F429203

General Info

Members Datasets Scaffolds Average Seq Length
382 217 764 143

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100476134|Ga0070708_1004761342
Length 159
Sequence MIYRMGAALMSLLGLFVSAYLYLYKIGRIGTLACGTGGCETVQLSEWSRFAGVDVALIGLVGYALLFAVALAALRPGLAEREWPAALLTALAGLGVLFTAYLTYLELFVIHAICRWCVGSALIITTLFMLGLLDLRRLRSGGAGGTAVSTGTGSARGAA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
150 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
151 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
189 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
190 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
191 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
192 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
193 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
194 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
195 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
201 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
202 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.42
Rhizosphere 90.31
Stem 0
Stem Tuber 0
Unclassified 8.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100476134 3300005445 Bacteria 1178
2 MBSR1b_contig_8174435 2162886012 Bacteria 1333
3 rootL2_10164352 3300003322 Bacteria 4423
4 Ga0070676_10111710 3300005328 Bacteria 1702
5 Ga0070670_100600001 3300005331 Bacteria 985
6 Ga0068869_100224858 3300005334 Bacteria 1489
7 Ga0070680_100005407 3300005336 Bacteria 9670
8 Ga0070691_10053653 3300005341 Bacteria 1929
9 Ga0070691_10092759 3300005341 Bacteria 1491
10 Ga0070687_100355952 3300005343 Bacteria 946
11 Ga0070692_10219449 3300005345 Bacteria 1123
12 Ga0070669_100105231 3300005353 Bacteria 2134
13 Ga0070671_100097308 3300005355 Bacteria 2468
14 Ga0070674_100000401 3300005356 Bacteria 21777
15 Ga0070674_100583021 3300005356 Bacteria 943
16 Ga0070674_101758601 3300005356 Unclassified 561
17 Ga0070673_100381764 3300005364 Bacteria 1256
18 Ga0070659_100144678 3300005366 Bacteria 1936
19 Ga0070701_10428641 3300005438 Bacteria 844
20 Ga0070711_100014365 3300005439 Bacteria 4990
21 Ga0070705_100000621 3300005440 Bacteria 20496
22 Ga0070705_100027223 3300005440 Bacteria 3120
23 Ga0070700_100096424 3300005441 Bacteria 1940
24 Ga0070700_100101584 3300005441 Bacteria 1895
25 Ga0070694_100206397 3300005444 Bacteria 1467
26 Ga0070694_100480464 3300005444 Bacteria 986
27 Ga0070694_100995328 3300005444 Bacteria 696
28 Ga0070708_100516359 3300005445 Bacteria 1127
29 Ga0070663_100335506 3300005455 Bacteria 1220
30 Ga0070663_100886309 3300005455 Bacteria 770
31 Ga0070678_100000727 3300005456 Bacteria 16382
32 Ga0070662_100000249 3300005457 Bacteria 31841
33 Ga0070681_10434567 3300005458 Bacteria 1225
34 Ga0070681_11529259 3300005458 Bacteria 592
35 Ga0068867_100000798 3300005459 Bacteria 21331
36 Ga0068867_100413541 3300005459 Unclassified 1141
37 Ga0070706_100089767 3300005467 Bacteria 2850
38 Ga0070706_100525540 3300005467 Bacteria 1101
39 Ga0070707_100255117 3300005468 Bacteria 1707
40 Ga0070707_100447992 3300005468 Unclassified 1252
41 Ga0070707_100697269 3300005468 Bacteria 978
42 Ga0070698_100107205 3300005471 Bacteria 2761
43 Ga0070699_100000017 3300005518 Bacteria 201366
44 Ga0070699_100004735 3300005518 Bacteria 12027
45 Ga0070679_100160270 3300005530 Bacteria 2224
46 Ga0070679_100445287 3300005530 Bacteria 1240
47 Ga0070684_100304777 3300005535 Bacteria 1462
48 Ga0070697_100010131 3300005536 Bacteria 7354
49 Ga0070697_100732939 3300005536 Bacteria 873
50 Ga0070686_100028542 3300005544 Bacteria 3385
51 Ga0070686_100447453 3300005544 Unclassified 992
52 Ga0070695_100108589 3300005545 Bacteria 1879
53 Ga0070695_100345897 3300005545 Unclassified 1113
54 Ga0070695_100726706 3300005545 Bacteria 790
55 Ga0070696_100000578 3300005546 Bacteria 23368
