008247 269
46 3300009147 Ga0114129_10481596 Ga0114129_104815961 269
47 3300009148 Ga0105243_10154113 Ga0105243_101541132 269
48 3300025935 Ga0207709_10199028 Ga0207709_101990282 269
49 3300026075 Ga0207708_10225644 Ga0207708_102256441 269
50 3300039450 Ga0436363_0908313 Ga0436363_0908313_695_1573 269
51 3300042876 Ga0451577_0358250 Ga0451577_0358250_207_1016 269
52 3300044673 Ga0453683_0011648 Ga0453683_0011648_4654_5463 269
53 3300044712 Ga0453684_0354950 Ga0453684_0354950_429_1238 269
54 3300045051 Ga0451576_0025131 Ga0451576_0025131_3390_4199 269
55 3300045051 Ga0451576_0185512 Ga0451576_0185512_816_1628 269
56 3300049592 Ga0501076_0067452 Ga0501076_0067452_1666_2475 269
57 3300049592 Ga0501076_0515950 Ga0501076_0515950_51_860 269
58 3300050507 nmdc:mga05p37_269_c1 nmdc:mga05p37_269_c1_33590_34399 269
59 3300050507 nmdc:mga05p37_561250_c1 nmdc:mga05p37_561250_c1_143_952 269
60 3300050508 nmdc:mga09592_851_c1 nmdc:mga09592_851_c1_19634_20443 269
61 3300050509 nmdc:mga0qj67_196135_c1 nmdc:mga0qj67_196135_c1_297_1106 269
62 3300050510 nmdc:mga06r32_325288_c1 nmdc:mga06r32_325288_c1_499_1347 269
63 3300054114 Ga0501084_0106581 Ga0501084_0106581_665_1474 269
64 3300031728 Ga0316578_10113871 Ga0316578_101138712 270
65 3300031731 Ga0307405_10020102 Ga0307405_100201022 270
66 3300031903 Ga0307407_10063832 Ga0307407_100638322 270
67 3300032002 Ga0307416_100166099 Ga0307416_1001660992 270
68 3300032005 Ga0307411_10231786 Ga0307411_102317862 270
69 3300036712 Ga0316584_0308213 Ga0316584_0308213_298_1110 270
70 3300044673 Ga0453683_0000448 Ga0453683_0000448_5955_6767 270
71 3300044712 Ga0453684_0006052 Ga0453684_0006052_8713_9525 270
72 3300044712 Ga0453684_0014626 Ga0453684_0014626_1232_2074 270
73 3300044712 Ga0453684_0296548 Ga0453684_0296548_577_1389 270
74 3300045051 Ga0451576_0005261 Ga0451576_0005261_2194_3006 270
75 3300045051 Ga0451576_0059035 Ga0451576_0059035_2152_2964 270
76 3300042876 Ga0451577_0008835 Ga0451577_0008835_5977_6795 271
77 3300044712 Ga0453684_0000007 Ga0453684_0000007_149557_150375 271
78 3300044712 Ga0453684_0000797 Ga0453684_0000797_99715_100530 271
79 3300005467 Ga0070706_100122217 Ga0070706_1001222172 272
80 3300005618 Ga0068864_100844910 Ga0068864_1008449101 272
81 3300006881 Ga0068865_100601863 Ga0068865_1006018631 272
82 3300009094 Ga0111539_10066177 Ga0111539_100661773 272
83 3300025938 Ga0207704_10064095 Ga0207704_100640952 272
84 3300026088 Ga0207641_10395692 Ga0207641_103956922 272
85 3300028654 Ga0265322_10024113 Ga0265322_100241132 272
86 3300044712 Ga0453684_0181042 Ga0453684_0181042_317_1135 272
87 3300005295 Ga0065707_10003467 Ga0065707_100034674 273
88 3300005719 Ga0068861_100162426 Ga0068861_1001624262 273
89 3300005844 Ga0068862_100081420 Ga0068862_1000814202 273
90 3300006844 Ga0075428_100000023 Ga0075428_10000002363 273
91 3300009094 Ga0111539_10000001 Ga0111539_10000001677 273
92 3300009553 Ga0105249_10085628 Ga0105249_100856283 273
93 3300014326 Ga0157380_10454802 Ga0157380_104548022 273
94 3300025961 Ga0207712_10294422 Ga0207712_102944222 273
95 3300026118 Ga0207675_100196269 Ga0207675_1001962693 273
96 3300027907 Ga0207428_10000002 Ga0207428_10000002690 273
97 3300028380 Ga0268265_10070879 Ga0268265_100708792 273
98 3300031548 Ga0307408_100206662 Ga0307408_1002066621 273
99 3300031995 Ga0307409_100387369 Ga0307409_1003873691 273
100 3300032002 Ga0307416_100362948 Ga0307416_1003629482 273
101 3300042531 Ga0450918_023613 Ga0450918_023613_13_834 273
