F429206

General Info

Members Datasets Scaffolds Average Seq Length
382 221 382 215

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100046503|Ga0070707_1000465032
Length 247
Sequence VYPEMIPTSSAEQVLQTLAGFKEYAASTLMVLELAGTFVFALSGAAAGVKYRLDLFGVLVVSCATGTAGGITRDVLIGAVPPVALRDWRYLGISVLAGLVVFLASPGPERQQRLRNLVLTFDAAGLALFAVSGTQTALAYGLNPVMAALLGMLTGIGGGMLRDVLVSDIPAVLHSDLYAVAALAGAIIVVAGHVLNAPPAASALAGATLCFGIRLIALWRGWQLPTAGGKKNAVGSAHNEGGRRDPP

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
161 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
162 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 0.79
Rhizosphere 97.38
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10089571 3300003322 Bacteria 1775
2 Ga0065715_10003875 3300005293 Bacteria 4213
3 Ga0070676_10001014 3300005328 Bacteria 13932
4 Ga0070683_100761436 3300005329 Bacteria 928
5 Ga0070690_100064381 3300005330 Bacteria 2368
6 Ga0070670_100009322 3300005331 Bacteria 8384
7 Ga0068869_100001246 3300005334 Bacteria 15025
8 Ga0068869_100052631 3300005334 Bacteria 2956
9 Ga0070680_100009452 3300005336 Bacteria 7490
10 Ga0070680_100067759 3300005336 Bacteria 2928
11 Ga0068868_100075556 3300005338 Bacteria 2693
12 Ga0070660_100000205 3300005339 Bacteria 39619
13 Ga0070660_100628618 3300005339 Bacteria 899
14 Ga0070687_100100235 3300005343 Bacteria 1620
15 Ga0070661_100000447 3300005344 Bacteria 31537
16 Ga0070692_10000692 3300005345 Bacteria 10840
17 Ga0070669_100095473 3300005353 Bacteria 2236
18 Ga0070673_100176020 3300005364 Bacteria 1829
19 Ga0070659_100000317 3300005366 Bacteria 37337
20 Ga0070659_100024100 3300005366 Bacteria 4663
21 Ga0070659_100261854 3300005366 Bacteria 1435
22 Ga0070709_10056796 3300005434 Bacteria 2477
23 Ga0070709_10646997 3300005434 Unclassified 818
24 Ga0070714_100182786 3300005435 Bacteria 1909
25 Ga0070714_100211929 3300005435 Bacteria 1776
26 Ga0070714_100529516 3300005435 Unclassified 1126
27 Ga0070713_100532007 3300005436 Bacteria 1112
28 Ga0070711_100176180 3300005439 Bacteria 1634
29 Ga0070705_100091481 3300005440 Bacteria 1897
30 Ga0070705_100319906 3300005440 Bacteria 1119
31 Ga0070694_100000789 3300005444 Bacteria 17724
32 Ga0070694_100008014 3300005444 Bacteria 6455
33 Ga0070694_100017544 3300005444 Bacteria 4524
34 Ga0070708_100027070 3300005445 Bacteria 4915
35 Ga0070708_100089392 3300005445 Bacteria 2802
36 Ga0070708_100250852 3300005445 Bacteria 1663
37 Ga0070708_100461838 3300005445 Bacteria 1198
38 Ga0070708_100795097 3300005445 Unclassified 889
39 Ga0070662_100011296 3300005457 Bacteria 5888
40 Ga0070662_100070072 3300005457 Bacteria 2583
41 Ga0070681_10006327 3300005458 Bacteria 11515
42 Ga0070681_10018938 3300005458 Bacteria 6889
43 Ga0070681_10096369 3300005458 Bacteria 2906
44 Ga0070681_10337954 3300005458 Bacteria 1415
45 Ga0070681_10356511 3300005458 Bacteria 1373
46 Ga0068867_100000839 3300005459 Bacteria 20657
47 Ga0068867_100300936 3300005459 Unclassified 1322
48 Ga0070706_100398267 3300005467 Bacteria 1282
49 Ga0070707_100034310 3300005468 Bacteria 4840
50 Ga0070707_100043560 3300005468 Bacteria 4295