56 Ga0070696_100157522 3300005546 Bacteria 1671
57 Ga0070696_100161305 3300005546 Bacteria 1652
58 Ga0070696_100259504 3300005546 Bacteria 1317
59 Ga0070696_100380392 3300005546 Bacteria 1100
60 Ga0070696_100739060 3300005546 Bacteria 805
61 Ga0070693_100012337 3300005547 Bacteria 4323
62 Ga0070693_100068416 3300005547 Bacteria 2084
63 Ga0070693_100567889 3300005547 Bacteria 814
64 Ga0070704_100081306 3300005549 Bacteria 2386
65 Ga0070704_100245139 3300005549 Bacteria 1468
66 Ga0070704_100349199 3300005549 Bacteria 1248
67 Ga0068855_100080895 3300005563 Bacteria 3767
68 Ga0068857_100001149 3300005577 Bacteria 20636
69 Ga0068854_100005070 3300005578 Bacteria 8296
70 Ga0068854_100149674 3300005578 Unclassified 1799
71 Ga0070702_100002431 3300005615 Bacteria 8025
72 Ga0070702_100067868 3300005615 Bacteria 2097
73 Ga0068852_100254512 3300005616 Bacteria 1683
74 Ga0068859_100514503 3300005617 Bacteria 1292
75 Ga0068864_100063626 3300005618 Bacteria 3197
76 Ga0068866_10000023 3300005718 Bacteria 60315
77 Ga0068866_10039476 3300005718 Bacteria 2331
78 Ga0068866_10279117 3300005718 Bacteria 1034
79 Ga0068861_100012449 3300005719 Bacteria 5936
80 Ga0068870_10511512 3300005840 Bacteria 802
81 Ga0068863_100036987 3300005841 Bacteria 4648
82 Ga0068863_100322805 3300005841 Bacteria 1500
83 Ga0068858_100136536 3300005842 Bacteria 2301
84 Ga0068858_100750897 3300005842 Bacteria 951
85 Ga0068860_100006226 3300005843 Bacteria 11997
86 Ga0068860_100200386 3300005843 Bacteria 1934
87 Ga0068860_100643561 3300005843 Bacteria 1068
88 Ga0068862_100078250 3300005844 Bacteria 2865
89 Ga0070712_100023217 3300006175 Bacteria 4095
90 Ga0075428_100146217 3300006844 Bacteria 2569
91 Ga0075428_100602566 3300006844 Bacteria 1173
92 Ga0075430_100079734 3300006846 Bacteria 2743
93 Ga0075430_100106415 3300006846 Bacteria 2340
94 Ga0075430_101104145 3300006846 Bacteria 653
95 Ga0075431_100007055 3300006847 Bacteria 11158
96 Ga0075431_100091959 3300006847 Bacteria 3131
97 Ga0075431_101369930 3300006847 Bacteria 667
98 Ga0075433_10918316 3300006852 Unclassified 763
99 Ga0075433_11590679 3300006852 Unclassified 564
100 Ga0075429_100003519 3300006880 Bacteria 13343
101 Ga0075429_100006816 3300006880 Bacteria 9913
102 Ga0075429_101296388 3300006880 Unclassified 635
103 Ga0068865_100040543 3300006881 Bacteria 3165
104 Ga0075436_100202707 3300006914 Bacteria 1405
105 Ga0097620_100514494 3300006931 Bacteria 1292
106 Ga0105240_10088316 3300009093 Bacteria 3794
107 Ga0111539_10904032 3300009094 Unclassified 1027
108 Ga0114129_10095615 3300009147 Bacteria 4115
109 Ga0114129_10659136 3300009147 Unclassified 1350
110 Ga0114129_10776182 3300009147 Bacteria 1225
111 Ga0114129_11320485 3300009147 Bacteria 893
112 Ga0114129_12600497 3300009147 Bacteria 604
113 Ga0105243_10610819 3300009148 Bacteria 1051
114 Ga0105241_10032421 3300009174 Bacteria 3917
115 Ga0105241_10831981 3300009174 Unclassified 852
116 Ga0105242_10001116 3300009176 Bacteria 21161
117 Ga0105242_10253688 3300009176 Bacteria 1586
118 Ga0105248_10002777 3300009177 Bacteria 19467
119 Ga0105238_10554845 3300009551 Bacteria 1153
120 Ga0105249_10069689 3300009553 Bacteria 3246
121 Ga0105249_10093339 3300009553 Bacteria 2819
122 Ga0105239_10031233 3300010375 Bacteria 5859
123 Ga0105246_10056742 3300011119 Bacteria 2708
124 Ga0157378_10000391 3300013297 Bacteria 43180
125 Ga0163162_10023904 3300013306 Bacteria 6030
126 Ga0163162_10583712 3300013306 Unclassified 1244
127 Ga0157372_10727553 3300013307 Bacteria 1154
128 Ga0157375_10057001 3300013308 Bacteria 3860
129 Ga0157375_10367468 3300013308 Bacteria 1605
130 Ga0163163_10186038 3300014325 Bacteria 2125
131 Ga0163163_10224186 3300014325 Bacteria 1929
132 Ga0157379_10113363 3300014968 Bacteria 2437