102 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_761909_762730 273
103 3300006237 Ga0097621_100005339 Ga0097621_1000053397 274
104 3300006358 Ga0068871_100027187 Ga0068871_1000271874 274
105 3300009176 Ga0105242_10258190 Ga0105242_102581902 274
106 3300025934 Ga0207686_10219569 Ga0207686_102195691 274
107 3300046455 Ga0495603_0271873 Ga0495603_0271873_98_922 274
108 3300046642 Ga0495634_0127554 Ga0495634_0127554_691_1515 274
109 3300046683 Ga0495658_0049973 Ga0495658_0049973_1360_2184 274
110 3300047322 Ga0495680_0329176 Ga0495680_0329176_10_834 274
111 3300048907 Ga0496104_0001478 Ga0496104_0001478_18761_19585 274
112 3300048908 Ga0496105_0094130 Ga0496105_0094130_492_1316 274
113 3300048909 Ga0496106_0026201 Ga0496106_0026201_3128_3952 274
114 3300048910 Ga0496107_0083450 Ga0496107_0083450_67_891 274
115 3300048917 Ga0496114_0000416 Ga0496114_0000416_26843_27667 274
116 3300048918 Ga0496115_0456069 Ga0496115_0456069_172_996 274
117 3300049572 Ga0501036_0054175 Ga0501036_0054175_2526_3371 274
118 3300049578 Ga0501042_0230695 Ga0501042_0230695_372_1217 274
119 3300049584 Ga0501068_0243948 Ga0501068_0243948_70_933 274
120 3300049592 Ga0501076_0005355 Ga0501076_0005355_3857_4702 274
121 3300049741 Ga0501079_0008095 Ga0501079_0008095_3724_4569 274
122 3300049744 Ga0501083_0052446 Ga0501083_0052446_1330_2175 274
123 3300049824 Ga0501045_0008022 Ga0501045_0008022_4067_4912 274
124 3300054114 Ga0501084_0004571 Ga0501084_0004571_3439_4284 274
125 3300061734 Ga0530510_0023316 Ga0530510_0023316_3529_4392 274
126 3300035398 Ga0316574_0152224 Ga0316574_0152224_536_1369 275
127 3300049591 Ga0501075_0299620 Ga0501075_0299620_248_1156 275
128 3300049741 Ga0501079_0147371 Ga0501079_0147371_696_1523 275
129 3300049824 Ga0501045_0138577 Ga0501045_0138577_272_1099 275
130 3300049824 Ga0501045_0184432 Ga0501045_0184432_330_1199 275
131 3300061734 Ga0530510_0030245 Ga0530510_0030245_3043_3870 275
132 3300006852 Ga0075433_10116441 Ga0075433_101164412 276
133 3300050515 nmdc:mga0a205_56534_c1 nmdc:mga0a205_56534_c1_1908_2777 276
134 3300059421 Ga0590071_017635 Ga0590071_017635_402_1235 276
135 3300059424 Ga0590075_017199 Ga0590075_017199_534_1367 276
136 3300006914 Ga0075436_100162661 Ga0075436_1001626612 277
137 3300026121 Ga0207683_10152271 Ga0207683_101522712 277
138 3300035116 Ga0373945_0038512 Ga0373945_0038512_21_878 277
139 3300035170 Ga0373943_0026948 Ga0373943_0026948_1531_2388 277
140 3300050514 nmdc:mga08x19_107982_c1 nmdc:mga08x19_107982_c1_311_1168 277
141 3300005356 Ga0070674_100005939 Ga0070674_1000059393 278
142 3300005471 Ga0070698_100135947 Ga0070698_1001359471 278
143 3300025926 Ga0207659_10283171 Ga0207659_102831711 278
144 3300025933 Ga0207706_10204943 Ga0207706_102049431 278
145 3300025937 Ga0207669_10072170 Ga0207669_100721702 278
146 3300026067 Ga0207678_10079314 Ga0207678_100793142 278
147 3300035170 Ga0373943_0045416 Ga0373943_0045416_468_1328 278
148 3300037068 Ga0373925_0002833 Ga0373925_0002833_9941_10801 278
149 3300005288 Ga0065714_10146053 Ga0065714_101460531 279
150 3300005290 Ga0065712_10000499 Ga0065712_100004996 279
151 3300005293 Ga0065715_10091975 Ga0065715_100919753 279
152 3300005293 Ga0065715_10158174 Ga0065715_101581742 279
153 3300005295 Ga0065707_10104865 Ga0065707_101048652 279
154 3300005328 Ga0070676_10055507 Ga0070676_100555073 279
155 3300005331 Ga0070670_100012457 Ga0070670_1000124572 279
156 3300005334 Ga0068869_100157943 Ga0068869_1001579432 279