51 Ga0070707_100046503 3300005468 Unclassified 4153
52 Ga0070698_100127717 3300005471 Bacteria 2499
53 Ga0070699_100035837 3300005518 Bacteria 4289
54 Ga0070699_100085742 3300005518 Unclassified 2748
55 Ga0070699_100305534 3300005518 Bacteria 1427
56 Ga0070679_100000646 3300005530 Bacteria 29694
57 Ga0070679_100037049 3300005530 Bacteria 4842
58 Ga0070679_100253737 3300005530 Bacteria 1715
59 Ga0070679_100752149 3300005530 Unclassified 917
60 Ga0070684_100011549 3300005535 Bacteria 7035
61 Ga0070684_100267400 3300005535 Bacteria 1565
62 Ga0070684_100277571 3300005535 Bacteria 1535
63 Ga0070684_100403419 3300005535 Unclassified 1261
64 Ga0070697_100200136 3300005536 Bacteria 1698
65 Ga0070697_100416092 3300005536 Bacteria 1168
66 Ga0068853_100036165 3300005539 Bacteria 4197
67 Ga0068853_100225426 3300005539 Bacteria 1713
68 Ga0070672_100212912 3300005543 Bacteria 1619
69 Ga0070686_100578354 3300005544 Bacteria 882
70 Ga0070695_100001011 3300005545 Bacteria 15323
71 Ga0070695_100045295 3300005545 Bacteria 2803
72 Ga0070695_100078740 3300005545 Unclassified 2174
73 Ga0070696_100000978 3300005546 Bacteria 18538
74 Ga0070696_100037591 3300005546 Bacteria 3340
75 Ga0070696_100055828 3300005546 Bacteria 2754
76 Ga0070693_100000254 3300005547 Bacteria 24884
77 Ga0070693_100184295 3300005547 Bacteria 1346
78 Ga0070704_100022922 3300005549 Bacteria 4069
79 Ga0068855_100012039 3300005563 Bacteria 10457
80 Ga0068855_100043224 3300005563 Bacteria 5338
81 Ga0068855_100212724 3300005563 Bacteria 2172
82 Ga0068855_100568641 3300005563 Bacteria 1225
83 Ga0068855_100765436 3300005563 Bacteria 1028
84 Ga0070664_100011899 3300005564 Bacteria 7062
85 Ga0070664_100446755 3300005564 Bacteria 1187
86 Ga0070664_100633752 3300005564 Bacteria 993
87 Ga0068857_100098437 3300005577 Bacteria 2623
88 Ga0068857_100192901 3300005577 Bacteria 1856
89 Ga0068856_100030823 3300005614 Bacteria 5244
90 Ga0068856_100552759 3300005614 Unclassified 1172
91 Ga0068856_101263021 3300005614 Unclassified 754
92 Ga0068852_100441399 3300005616 Bacteria 1287
93 Ga0068852_100689707 3300005616 Bacteria 1031
94 Ga0068852_100887810 3300005616 Unclassified 908
95 Ga0068859_100000673 3300005617 Bacteria 34234
96 Ga0068864_100859735 3300005618 Unclassified 894
97 Ga0068861_100003194 3300005719 Bacteria 10839
98 Ga0068863_100026154 3300005841 Bacteria 5569
99 Ga0068858_100386208 3300005842 Unclassified 1344
100 Ga0068860_100294720 3300005843 Bacteria 1588
101 Ga0068862_100124945 3300005844 Bacteria 2271
102 Ga0075432_10072493 3300006058 Bacteria 1239
103 Ga0070716_100054408 3300006173 Unclassified 2286
104 Ga0070716_100818217 3300006173 Unclassified 723
105 Ga0070712_100115762 3300006175 Bacteria 2009
106 Ga0068871_100356938 3300006358 Unclassified 1294
107 Ga0075430_100021961 3300006846 Bacteria 5424
108 Ga0075430_100201540 3300006846 Bacteria 1652
109 Ga0075431_100000350 3300006847 Bacteria 36472
110 Ga0075431_100033984 3300006847 Bacteria 5255
111 Ga0075431_100236258 3300006847 Bacteria 1861
112 Ga0075433_10342690 3300006852 Bacteria 1321
113 Ga0075433_10445903 3300006852 Bacteria 1141