133 Ga0157376_10302321 3300014969 Bacteria 1515
134 Ga0163161_10010248 3300017792 Bacteria 6490
135 Ga0207642_10000141 3300025899 Bacteria 20354
136 Ga0207642_10358470 3300025899 Bacteria 862
137 Ga0207642_10773901 3300025899 Bacteria 609
138 Ga0207699_10443178 3300025906 Bacteria 930
139 Ga0207645_10131404 3300025907 Bacteria 1629
140 Ga0207643_10045670 3300025908 Bacteria 2474
141 Ga0207643_10877122 3300025908 Bacteria 582
142 Ga0207654_10012985 3300025911 Bacteria 4275
143 Ga0207707_10043868 3300025912 Bacteria 3899
144 Ga0207707_10067195 3300025912 Bacteria 3123
145 Ga0207693_10049474 3300025915 Bacteria 3301
146 Ga0207663_10330910 3300025916 Bacteria 1147
147 Ga0207660_10016653 3300025917 Bacteria 4870
148 Ga0207660_10429747 3300025917 Bacteria 1066
149 Ga0207662_10478624 3300025918 Bacteria 855
150 Ga0207662_11299660 3300025918 Bacteria 517
151 Ga0207657_10647715 3300025919 Unclassified 822
152 Ga0207649_10239845 3300025920 Bacteria 1301
153 Ga0207652_10142576 3300025921 Bacteria 2143
154 Ga0207652_10519733 3300025921 Bacteria 1071
155 Ga0207646_10058526 3300025922 Bacteria 3442
156 Ga0207646_10165442 3300025922 Bacteria 1997
157 Ga0207681_10011492 3300025923 Bacteria 5440
158 Ga0207694_10400219 3300025924 Bacteria 1142
159 Ga0207687_10497870 3300025927 Archaea 1017
160 Ga0207644_11600143 3300025931 Unclassified 546
161 Ga0207690_10220315 3300025932 Bacteria 1451
162 Ga0207690_10242227 3300025932 Unclassified 1389
163 Ga0207706_10000457 3300025933 Bacteria 43553
164 Ga0207706_11150201 3300025933 Unclassified 647
165 Ga0207686_10000049 3300025934 Bacteria 115396
166 Ga0207709_10002628 3300025935 Bacteria 11181
167 Ga0207669_10000401 3300025937 Bacteria 19104
168 Ga0207669_11305480 3300025937 Bacteria 616
169 Ga0207704_10001407 3300025938 Bacteria 10754
170 Ga0207711_10000686 3300025941 Bacteria 33567
171 Ga0207689_10000895 3300025942 Bacteria 28650
172 Ga0207679_10449507 3300025945 Unclassified 1142
173 Ga0207679_11713815 3300025945 Bacteria 575
174 Ga0207667_10133988 3300025949 Bacteria 2551
175 Ga0207651_10859584 3300025960 Unclassified 806
176 Ga0207712_10001103 3300025961 Bacteria 18895
177 Ga0207712_10041175 3300025961 Bacteria 3174
178 Ga0207668_10020974 3300025972 Bacteria 4161
179 Ga0207640_10003689 3300025981 Bacteria 8256
180 Ga0207703_10367463 3300026035 Bacteria 1328
181 Ga0207639_10198033 3300026041 Bacteria 1720
182 Ga0207678_10181242 3300026067 Bacteria 1799
183 Ga0207678_10293136 3300026067 Bacteria 1398
184 Ga0207641_10039610 3300026088 Bacteria 3942
185 Ga0207648_10000011 3300026089 Bacteria 182284
186 Ga0207648_10307617 3300026089 Bacteria 1422
187 Ga0207676_10009558 3300026095 Bacteria 6904
188 Ga0207676_10065438 3300026095 Bacteria 2894
189 Ga0207676_10295100 3300026095 Bacteria 1478
190 Ga0207676_10531090 3300026095 Bacteria 1121
191 Ga0207674_10035432 3300026116 Bacteria 5207
192 Ga0207683_10002251 3300026121 Bacteria 16942
193 Ga0207683_12021173 3300026121 Bacteria 525
194 Ga0207698_10071454 3300026142 Bacteria 2754
195 Ga0209996_1051120 3300027395 Unclassified 626
196 Ga0209995_1008929 3300027471 Bacteria 1620
197 Ga0209974_10165284 3300027876 Bacteria 804
198 Ga0268265_10033283 3300028380 Bacteria 3746
199 Ga0268265_11163163 3300028380 Bacteria 768
200 Ga0268264_10007568 3300028381 Bacteria 9058
201 Ga0268264_11504629 3300028381 Bacteria 684
202 Ga0307408_100053512 3300031548 Bacteria 2915
203 Ga0307408_100073308 3300031548 Bacteria 2537
204 Ga0307405_10027768 3300031731 Bacteria 3287
205 Ga0307405_10031244 3300031731 Bacteria 3133
206 Ga0307413_10004487 3300031824 Bacteria 6080
207 Ga0307413_10021899 3300031824 Bacteria 3432
208 Ga0307413_10033794 3300031824 Bacteria 2916
209 Ga0307413_10049720 3300031824 Bacteria 2514
210 Ga0307413_10063616 3300031824 Bacteria 2288