157 3300005335 Ga0070666_10154297 Ga0070666_101542971 279
158 3300005338 Ga0068868_100064474 Ga0068868_1000644742 279
159 3300005343 Ga0070687_100215900 Ga0070687_1002159001 279
160 3300005347 Ga0070668_100051417 Ga0070668_1000514174 279
161 3300005353 Ga0070669_100181244 Ga0070669_1001812443 279
162 3300005353 Ga0070669_100377381 Ga0070669_1003773811 279
163 3300005354 Ga0070675_100000055 Ga0070675_10000005513 279
164 3300005354 Ga0070675_100028939 Ga0070675_1000289393 279
165 3300005354 Ga0070675_100103571 Ga0070675_1001035712 279
166 3300005364 Ga0070673_100043757 Ga0070673_1000437572 279
167 3300005364 Ga0070673_100065379 Ga0070673_1000653792 279
168 3300005365 Ga0070688_100083245 Ga0070688_1000832452 279
169 3300005365 Ga0070688_100087175 Ga0070688_1000871752 279
170 3300005366 Ga0070659_100222522 Ga0070659_1002225222 279
171 3300005441 Ga0070700_100002552 Ga0070700_1000025528 279
172 3300005444 Ga0070694_100017695 Ga0070694_1000176953 279
173 3300005456 Ga0070678_100055178 Ga0070678_1000551782 279
174 3300005457 Ga0070662_100088024 Ga0070662_1000880242 279
175 3300005459 Ga0068867_100012999 Ga0068867_1000129992 279
176 3300005459 Ga0068867_100265147 Ga0068867_1002651471 279
177 3300005459 Ga0068867_100276860 Ga0068867_1002768602 279
178 3300005467 Ga0070706_100274823 Ga0070706_1002748232 279
179 3300005471 Ga0070698_100120610 Ga0070698_1001206102 279
180 3300005518 Ga0070699_100122629 Ga0070699_1001226292 279
181 3300005536 Ga0070697_100251062 Ga0070697_1002510622 279
182 3300005539 Ga0068853_100149579 Ga0068853_1001495792 279
183 3300005543 Ga0070672_100059519 Ga0070672_1000595191 279
184 3300005543 Ga0070672_100074386 Ga0070672_1000743862 279
185 3300005543 Ga0070672_100226642 Ga0070672_1002266422 279
186 3300005544 Ga0070686_100278717 Ga0070686_1002787172 279
187 3300005545 Ga0070695_100075267 Ga0070695_1000752672 279
188 3300005546 Ga0070696_100047931 Ga0070696_1000479311 279
189 3300005546 Ga0070696_100098744 Ga0070696_1000987442 279
190 3300005548 Ga0070665_100039464 Ga0070665_1000394642 279
191 3300005548 Ga0070665_100074672 Ga0070665_1000746722 279
192 3300005548 Ga0070665_100087855 Ga0070665_1000878553 279
193 3300005549 Ga0070704_100196367 Ga0070704_1001963673 279
194 3300005564 Ga0070664_100193685 Ga0070664_1001936852 279
195 3300005577 Ga0068857_100487316 Ga0068857_1004873162 279
196 3300005578 Ga0068854_100187781 Ga0068854_1001877812 279
197 3300005618 Ga0068864_100010173 Ga0068864_1000101737 279
198 3300005618 Ga0068864_100023531 Ga0068864_1000235314 279
199 3300005718 Ga0068866_10141737 Ga0068866_101417372 279
200 3300005719 Ga0068861_100010150 Ga0068861_1000101506 279
201 3300005719 Ga0068861_100065383 Ga0068861_1000653831 279
202 3300005840 Ga0068870_10034430 Ga0068870_100344302 279
203 3300005841 Ga0068863_100034633 Ga0068863_1000346333 279
204 3300005842 Ga0068858_100088165 Ga0068858_1000881652 279
205 3300005842 Ga0068858_100223044 Ga0068858_1002230442 279
206 3300005842 Ga0068858_100342719 Ga0068858_1003427192 279
207 3300005843 Ga0068860_100355723 Ga0068860_1003557232 279
208 3300005844 Ga0068862_100011943 Ga0068862_1000119433 279
209 3300005844 Ga0068862_100105072 Ga0068862_1001050722 279
210 3300006237 Ga0097621_100120978 Ga0097621_1001209784 279
211 3300006237 Ga0097621_100188220 Ga0097621_1001882202 279
212 3300006358 Ga0068871_100027882 Ga0068871_1000278826 279
213 3300006358 Ga0068871_100087360 Ga0068871_1000873602 279