114 Ga0075434_100274135 3300006871 Bacteria 1706
115 Ga0075434_100420860 3300006871 Unclassified 1357
116 Ga0075429_100002202 3300006880 Bacteria 16305
117 Ga0075429_100387054 3300006880 Bacteria 1224
118 Ga0075436_100038648 3300006914 Bacteria 3294
119 Ga0097620_100000673 3300006931 Bacteria 34234
120 Ga0075435_100051586 3300007076 Bacteria 3314
121 Ga0075435_100351299 3300007076 Bacteria 1264
122 Ga0105240_10001370 3300009093 Bacteria 41899
123 Ga0105240_10054246 3300009093 Bacteria 5024
124 Ga0105240_10054689 3300009093 Bacteria 5001
125 Ga0111539_10009287 3300009094 Bacteria 12418
126 Ga0111539_10042850 3300009094 Bacteria 5431
127 Ga0105245_10061323 3300009098 Bacteria 3390
128 Ga0105245_10079289 3300009098 Bacteria 2998
129 Ga0105245_10909841 3300009098 Bacteria 922
130 Ga0114129_10124926 3300009147 Bacteria 3538
131 Ga0114129_10182825 3300009147 Bacteria 2851
132 Ga0114129_10275022 3300009147 Bacteria 2252
133 Ga0114129_10960644 3300009147 Bacteria 1079
134 Ga0114129_10973398 3300009147 Bacteria 1070
135 Ga0105243_10031842 3300009148 Bacteria 4069
136 Ga0105241_10009734 3300009174 Bacteria 7064
137 Ga0105241_10023491 3300009174 Bacteria 4572
138 Ga0105241_10032206 3300009174 Bacteria 3929
139 Ga0105241_10595584 3300009174 Bacteria 998
140 Ga0105242_10004396 3300009176 Bacteria 10961
141 Ga0105242_10005181 3300009176 Bacteria 10061
142 Ga0105248_10024439 3300009177 Bacteria 6717
143 Ga0105237_10285593 3300009545 Bacteria 1653
144 Ga0105237_10563506 3300009545 Bacteria 1146
145 Ga0105238_10055283 3300009551 Bacteria 3985
146 Ga0105238_10273844 3300009551 Bacteria 1669
147 Ga0105238_10355208 3300009551 Unclassified 1455
148 Ga0105238_10399404 3300009551 Bacteria 1368
149 Ga0105249_10030664 3300009553 Bacteria 4862
150 Ga0105239_10313707 3300010375 Bacteria 1767
151 Ga0105239_10423438 3300010375 Unclassified 1508
152 Ga0105239_10461946 3300010375 Bacteria 1441
153 Ga0105239_10505675 3300010375 Unclassified 1374
154 Ga0157373_10001228 3300013100 Bacteria 19609
155 Ga0157371_10628404 3300013102 Bacteria 800
156 Ga0157370_10456645 3300013104 Bacteria 1174
157 Ga0157369_10186202 3300013105 Bacteria 2183
158 Ga0157369_10959432 3300013105 Unclassified 876
159 Ga0157378_10180934 3300013297 Bacteria 1983
160 Ga0163162_10606289 3300013306 Bacteria 1221
161 Ga0157372_10001508 3300013307 Bacteria 25304
162 Ga0157372_10018833 3300013307 Bacteria 7428
163 Ga0157372_10510788 3300013307 Bacteria 1401
164 Ga0157372_10650754 3300013307 Bacteria 1227
165 Ga0157372_10754720 3300013307 Bacteria 1131
166 Ga0157372_10827750 3300013307 Bacteria 1075
167 Ga0157375_10436047 3300013308 Bacteria 1476
168 Ga0163163_10193545 3300014325 Bacteria 2082
169 Ga0157377_10420383 3300014745 Bacteria 915
170 Ga0213872_10079559 3300021361 Bacteria 1473
171 Ga0213876_10265416 3300021384 Bacteria 912
172 Ga0228598_1008187 3300024227 Unclassified 2116
173 Ga0209148_1001290 3300025254 Bacteria 13592
174 Ga0207653_10010692 3300025885 Bacteria 2865
175 Ga0207692_10153292 3300025898 Unclassified 1321
176 Ga0207688_10008862 3300025901 Bacteria 5473
177 Ga0207688_10287816 3300025901 Bacteria 1002