211 Ga0307413_10078320 3300031824 Unclassified 2108
212 Ga0307410_10001421 3300031852 Bacteria 10773
213 Ga0307410_10021912 3300031852 Bacteria 3939
214 Ga0307410_10027668 3300031852 Bacteria 3586
215 Ga0307406_10025209 3300031901 Bacteria 3559
216 Ga0307406_10062737 3300031901 Unclassified 2405
217 Ga0307406_10076498 3300031901 Bacteria 2211
218 Ga0307406_10099280 3300031901 Bacteria 1979
219 Ga0307407_10015225 3300031903 Bacteria 3793
220 Ga0307407_10024538 3300031903 Bacteria 3164
221 Ga0307407_10227108 3300031903 Bacteria 1265
222 Ga0307412_10072644 3300031911 Bacteria 2352
223 Ga0307412_10074629 3300031911 Bacteria 2324
224 Ga0307409_100004650 3300031995 Bacteria 7756
225 Ga0307409_100071253 3300031995 Bacteria 2763
226 Ga0307409_100171514 3300031995 Bacteria 1910
227 Ga0307409_100173367 3300031995 Bacteria 1901
228 Ga0307409_100255206 3300031995 Bacteria 1605
229 Ga0307409_100368997 3300031995 Bacteria 1360
230 Ga0307409_100714653 3300031995 Bacteria 1002
231 Ga0307416_100004439 3300032002 Bacteria 8456
232 Ga0307416_100007825 3300032002 Bacteria 6832
233 Ga0307416_100015759 3300032002 Bacteria 5230
234 Ga0307416_100025794 3300032002 Bacteria 4317
235 Ga0307416_100498792 3300032002 Unclassified 1281
236 Ga0307416_100812160 3300032002 Bacteria 1031
237 Ga0307414_10018503 3300032004 Bacteria 4292
238 Ga0307414_10023515 3300032004 Bacteria 3910
239 Ga0307414_10065054 3300032004 Unclassified 2600
240 Ga0307414_10277856 3300032004 Bacteria 1406
241 Ga0307414_11125743 3300032004 Bacteria 725
242 Ga0307411_10051027 3300032005 Bacteria 2697
243 Ga0307411_10071186 3300032005 Bacteria 2356
244 Ga0307411_10090557 3300032005 Bacteria 2134
245 Ga0307415_100005227 3300032126 Bacteria 6865
246 Ga0307415_100051029 3300032126 Bacteria 2805
247 Ga0307415_100320569 3300032126 Bacteria 1292
248 Ga0307415_100618928 3300032126 Bacteria 966
249 Ga0307415_100702648 3300032126 Bacteria 913
250 Ga0373958_0145370 3300034819 Bacteria 590
251 Ga0373959_0086453 3300034820 Bacteria 729
252 Ga0373929_0017851 3300035085 Bacteria 1405
253 Ga0373940_0006120 3300035088 Bacteria 2648
254 Ga0373940_0050418 3300035088 Bacteria 1168
255 Ga0373949_0018815 3300035090 Bacteria 1569
256 Ga0373941_0094058 3300035115 Bacteria 1033
257 Ga0373960_0007828 3300035121 Bacteria 2542
258 Ga0373962_0176502 3300035242 Bacteria 712
259 Ga0373931_0160301 3300035691 Bacteria 1318
260 Ga0373931_0178398 3300035691 Bacteria 1256
261 Ga0395905_0106490 3300037471 Bacteria 2633
262 Ga0395901_0988406 3300038443 Bacteria 818
263 Ga0242420_006299 3300038996 Bacteria 1871
264 Ga0439457_017442 3300042014 Bacteria 1595
265 Ga0439446_0258326 3300042156 Bacteria 602
266 Ga0451577_0082732 3300042876 Bacteria 2863
267 Ga0451577_0486050 3300042876 Bacteria 1121
268 Ga0451577_0746241 3300042876 Bacteria 886
269 Ga0466964_0036697 3300044706 Bacteria 1967
270 Ga0453684_0139282 3300044712 Bacteria 2900
271 Ga0451576_0042056 3300045051 Bacteria 4825
272 Ga0451576_0926809 3300045051 Bacteria 914
273 Ga0495603_0222350 3300046455 Bacteria 1089
274 Ga0495641_0484135 3300046461 Bacteria 564
275 Ga0495622_0059115 3300046557 Bacteria 1775
276 Ga0495668_0194816 3300046616 Bacteria 1110
277 Ga0495659_0166289 3300046664 Unclassified 893
278 Ga0496100_0053068 3300048903 Bacteria 2639
279 Ga0496100_0125368 3300048903 Bacteria 1802
280 Ga0496100_0400115 3300048903 Bacteria 1046
281 Ga0496101_0051495 3300048904 Bacteria 2967
282 Ga0496102_0076062 3300048905 Bacteria 3087
283 Ga0496102_0199806 3300048905 Bacteria 1884
284 Ga0496103_0898704 3300048906 Bacteria 555
285 Ga0496104_0040471 3300048907 Bacteria 4368
286 Ga0496104_0184571 3300048907 Bacteria 1996
287 Ga0496105_0062259 3300048908 Bacteria 3079
288 Ga0496105_0279755 3300048908 Bacteria 1346