214 3300006844 Ga0075428_100195667 Ga0075428_1001956672 279
215 3300006852 Ga0075433_10073877 Ga0075433_100738771 279
216 3300006852 Ga0075433_10200186 Ga0075433_102001861 279
217 3300006852 Ga0075433_10207426 Ga0075433_102074262 279
218 3300006871 Ga0075434_100044270 Ga0075434_1000442702 279
219 3300006881 Ga0068865_100027675 Ga0068865_1000276752 279
220 3300006914 Ga0075436_100046415 Ga0075436_1000464152 279
221 3300006914 Ga0075436_100347848 Ga0075436_1003478481 279
222 3300007076 Ga0075435_100008984 Ga0075435_1000089843 279
223 3300009094 Ga0111539_10034811 Ga0111539_100348112 279
224 3300009098 Ga0105245_10279994 Ga0105245_102799941 279
225 3300009098 Ga0105245_10365608 Ga0105245_103656082 279
226 3300009098 Ga0105245_10898399 Ga0105245_108983991 279
227 3300009101 Ga0105247_10145250 Ga0105247_101452502 279
228 3300009147 Ga0114129_10010381 Ga0114129_100103819 279
229 3300009147 Ga0114129_10011848 Ga0114129_100118483 279
230 3300009147 Ga0114129_10046542 Ga0114129_100465423 279
231 3300009147 Ga0114129_10766180 Ga0114129_107661802 279
232 3300009148 Ga0105243_10028030 Ga0105243_100280302 279
233 3300009148 Ga0105243_10215974 Ga0105243_102159742 279
234 3300009176 Ga0105242_10113581 Ga0105242_101135812 279
235 3300009176 Ga0105242_10212851 Ga0105242_102128512 279
236 3300009176 Ga0105242_10259190 Ga0105242_102591902 279
237 3300009176 Ga0105242_10301731 Ga0105242_103017311 279
238 3300009177 Ga0105248_10055164 Ga0105248_100551643 279
239 3300009177 Ga0105248_10061183 Ga0105248_100611836 279
240 3300009177 Ga0105248_10318092 Ga0105248_103180922 279
241 3300009553 Ga0105249_10287579 Ga0105249_102875792 279
242 3300013296 Ga0157374_10147199 Ga0157374_101471992 279
243 3300013306 Ga0163162_10231573 Ga0163162_102315733 279
244 3300013306 Ga0163162_10267587 Ga0163162_102675872 279
245 3300013306 Ga0163162_10271698 Ga0163162_102716982 279
246 3300013308 Ga0157375_10510283 Ga0157375_105102832 279
247 3300014325 Ga0163163_10004562 Ga0163163_1000456211 279
248 3300014325 Ga0163163_10334065 Ga0163163_103340652 279
249 3300014326 Ga0157380_10031428 Ga0157380_100314286 279
250 3300014326 Ga0157380_10201326 Ga0157380_102013261 279
251 3300014968 Ga0157379_10586599 Ga0157379_105865991 279
252 3300014968 Ga0157379_10688831 Ga0157379_106888311 279
253 3300014969 Ga0157376_10052610 Ga0157376_100526102 279
254 3300014969 Ga0157376_10072558 Ga0157376_100725583 279
255 3300014969 Ga0157376_10167651 Ga0157376_101676511 279
256 3300014969 Ga0157376_10384260 Ga0157376_103842602 279
257 3300017792 Ga0163161_10025344 Ga0163161_100253442 279
258 3300025899 Ga0207642_10008723 Ga0207642_100087233 279
259 3300025899 Ga0207642_10050210 Ga0207642_100502102 279
260 3300025899 Ga0207642_10121157 Ga0207642_101211572 279
261 3300025904 Ga0207647_10097640 Ga0207647_100976402 279
262 3300025907 Ga0207645_10005828 Ga0207645_100058288 279
263 3300025907 Ga0207645_10067925 Ga0207645_100679252 279
264 3300025908 Ga0207643_10028693 Ga0207643_100286932 279
265 3300025911 Ga0207654_10122716 Ga0207654_101227162 279
266 3300025918 Ga0207662_10133902 Ga0207662_101339022 279
267 3300025923 Ga0207681_10023489 Ga0207681_100234892 279
268 3300025923 Ga0207681_10056959 Ga0207681_100569592 279
269 3300025923 Ga0207681_10069791 Ga0207681_100697912 279
270 3300025923 Ga0207681_10093565 Ga0207681_100935652 279
271 3300025923 Ga0207681_10116388 Ga0207681_101163882 279
272 3300025925 Ga0207650_10014626 Ga0207650_100146262 279