178 Ga0207645_10000584 3300025907 Bacteria 30274
179 Ga0207645_10067189 3300025907 Bacteria 2291
180 Ga0207643_10099531 3300025908 Bacteria 1704
181 Ga0207684_10060077 3300025910 Bacteria 3228
182 Ga0207684_10065369 3300025910 Bacteria 3088
183 Ga0207684_10515018 3300025910 Unclassified 1025
184 Ga0207654_10004291 3300025911 Bacteria 7191
185 Ga0207654_10015860 3300025911 Bacteria 3917
186 Ga0207654_10744903 3300025911 Bacteria 706
187 Ga0207707_10000251 3300025912 Bacteria 58978
188 Ga0207707_10067280 3300025912 Bacteria 3120
189 Ga0207707_10171311 3300025912 Bacteria 1897
190 Ga0207707_10210016 3300025912 Bacteria 1696
191 Ga0207707_10255711 3300025912 Bacteria 1521
192 Ga0207707_10290816 3300025912 Bacteria 1414
193 Ga0207695_10045267 3300025913 Bacteria 4672
194 Ga0207695_10066129 3300025913 Bacteria 3714
195 Ga0207695_10539521 3300025913 Unclassified 1048
196 Ga0207671_10600080 3300025914 Unclassified 877
197 Ga0207693_10159670 3300025915 Bacteria 1773
198 Ga0207693_10312652 3300025915 Bacteria 1230
199 Ga0207660_10000250 3300025917 Bacteria 35005
200 Ga0207657_10000802 3300025919 Bacteria 33284
201 Ga0207649_10022251 3300025920 Bacteria 3661
202 Ga0207652_10000359 3300025921 Bacteria 47235
203 Ga0207652_10007073 3300025921 Bacteria 9043
204 Ga0207652_10245052 3300025921 Bacteria 1616
205 Ga0207652_10702700 3300025921 Bacteria 902
206 Ga0207646_10016766 3300025922 Bacteria 6872
207 Ga0207646_10025739 3300025922 Bacteria 5380
208 Ga0207646_10040230 3300025922 Unclassified 4205
209 Ga0207646_10045173 3300025922 Bacteria 3954
210 Ga0207681_10127583 3300025923 Bacteria 1876
211 Ga0207681_10272968 3300025923 Bacteria 1328
212 Ga0207694_10080934 3300025924 Bacteria 2550
213 Ga0207694_10116206 3300025924 Unclassified 2132
214 Ga0207694_10145763 3300025924 Bacteria 1906
215 Ga0207650_10023155 3300025925 Bacteria 4404
216 Ga0207687_10070668 3300025927 Bacteria 2492
217 Ga0207664_10689364 3300025929 Bacteria 919
218 Ga0207690_10000701 3300025932 Bacteria 21602
219 Ga0207706_10009146 3300025933 Bacteria 9108
220 Ga0207706_10038007 3300025933 Bacteria 4271
221 Ga0207686_10036231 3300025934 Bacteria 2969
222 Ga0207686_10058321 3300025934 Bacteria 2434
223 Ga0207670_10017215 3300025936 Bacteria 4365
224 Ga0207691_10012327 3300025940 Bacteria 8194
225 Ga0207711_10105668 3300025941 Bacteria 2497
226 Ga0207689_10002375 3300025942 Bacteria 17568
227 Ga0207689_10006150 3300025942 Bacteria 10626
228 Ga0207661_10038791 3300025944 Bacteria 3736
229 Ga0207661_10098001 3300025944 Bacteria 2456
230 Ga0207679_10007020 3300025945 Bacteria 7137
231 Ga0207667_10009758 3300025949 Bacteria 11290
232 Ga0207667_10262978 3300025949 Bacteria 1764
233 Ga0207651_10133796 3300025960 Bacteria 1903
234 Ga0207712_10055668 3300025961 Bacteria 2783
235 Ga0207640_10001304 3300025981 Bacteria 13533
236 Ga0207703_10413167 3300026035 Unclassified 1254
237 Ga0207639_10003624 3300026041 Bacteria 10372
238 Ga0207678_10000988 3300026067 Bacteria 25935
239 Ga0207702_10005888 3300026078 Bacteria 10661
240 Ga0207702_11002551 3300026078 Unclassified 828
241 Ga0207641_10011793 3300026088 Bacteria 7175