289 Ga0496106_0045699 3300048909 Bacteria 3290
290 Ga0496106_0059903 3300048909 Bacteria 2885
291 Ga0496106_0219032 3300048909 Bacteria 1518
292 Ga0496106_0352009 3300048909 Unclassified 1183
293 Ga0496108_0008066 3300048911 Bacteria 8544
294 Ga0496108_0038935 3300048911 Bacteria 3962
295 Ga0496108_0050523 3300048911 Bacteria 3480
296 Ga0496109_0015661 3300048912 Bacteria 6614
297 Ga0496109_0022447 3300048912 Bacteria 5589
298 Ga0496109_0069621 3300048912 Bacteria 3227
299 Ga0496110_0003328 3300048913 Bacteria 12280
300 Ga0496110_0053106 3300048913 Bacteria 3562
301 Ga0496110_0061037 3300048913 Bacteria 3326
302 Ga0496111_0010557 3300048914 Bacteria 6203
303 Ga0496111_0057181 3300048914 Bacteria 2824
304 Ga0496111_0096516 3300048914 Bacteria 2169
305 Ga0496112_0018597 3300048915 Bacteria 6546
306 Ga0496112_0070512 3300048915 Bacteria 3454
307 Ga0496112_0890090 3300048915 Unclassified 812
308 Ga0496113_0005261 3300048916 Bacteria 8058
309 Ga0496113_0022916 3300048916 Bacteria 4424
310 Ga0496114_0020610 3300048917 Bacteria 5352
311 Ga0496114_0060620 3300048917 Bacteria 3163
312 Ga0496114_1240245 3300048917 Unclassified 632
313 Ga0496115_0139066 3300048918 Bacteria 2003
314 Ga0501032_0608435 3300049569 Bacteria 695
315 Ga0501034_0005637 3300049571 Bacteria 13626
316 Ga0501034_0116880 3300049571 Bacteria 2655
317 Ga0501047_0085409 3300049581 Bacteria 3032
318 Ga0501047_0230211 3300049581 Bacteria 1707
319 Ga0501067_0004871 3300049583 Bacteria 7455
320 Ga0501067_0007550 3300049583 Bacteria 6045
321 Ga0501067_0024025 3300049583 Bacteria 3380
322 Ga0501067_0035994 3300049583 Bacteria 2749
323 Ga0501068_0000107 3300049584 Bacteria 35803
324 Ga0501068_0000534 3300049584 Bacteria 19220
325 Ga0501069_0037892 3300049585 Bacteria 2660
326 Ga0501069_0070369 3300049585 Bacteria 1959
327 Ga0501070_0026763 3300049586 Bacteria 4837
328 Ga0501070_0087098 3300049586 Bacteria 2585
329 Ga0501070_0225739 3300049586 Bacteria 1535
330 Ga0501071_0002672 3300049587 Bacteria 10915
331 Ga0501071_0003974 3300049587 Bacteria 9328
332 Ga0501072_0059381 3300049588 Bacteria 3015
333 Ga0501073_0032056 3300049589 Bacteria 3748
334 Ga0501073_0490572 3300049589 Bacteria 849
335 Ga0501073_0678361 3300049589 Bacteria 711
336 Ga0501074_0010562 3300049590 Bacteria 6701
337 Ga0501074_0056514 3300049590 Bacteria 2828
338 Ga0501074_0985672 3300049590 Bacteria 593
339 Ga0501076_0345608 3300049592 Bacteria 1221
340 Ga0501206_103033 3300049653 Bacteria 519
341 Ga0501209_285386 3300049656 Bacteria 518
342 Ga0501233_009060 3300049668 Bacteria 1935
343 Ga0501235_199966 3300049669 Bacteria 540
344 Ga0501248_010464 3300049678 Bacteria 824
345 Ga0501250_029025 3300049680 Bacteria 759
346 Ga0501253_024718 3300049683 Bacteria 1092
347 Ga0501225_0025962 3300049705 Bacteria 1611
348 Ga0501225_0300556 3300049705 Bacteria 543
349 Ga0501079_0111680 3300049741 Bacteria 2124
350 Ga0501080_0032577 3300049742 Bacteria 4861
351 Ga0501080_0073121 3300049742 Bacteria 3189
352 Ga0501080_0158144 3300049742 Bacteria 2093
353 Ga0501081_1544622 3300049743 Bacteria 504
354 Ga0501083_0027780 3300049744 Bacteria 3902
355 Ga0501083_0032336 3300049744 Bacteria 3589
356 Ga0501263_009343 3300049760 Bacteria 1185
357 Ga0501268_005159 3300049765 Bacteria 1867
358 Ga0501270_004405 3300049767 Bacteria 1578
359 Ga0501044_0338025 3300049823 Bacteria 1427
360 Ga0501204_053672 3300049850 Bacteria 624
361 nmdc:mga05p37_1266840_c1 3300050507 Bacteria 755
362 nmdc:mga05p37_399180_c1 3300050507 Bacteria 1272
363 nmdc:mga05p37_443686_c2 3300050507 Unclassified 763
364 nmdc:mga09592_5138_c1 3300050508 Bacteria 10630
365 nmdc:mga0qj67_72577_c1 3300050509 Bacteria 793
366 nmdc:mga06r32_10243_c1 3300050510 Bacteria 8458
367 nmdc:mga06r32_1310467_c1 3300050510 Bacteria 668
368 nmdc:mga06r32_532933_c1 3300050510 Bacteria 1149