273 3300025925 Ga0207650_10148831 Ga0207650_101488312 279
274 3300025926 Ga0207659_10001583 Ga0207659_100015835 279
275 3300025926 Ga0207659_10040945 Ga0207659_100409454 279
276 3300025927 Ga0207687_10230781 Ga0207687_102307811 279
277 3300025931 Ga0207644_10067061 Ga0207644_100670612 279
278 3300025933 Ga0207706_10074221 Ga0207706_100742214 279
279 3300025934 Ga0207686_10075178 Ga0207686_100751782 279
280 3300025934 Ga0207686_10112514 Ga0207686_101125142 279
281 3300025934 Ga0207686_10194200 Ga0207686_101942001 279
282 3300025935 Ga0207709_10004342 Ga0207709_100043423 279
283 3300025935 Ga0207709_10037191 Ga0207709_100371911 279
284 3300025936 Ga0207670_10150790 Ga0207670_101507902 279
285 3300025936 Ga0207670_10213755 Ga0207670_102137552 279
286 3300025938 Ga0207704_10004287 Ga0207704_100042874 279
287 3300025940 Ga0207691_10203695 Ga0207691_102036952 279
288 3300025941 Ga0207711_10012271 Ga0207711_100122714 279
289 3300025941 Ga0207711_10134276 Ga0207711_101342762 279
290 3300025941 Ga0207711_10245186 Ga0207711_102451862 279
291 3300025941 Ga0207711_10287765 Ga0207711_102877652 279
292 3300025941 Ga0207711_10527926 Ga0207711_105279262 279
293 3300025942 Ga0207689_10078486 Ga0207689_100784862 279
294 3300025945 Ga0207679_10078152 Ga0207679_100781522 279
295 3300025945 Ga0207679_10286348 Ga0207679_102863482 279
296 3300025960 Ga0207651_10005977 Ga0207651_100059773 279
297 3300025960 Ga0207651_10058661 Ga0207651_100586612 279
298 3300025960 Ga0207651_10165934 Ga0207651_101659342 279
299 3300025961 Ga0207712_10032625 Ga0207712_100326253 279
300 3300025961 Ga0207712_10127230 Ga0207712_101272302 279
301 3300025972 Ga0207668_10146215 Ga0207668_101462152 279
302 3300026035 Ga0207703_10044937 Ga0207703_100449373 279
303 3300026035 Ga0207703_10136516 Ga0207703_101365162 279
304 3300026035 Ga0207703_10163908 Ga0207703_101639082 279
305 3300026035 Ga0207703_10372200 Ga0207703_103722002 279
306 3300026041 Ga0207639_10079638 Ga0207639_100796381 279
307 3300026075 Ga0207708_10004696 Ga0207708_100046963 279
308 3300026075 Ga0207708_10112907 Ga0207708_101129072 279
309 3300026088 Ga0207641_10052788 Ga0207641_100527882 279
310 3300026088 Ga0207641_10192265 Ga0207641_101922652 279
311 3300026089 Ga0207648_10018612 Ga0207648_100186123 279
312 3300026089 Ga0207648_10054597 Ga0207648_100545976 279
313 3300026089 Ga0207648_10157980 Ga0207648_101579802 279
314 3300026089 Ga0207648_10390508 Ga0207648_103905081 279
315 3300026095 Ga0207676_10006059 Ga0207676_100060595 279
316 3300026095 Ga0207676_10015116 Ga0207676_100151164 279
317 3300026095 Ga0207676_10059047 Ga0207676_100590473 279
318 3300026095 Ga0207676_10073193 Ga0207676_100731934 279
319 3300026118 Ga0207675_100022777 Ga0207675_1000227774 279
320 3300026118 Ga0207675_100069427 Ga0207675_1000694272 279
321 3300026118 Ga0207675_100129740 Ga0207675_1001297402 279
322 3300027682 Ga0209971_1001642 Ga0209971_10016423 279
323 3300028379 Ga0268266_10029291 Ga0268266_100292913 279
324 3300028379 Ga0268266_10058985 Ga0268266_100589853 279
325 3300028379 Ga0268266_10061775 Ga0268266_100617752 279
326 3300028379 Ga0268266_10293598 Ga0268266_102935982 279
327 3300028380 Ga0268265_10030955 Ga0268265_100309553 279
328 3300028380 Ga0268265_10170512 Ga0268265_101705122 279
329 3300028381 Ga0268264_10200751 Ga0268264_102007511 279
330 3300031995 Ga0307409_100220826 Ga0307409_1002208262 279
331 3300032002 Ga0307416_100011098 Ga0307416_1000110983 279