242 Ga0207648_10001427 3300026089 Bacteria 26302
243 Ga0207648_10041278 3300026089 Bacteria 4052
244 Ga0207676_10175784 3300026095 Bacteria 1870
245 Ga0207676_10291204 3300026095 Bacteria 1487
246 Ga0207676_10773831 3300026095 Unclassified 935
247 Ga0207674_10002580 3300026116 Bacteria 22807
248 Ga0207674_10215818 3300026116 Bacteria 1867
249 Ga0207675_100005158 3300026118 Bacteria 12582
250 Ga0207675_100940849 3300026118 Bacteria 881
251 Ga0207698_10245054 3300026142 Bacteria 1636
252 Ga0207428_10000628 3300027907 Bacteria 41501
253 Ga0207428_10004424 3300027907 Bacteria 13376
254 Ga0268265_10020874 3300028380 Bacteria 4578
255 Ga0268265_10040806 3300028380 Bacteria 3429
256 Ga0268264_10093820 3300028381 Bacteria 2594
257 Ga0265760_10014516 3300031090 Bacteria 2257
258 Ga0307408_100640756 3300031548 Archaea 949
259 Ga0307405_10315618 3300031731 Bacteria 1192
260 Ga0307413_10348557 3300031824 Bacteria 1142
261 Ga0307409_100626058 3300031995 Bacteria 1067
262 Ga0307416_100539403 3300032002 Unclassified 1238
263 Ga0307416_101377253 3300032002 Archaea 811
264 Ga0307414_10441106 3300032004 Bacteria 1140
265 Ga0373940_0048876 3300035088 Bacteria 1183
266 Ga0373949_0091458 3300035090 Bacteria 823
267 Ga0373960_0157701 3300035121 Bacteria 779
268 Ga0373931_0111780 3300035691 Bacteria 1551
269 Ga0373937_0900930 3300036401 Bacteria 833
270 Ga0395899_0000003 3300037312 Bacteria 1232684
271 Ga0395900_0017238 3300037418 Bacteria 7371
272 Ga0395900_0148941 3300037418 Bacteria 2392
273 Ga0395900_0232650 3300037418 Bacteria 1853
274 Ga0395898_0012591 3300037466 Bacteria 8745
275 Ga0395905_0119143 3300037471 Bacteria 2481
276 Ga0395905_0126633 3300037471 Bacteria 2402
277 Ga0395901_0006617 3300038443 Bacteria 11708
278 Ga0395901_0008781 3300038443 Bacteria 10222
279 Ga0436365_1053770 3300039437 Bacteria 1487
280 Ga0436361_0082970 3300039447 Bacteria 8400
281 Ga0436361_0459777 3300039447 Bacteria 1275
282 Ga0436361_0996666 3300039447 Bacteria 1348
283 Ga0439448_0002625 3300042005 Bacteria 4902
284 Ga0439448_0161428 3300042005 Bacteria 780
285 Ga0439450_012779 3300042008 Bacteria 1673
286 Ga0439455_0008301 3300042012 Bacteria 2221
287 Ga0450907_016025 3300042146 Bacteria 1250
288 Ga0439458_0003423 3300042157 Bacteria 3713
289 Ga0439459_0000611 3300042438 Bacteria 4792
290 Ga0451577_0027758 3300042876 Bacteria 5123
291 Ga0451577_0066438 3300042876 Bacteria 3216
292 Ga0451577_0129368 3300042876 Bacteria 2264
293 Ga0453683_0011277 3300044673 Bacteria 5900
294 Ga0453683_0124559 3300044673 Unclassified 1622
295 Ga0466966_0492980 3300044684 Bacteria 737
296 Ga0453684_0037997 3300044712 Bacteria 6594
297 Ga0453684_0080216 3300044712 Bacteria 4075
298 Ga0451576_0002517 3300045051 Bacteria 27167
299 Ga0451576_0059115 3300045051 Bacteria 4003
300 Ga0451576_0083627 3300045051 Bacteria 3320
301 Ga0466967_0611146 3300045976 Bacteria 1076
302 Ga0495580_0163903 3300046472 Bacteria 1538
303 Ga0495580_0215605 3300046472 Bacteria 1320
304 Ga0495605_0019046 3300046474 Bacteria 3674
305 Ga0495584_0012060 3300046491 Bacteria 4419
306 Ga0495607_0006020 3300046501 Bacteria 8600