369 nmdc:mga06r32_70503_c1 3300050510 Bacteria 3380
370 nmdc:mga08y16_704013_c1 3300050511 Unclassified 1010
371 nmdc:mga0n895_185974_c1 3300050512 Bacteria 2108
372 nmdc:mga0n895_621884_c1 3300050512 Bacteria 1081
373 nmdc:mga0a205_1172375_c1 3300050515 Bacteria 616
374 nmdc:mga0a205_829720_c1 3300050515 Unclassified 772
375 Ga0501084_0000269 3300054114 Bacteria 39257
376 Ga0501084_0017391 3300054114 Bacteria 5977
377 Ga0590071_007153 3300059421 Bacteria 2642
378 Ga0590075_089857 3300059424 Bacteria 797
379 Ga0590077_020162 3300059426 Bacteria 1415
380 Ga0501082_0012998 3300060353 Bacteria 7155
381 Ga0501082_0040549 3300060353 Bacteria 4015
382 Ga0530510_0171310 3300061734 Bacteria 1608
383 Ga0070708_100476134
384 MBSR1b_contig_8174435
385 rootL2_10164352
386 Ga0070676_10111710
387 Ga0070670_100600001
388 Ga0068869_100224858
389 Ga0070680_100005407
390 Ga0070691_10053653
391 Ga0070691_10092759
392 Ga0070687_100355952
393 Ga0070692_10219449
394 Ga0070669_100105231
395 Ga0070671_100097308
396 Ga0070674_100000401
397 Ga0070674_100583021
398 Ga0070674_101758601
399 Ga0070673_100381764
400 Ga0070659_100144678
401 Ga0070701_10428641
402 Ga0070711_100014365
403 Ga0070705_100000621
404 Ga0070705_100027223
405 Ga0070700_100096424
406 Ga0070700_100101584
407 Ga0070694_100206397
408 Ga0070694_100480464
409 Ga0070694_100995328
410 Ga0070708_100516359
411 Ga0070663_100335506
412 Ga0070663_100886309
413 Ga0070678_100000727
414 Ga0070662_100000249
415 Ga0070681_10434567
416 Ga0070681_11529259
417 Ga0068867_100000798
418 Ga0068867_100413541
419 Ga0070706_100089767
420 Ga0070706_100525540
421 Ga0070707_100255117
422 Ga0070707_100447992
423 Ga0070707_100697269
424 Ga0070698_100107205
425 Ga0070699_100000017
426 Ga0070699_100004735
427 Ga0070679_100160270
428 Ga0070679_100445287
429 Ga0070684_100304777
430 Ga0070697_100010131
431 Ga0070697_100732939
432 Ga0070686_100028542
433 Ga0070686_100447453
434 Ga0070695_100108589
435 Ga0070695_100345897
436 Ga0070695_100726706
437 Ga0070696_100000578
438 Ga0070696_100157522
439 Ga0070696_100161305
440 Ga0070696_100259504
441 Ga0070696_100380392
442 Ga0070696_100739060
443 Ga0070693_100012337
444 Ga0070693_100068416
445 Ga0070693_100567889
446 Ga0070704_100081306
447 Ga0070704_100245139
448 Ga0070704_100349199
449 Ga0068855_100080895
450 Ga0068857_100001149
451 Ga0068854_100005070
452 Ga0068854_100149674
453 Ga0070702_100002431
454 Ga0070702_100067868
455 Ga0068852_100254512
456 Ga0068859_100514503
457 Ga0068864_100063626
458 Ga0068866_10000023
459 Ga0068866_10039476
460 Ga0068866_10279117
461 Ga0068861_100012449
462 Ga0068870_10511512
463 Ga0068863_100036987
464 Ga0068863_100322805
465 Ga0068858_100136536
466 Ga0068858_100750897
467 Ga0068860_100006226
468 Ga0068860_100200386
469 Ga0068860_100643561
470 Ga0068862_100078250
471 Ga0070712_100023217
472 Ga0075428_100146217
473 Ga0075428_100602566
474 Ga0075430_100079734
475 Ga0075430_100106415
476 Ga0075430_101104145
477 Ga0075431_100007055
478 Ga0075431_100091959
479 Ga0075431_101369930
480 Ga0075433_10918316
481 Ga0075433_11590679
482 Ga0075429_100003519
483 Ga0075429_100006816
484 Ga0075429_101296388
485 Ga0068865_100040543
486 Ga0075436_100202707
487 Ga0097620_100514494
488 Ga0105240_10088316
489 Ga0111539_10904032
490 Ga0114129_10095615
491 Ga0114129_10659136
492 Ga0114129_10776182
493 Ga0114129_11320485
494 Ga0114129_12600497
495 Ga0105243_10610819
496 Ga0105241_10032421
497 Ga0105241_10831981
498 Ga0105242_10001116
499 Ga0105242_10253688
500 Ga0105248_10002777
501 Ga0105238_10554845
502 Ga0105249_10069689
503 Ga0105249_10093339
504 Ga0105239_10031233
505 Ga0105246_10056742
506 Ga0157378_10000391
507 Ga0163162_10023904
508 Ga0163162_10583712
509 Ga0157372_10727553
510 Ga0157375_10057001