332 3300032126 Ga0307415_100072822 Ga0307415_1000728222 279
333 3300042132 Ga0450895_000635 Ga0450895_000635_88_939 279
334 3300042435 Ga0439434_0097348 Ga0439434_0097348_57_923 279
335 3300046535 Ga0495586_0089266 Ga0495586_0089266_133_975 279
336 3300046642 Ga0495634_0148001 Ga0495634_0148001_23_865 279
337 3300048904 Ga0496101_0087340 Ga0496101_0087340_962_1801 279
338 3300048907 Ga0496104_0003893 Ga0496104_0003893_4519_5358 279
339 3300048907 Ga0496104_0141448 Ga0496104_0141448_1126_1980 279
340 3300048908 Ga0496105_0108195 Ga0496105_0108195_252_1091 279
341 3300048909 Ga0496106_0155390 Ga0496106_0155390_269_1108 279
342 3300048911 Ga0496108_0008779 Ga0496108_0008779_790_1644 279
343 3300048911 Ga0496108_0011716 Ga0496108_0011716_2061_2900 279
344 3300048911 Ga0496108_0264635 Ga0496108_0264635_388_1227 279
345 3300048911 Ga0496108_0333062 Ga0496108_0333062_423_1277 279
346 3300048912 Ga0496109_0013742 Ga0496109_0013742_3399_4238 279
347 3300048912 Ga0496109_0309952 Ga0496109_0309952_218_1072 279
348 3300048913 Ga0496110_0028487 Ga0496110_0028487_2220_3059 279
349 3300048913 Ga0496110_0275864 Ga0496110_0275864_350_1204 279
350 3300048913 Ga0496110_0285543 Ga0496110_0285543_535_1374 279
351 3300048914 Ga0496111_0054724 Ga0496111_0054724_78_917 279
352 3300048915 Ga0496112_0006594 Ga0496112_0006594_5102_5956 279
353 3300048915 Ga0496112_0123275 Ga0496112_0123275_1436_2275 279
354 3300048916 Ga0496113_0022414 Ga0496113_0022414_2091_2930 279
355 3300048916 Ga0496113_0049273 Ga0496113_0049273_616_1470 279
356 3300048917 Ga0496114_0001537 Ga0496114_0001537_12202_13041 279
357 3300048917 Ga0496114_0074115 Ga0496114_0074115_167_1006 279
358 3300048918 Ga0496115_0021424 Ga0496115_0021424_2937_3776 279
359 3300048918 Ga0496115_0270451 Ga0496115_0270451_353_1207 279
360 3300049460 Ga0495682_0096083 Ga0495682_0096083_45_899 279
361 3300049573 Ga0501037_0227577 Ga0501037_0227577_309_1166 279
362 3300049578 Ga0501042_0027700 Ga0501042_0027700_236_1093 279
363 3300049588 Ga0501072_0052243 Ga0501072_0052243_1080_1937 279
364 3300049591 Ga0501075_0152986 Ga0501075_0152986_380_1237 279
365 3300049592 Ga0501076_0268277 Ga0501076_0268277_322_1167 279
366 3300049592 Ga0501076_0434962 Ga0501076_0434962_123_980 279
367 3300049741 Ga0501079_0125957 Ga0501079_0125957_740_1648 279
368 3300050507 nmdc:mga05p37_139245_c1 nmdc:mga05p37_139245_c1_766_1623 279
369 3300050507 nmdc:mga05p37_15317_c1 nmdc:mga05p37_15317_c1_3799_4653 279
370 3300050507 nmdc:mga05p37_465499_c1 nmdc:mga05p37_465499_c1_32_904 279
371 3300050507 nmdc:mga05p37_7530_c1 nmdc:mga05p37_7530_c1_1117_1971 279
372 3300050511 nmdc:mga08y16_13913_c1 nmdc:mga08y16_13913_c1_280_1134 279
373 3300050511 nmdc:mga08y16_172029_c1 nmdc:mga08y16_172029_c1_910_1764 279
374 3300050512 nmdc:mga0n895_254345_c1 nmdc:mga0n895_254345_c1_804_1661 279
375 3300050514 nmdc:mga08x19_149275_c1 nmdc:mga08x19_149275_c1_177_1031 279
376 3300050514 nmdc:mga08x19_268270_c1 nmdc:mga08x19_268270_c1_241_1095 279
377 3300050515 nmdc:mga0a205_214694_c1 nmdc:mga0a205_214694_c1_727_1581 279
378 3300050515 nmdc:mga0a205_79833_c1 nmdc:mga0a205_79833_c1_127_984 279
379 3300053084 Ga0495595_0016336 Ga0495595_0016336_1742_2584 279
380 3300053103 Ga0500555_000674 Ga0500555_000674_5450_6346 279
381 3300053153 Ga0500616_0000234 Ga0500616_0000234_7286_8182 279
382 3300053730 Ga0500645_000508 Ga0500645_000508_24611_25507 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00800