307 Ga0495616_0002199 3300046513 Bacteria 13035
308 Ga0495609_0000009 3300046538 Bacteria 354860
309 Ga0495645_0067122 3300046543 Bacteria 2590
310 Ga0495661_0000032 3300046665 Bacteria 170076
311 Ga0495589_0000049 3300046794 Bacteria 116553
312 Ga0495687_000024 3300047443 Bacteria 316676
313 Ga0495677_0000017 3300047445 Bacteria 121483
314 Ga0495626_0000287 3300048091 Bacteria 54612
315 Ga0496106_0181807 3300048909 Bacteria 1669
316 Ga0496106_0548492 3300048909 Bacteria 928
317 Ga0496112_0427986 3300048915 Bacteria 1262
318 Ga0496120_0064587 3300048923 Bacteria 2031
319 Ga0501031_0084349 3300049568 Bacteria 2071
320 Ga0501032_0238048 3300049569 Bacteria 1183
321 Ga0501033_0032024 3300049570 Bacteria 3947
322 Ga0501034_0071817 3300049571 Bacteria 3470
323 Ga0501036_0396948 3300049572 Bacteria 1151
324 Ga0501036_0727431 3300049572 Bacteria 819
325 Ga0501037_0418470 3300049573 Bacteria 917
326 Ga0501038_0077334 3300049574 Bacteria 2809
327 Ga0501039_0278539 3300049575 Bacteria 1315
328 Ga0501040_0066843 3300049576 Unclassified 2477
329 Ga0501041_0073776 3300049577 Bacteria 2097
330 Ga0501041_0267321 3300049577 Bacteria 1076
331 Ga0501043_0374126 3300049579 Bacteria 1079
332 Ga0501046_0494198 3300049580 Bacteria 877
333 Ga0501047_0271232 3300049581 Bacteria 1543
334 Ga0501048_0019221 3300049582 Bacteria 5016
335 Ga0501048_0184336 3300049582 Bacteria 1480
336 Ga0501067_0078572 3300049583 Bacteria 1829
337 Ga0501068_0137269 3300049584 Bacteria 1532
338 Ga0501071_0035930 3300049587 Bacteria 3532
339 Ga0501071_0438587 3300049587 Bacteria 999
340 Ga0501071_0592107 3300049587 Bacteria 852
341 Ga0501071_1122208 3300049587 Bacteria 607
342 Ga0501074_0313056 3300049590 Unclassified 1115
343 Ga0501075_0123981 3300049591 Bacteria 1967
344 Ga0501075_0362150 3300049591 Bacteria 1105
345 Ga0501076_0084805 3300049592 Bacteria 2545
346 Ga0501076_0208863 3300049592 Bacteria 1595
347 Ga0501077_0024894 3300049593 Bacteria 3801
348 Ga0501079_0147183 3300049741 Bacteria 1836
349 Ga0501081_0329134 3300049743 Bacteria 1124
350 Ga0501035_0226335 3300049822 Bacteria 1595
351 Ga0501045_0118270 3300049824 Bacteria 1967
352 Ga0501045_0133854 3300049824 Bacteria 1843
353 nmdc:mga05p37_210560_c1 3300050507 Bacteria 2350
354 nmdc:mga05p37_227100_c1 3300050507 Bacteria 2251
355 nmdc:mga05p37_408086_c1 3300050507 Bacteria 1584
356 nmdc:mga05p37_69016_c1 3300050507 Bacteria 4347
357 nmdc:mga09592_16788_c1 3300050508 Bacteria 5992
358 nmdc:mga09592_33714_c1 3300050508 Bacteria 4277
359 nmdc:mga0qj67_14244_c1 3300050509 Bacteria 6009
360 nmdc:mga0qj67_171125_c1 3300050509 Bacteria 1764
361 nmdc:mga06r32_2269_c1 3300050510 Bacteria 17188
362 nmdc:mga06r32_81750_c1 3300050510 Bacteria 3147
363 nmdc:mga08y16_6386_c1 3300050511 Bacteria 12364
364 nmdc:mga08y16_9870_c1 3300050511 Bacteria 10024
365 nmdc:mga0n895_231367_c1 3300050512 Bacteria 1876
366 nmdc:mga0n895_33687_c1 3300050512 Bacteria 4924
367 nmdc:mga0rr50_104625_c1 3300050513 Bacteria 2230
368 nmdc:mga0rr50_173582_c1 3300050513 Bacteria 1758
369 nmdc:mga0rr50_320532_c1 3300050513 Bacteria 1299