511 Ga0157375_10367468
512 Ga0163163_10186038
513 Ga0163163_10224186
514 Ga0157379_10113363
515 Ga0157376_10302321
516 Ga0163161_10010248
517 Ga0207642_10000141
518 Ga0207642_10358470
519 Ga0207642_10773901
520 Ga0207699_10443178
521 Ga0207645_10131404
522 Ga0207643_10045670
523 Ga0207643_10877122
524 Ga0207654_10012985
525 Ga0207707_10043868
526 Ga0207707_10067195
527 Ga0207693_10049474
528 Ga0207663_10330910
529 Ga0207660_10016653
530 Ga0207660_10429747
531 Ga0207662_10478624
532 Ga0207662_11299660
533 Ga0207657_10647715
534 Ga0207649_10239845
535 Ga0207652_10142576
536 Ga0207652_10519733
537 Ga0207646_10058526
538 Ga0207646_10165442
539 Ga0207681_10011492
540 Ga0207694_10400219
541 Ga0207687_10497870
542 Ga0207644_11600143
543 Ga0207690_10220315
544 Ga0207690_10242227
545 Ga0207706_10000457
546 Ga0207706_11150201
547 Ga0207686_10000049
548 Ga0207709_10002628
549 Ga0207669_10000401
550 Ga0207669_11305480
551 Ga0207704_10001407
552 Ga0207711_10000686
553 Ga0207689_10000895
554 Ga0207679_10449507
555 Ga0207679_11713815
556 Ga0207667_10133988
557 Ga0207651_10859584
558 Ga0207712_10001103
559 Ga0207712_10041175
560 Ga0207668_10020974
561 Ga0207640_10003689
562 Ga0207703_10367463
563 Ga0207639_10198033
564 Ga0207678_10181242
565 Ga0207678_10293136
566 Ga0207641_10039610
567 Ga0207648_10000011
568 Ga0207648_10307617
569 Ga0207676_10009558
570 Ga0207676_10065438
571 Ga0207676_10295100
572 Ga0207676_10531090
573 Ga0207674_10035432
574 Ga0207683_10002251
575 Ga0207683_12021173
576 Ga0207698_10071454
577 Ga0209996_1051120
578 Ga0209995_1008929
579 Ga0209974_10165284
580 Ga0268265_10033283
581 Ga0268265_11163163
582 Ga0268264_10007568
583 Ga0268264_11504629
584 Ga0307408_100053512
585 Ga0307408_100073308
586 Ga0307405_10027768
587 Ga0307405_10031244
588 Ga0307413_10004487
589 Ga0307413_10021899
590 Ga0307413_10033794
591 Ga0307413_10049720
592 Ga0307413_10063616
593 Ga0307413_10078320
594 Ga0307410_10001421
595 Ga0307410_10021912
596 Ga0307410_10027668
597 Ga0307406_10025209
598 Ga0307406_10062737
599 Ga0307406_10076498
600 Ga0307406_10099280
601 Ga0307407_10015225
602 Ga0307407_10024538
603 Ga0307407_10227108
604 Ga0307412_10072644
605 Ga0307412_10074629
606 Ga0307409_100004650
607 Ga0307409_100071253
608 Ga0307409_100171514
609 Ga0307409_100173367
610 Ga0307409_100255206
611 Ga0307409_100368997
612 Ga0307409_100714653
613 Ga0307416_100004439
614 Ga0307416_100007825
615 Ga0307416_100015759
616 Ga0307416_100025794
617 Ga0307416_100498792
618 Ga0307416_100812160
619 Ga0307414_10018503
620 Ga0307414_10023515
621 Ga0307414_10065054
622 Ga0307414_10277856
623 Ga0307414_11125743
624 Ga0307411_10051027
625 Ga0307411_10071186
626 Ga0307411_10090557
627 Ga0307415_100005227
628 Ga0307415_100051029
629 Ga0307415_100320569
630 Ga0307415_100618928
631 Ga0307415_100702648
632 Ga0373958_0145370
633 Ga0373959_0086453
634 Ga0373929_0017851
635 Ga0373940_0006120
636 Ga0373940_0050418
637 Ga0373949_0018815
638 Ga0373941_0094058
639 Ga0373960_0007828
640 Ga0373962_0176502
641 Ga0373931_0160301
642 Ga0373931_0178398
643 Ga0395905_0106490
644 Ga0395901_0988406
645 Ga0242420_006299
646 Ga0439457_017442
647 Ga0439446_0258326
648 Ga0451577_0082732
649 Ga0451577_0486050
650 Ga0451577_0746241
651 Ga0466964_0036697
652 Ga0453684_0139282
653 Ga0451576_0042056
654 Ga0451576_0926809
655 Ga0495603_0222350
656 Ga0495641_0484135
657 Ga0495622_0059115
658 Ga0495668_0194816
659 Ga0495659_0166289
660 Ga0496100_0053068
661 Ga0496100_0125368
662 Ga0496100_0400115
663 Ga0496101_0051495
664 Ga0496102_0076062
665 Ga0496102_0199806
666 Ga0496103_0898704
667 Ga0496104_0040471
668 Ga0496104_0184571
669 Ga0496105_0062259
670 Ga0496105_0279755
671 Ga0496106_0045699
672 Ga0496106_0059903
673 Ga0496106_0219032
674 Ga0496106_0352009