PDT

Prephenate dehydratase

28

206

0.99

PF01842

ACT

ACT domain

214

269

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vh5-assembly1.cif.gz_C crystal structure of prephenate dehydratase from brucella melitensis biovar abortus 2308 in complex with phenylalanine 0.9367 2 266
7am0-assembly2.cif.gz_C gqqa- a novel type of quorum quenching acylases 0.927 1 268
2qmx-assembly1.cif.gz_A the crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls 0.9243 2 268
7alz-assembly1.cif.gz_B gqqa- a novel type of quorum quenching acylases 0.9223 2 267
3mwb-assembly1.cif.gz_A the crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a 0.9173 1 271
ID Description Score Start End Superfamily
af_A0A0P0X6W8_91_157_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9867 3 67 3.40.190.10
af_A0A1D6ICV1_89_167_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9773 86 160 3.40.190.10
af_O14361_1_89_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9741 2 66 3.40.190.10
2qmxB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9726 83 165 3.40.190.10
af_A0A1D6ICV1_2_88_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.971 1 81 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7J9X0H9-F1-model_v4 prephenate dehydratase (EC 4.2.1.51) 0.9905 2 179 GO:0004664
GO:0005737
GO:0009094
AF-A0A7J8UJM2-F1-model_v4 Prephenate dehydratase domain-containing protein 0.9878 1 182 GO:0004664
GO:0009094
GO:0009507
GO:0047769
AF-A0A524HZ84-F1-model_v4 Prephenate dehydratase (EC 4.2.1.51) 0.984 1 246 GO:0004664
GO:0005737
GO:0009094
AF-R6DIK4-F1-model_v4 Prephenate dehydratase 0.984 184 265 GO:0004664
GO:0005737
GO:0009094
AF-A0A6A0HHG4-F1-model_v4 prephenate dehydratase (EC 4.2.1.51) 0.983 2 268 GO:0004106
GO:0004664
GO:0005737
GO:0009094

Feature Viewer

pLDDT pTM Quality
93.41 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map