675 Ga0496108_0008066
676 Ga0496108_0038935
677 Ga0496108_0050523
678 Ga0496109_0015661
679 Ga0496109_0022447
680 Ga0496109_0069621
681 Ga0496110_0003328
682 Ga0496110_0053106
683 Ga0496110_0061037
684 Ga0496111_0010557
685 Ga0496111_0057181
686 Ga0496111_0096516
687 Ga0496112_0018597
688 Ga0496112_0070512
689 Ga0496112_0890090
690 Ga0496113_0005261
691 Ga0496113_0022916
692 Ga0496114_0020610
693 Ga0496114_0060620
694 Ga0496114_1240245
695 Ga0496115_0139066
696 Ga0501032_0608435
697 Ga0501034_0005637
698 Ga0501034_0116880
699 Ga0501047_0085409
700 Ga0501047_0230211
701 Ga0501067_0004871
702 Ga0501067_0007550
703 Ga0501067_0024025
704 Ga0501067_0035994
705 Ga0501068_0000107
706 Ga0501068_0000534
707 Ga0501069_0037892
708 Ga0501069_0070369
709 Ga0501070_0026763
710 Ga0501070_0087098
711 Ga0501070_0225739
712 Ga0501071_0002672
713 Ga0501071_0003974
714 Ga0501072_0059381
715 Ga0501073_0032056
716 Ga0501073_0490572
717 Ga0501073_0678361
718 Ga0501074_0010562
719 Ga0501074_0056514
720 Ga0501074_0985672
721 Ga0501076_0345608
722 Ga0501206_103033
723 Ga0501209_285386
724 Ga0501233_009060
725 Ga0501235_199966
726 Ga0501248_010464
727 Ga0501250_029025
728 Ga0501253_024718
729 Ga0501225_0025962
730 Ga0501225_0300556
731 Ga0501079_0111680
732 Ga0501080_0032577
733 Ga0501080_0073121
734 Ga0501080_0158144
735 Ga0501081_1544622
736 Ga0501083_0027780
737 Ga0501083_0032336
738 Ga0501263_009343
739 Ga0501268_005159
740 Ga0501270_004405
741 Ga0501044_0338025
742 Ga0501204_053672
743 nmdc:mga05p37_1266840_c1
744 nmdc:mga05p37_399180_c1
745 nmdc:mga05p37_443686_c2
746 nmdc:mga09592_5138_c1
747 nmdc:mga0qj67_72577_c1
748 nmdc:mga06r32_10243_c1
749 nmdc:mga06r32_1310467_c1
750 nmdc:mga06r32_532933_c1
751 nmdc:mga06r32_70503_c1
752 nmdc:mga08y16_704013_c1
753 nmdc:mga0n895_185974_c1
754 nmdc:mga0n895_621884_c1
755 nmdc:mga0a205_1172375_c1
756 nmdc:mga0a205_829720_c1
757 Ga0501084_0000269
758 Ga0501084_0017391
759 Ga0590071_007153
760 Ga0590075_089857
761 Ga0590077_020162
762 Ga0501082_0012998
763 Ga0501082_0040549
764 Ga0530510_0171310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07884

VKOR

Vitamin K epoxide reductase family

6

132

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nv5-assembly1.cif.gz_A c50a mutant of synechococcus vkor, c2 crystal form (dehydrated) 0.8052 4 133
4nv5-assembly2.cif.gz_B c50a mutant of synechococcus vkor, c2 crystal form (dehydrated) 0.7959 3 133
3kp9-assembly1.cif.gz_A structure of a bacterial homolog of vitamin k epoxide reductase 0.7819 4 133
4nv2-assembly1.cif.gz_A c50a mutant of synechococcus vkor, c2221 crystal form 0.7801 4 133
4nv6-assembly1.cif.gz_A c212a mutant of synechococcus vkor 0.768 4 133
ID Description Score Start End Superfamily
3kp9A01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8167 4 133 1.20.1440.130
4nv5A01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8052 4 133 1.20.1440.130
af_A1ZAJ5_3_151_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.7757 3 137 1.20.1440.130
af_I6X5W1_15_164_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.7618 3 135 1.20.1440.130
af_Q54V87_14_188_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.7598 3 142 1.20.1440.130
ID Description Score Start End GO Terms
AF-A0A2V7S9F4-F1-model_v4 Vitamin K epoxide reductase 0.8934 1 137 GO:0016020
GO:0016491
GO:0048038
AF-A0A7Y5PBN3-F1-model_v4 Vitamin K epoxide reductase family protein 0.8867 1 137 GO:0016020
GO:0016491
GO:0048038
AF-A0A7W1UIM1-F1-model_v4 Vitamin K epoxide reductase family protein 0.8855 2 137 GO:0016020
GO:0016491
GO:0048038
AF-A0A2V7IKM4-F1-model_v4 Vitamin K epoxide reductase 0.8853 1 137 GO:0016020
GO:0016491
GO:0048038
AF-A0A800F7U1-F1-model_v4 Vitamin K epoxide reductase family protein 0.8835 1 137 GO:0016020
GO:0016491
GO:0048038

Map