370 nmdc:mga08x19_119847_c1 3300050514 Bacteria 1763
371 nmdc:mga08x19_19218_c2 3300050514 Unclassified 1590
372 nmdc:mga0a205_351654_c1 3300050515 Bacteria 1341
373 nmdc:mga0a205_375938_c1 3300050515 Bacteria 1286
374 nmdc:mga0a205_77017_c1 3300050515 Bacteria 3223
375 nmdc:mga0a205_85554_c1 3300050515 Bacteria 3045
376 Ga0500588_0006744 3300053146 Bacteria 2618
377 Ga0500588_0009650 3300053146 Bacteria 2302
378 Ga0501084_0067748 3300054114 Bacteria 2988
379 Ga0501084_0091799 3300054114 Unclassified 2549
380 Ga0501084_0799877 3300054114 Bacteria 794
381 Ga0501082_0014975 3300060353 Bacteria 6683
382 Ga0530510_0351130 3300061734 Bacteria 1108

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035090 Ga0373949_0091458 Ga0373949_0091458_285_803 172
2 3300046472 Ga0495580_0163903 Ga0495580_0163903_488_1345 172
3 3300049587 Ga0501071_1122208 Ga0501071_1122208_63_590 175
4 3300037471 Ga0395905_0126633 Ga0395905_0126633_1690_2310 176
5 3300031548 Ga0307408_100640756 Ga0307408_1006407562 177
6 3300031731 Ga0307405_10315618 Ga0307405_103156182 177
7 3300031824 Ga0307413_10348557 Ga0307413_103485572 177
8 3300031995 Ga0307409_100626058 Ga0307409_1006260582 177
9 3300032002 Ga0307416_101377253 Ga0307416_1013772532 177
10 3300032004 Ga0307414_10441106 Ga0307414_104411062 177
11 3300037418 Ga0395900_0148941 Ga0395900_0148941_899_1612 177
12 3300037471 Ga0395905_0119143 Ga0395905_0119143_830_1543 177
13 3300025922 Ga0207646_10025739 Ga0207646_100257394 178
14 3300035691 Ga0373931_0111780 Ga0373931_0111780_626_1333 178
15 3300042876 Ga0451577_0027758 Ga0451577_0027758_2464_3192 178
16 3300044673 Ga0453683_0124559 Ga0453683_0124559_225_953 178
17 3300045051 Ga0451576_0059115 Ga0451576_0059115_2154_2861 178
18 3300050507 nmdc:mga05p37_210560_c1 nmdc:mga05p37_210560_c1_376_1092 178
19 3300050514 nmdc:mga08x19_119847_c1 nmdc:mga08x19_119847_c1_964_1680 178
20 3300006847 Ga0075431_100236258 Ga0075431_1002362582 180
21 3300009098 Ga0105245_10061323 Ga0105245_100613233 180
22 3300009147 Ga0114129_10275022 Ga0114129_102750221 180
23 3300025944 Ga0207661_10038791 Ga0207661_100387912 180
24 3300048915 Ga0496112_0427986 Ga0496112_0427986_68_769 180
25 3300005445 Ga0070708_100461838 Ga0070708_1004618381 181
26 3300005467 Ga0070706_100398267 Ga0070706_1003982671 181
27 3300005563 Ga0068855_100765436 Ga0068855_1007654361 181
28 3300025910 Ga0207684_10065369 Ga0207684_100653692 181
29 3300050513 nmdc:mga0rr50_173582_c1 nmdc:mga0rr50_173582_c1_751_1470 181
30 3300005328 Ga0070676_10001014 Ga0070676_1000101412 182
31 3300005334 Ga0068869_100001246 Ga0068869_1000012466 182
32 3300005338 Ga0068868_100075556 Ga0068868_1000755563 182
33 3300005353 Ga0070669_100095473 Ga0070669_1000954732 182
34 3300005364 Ga0070673_100176020 Ga0070673_1001760202 182
35 3300005440 Ga0070705_100319906 Ga0070705_1003199062 182
36 3300005444 Ga0070694_100008014 Ga0070694_1000080141 182
37 3300005444 Ga0070694_100017544 Ga0070694_1000175443 182
38 3300005458 Ga0070681_10337954 Ga0070681_103379541 182
39 3300005545 Ga0070695_100001011 Ga0070695_1000010114 182
40 3300005545 Ga0070695_100045295 Ga0070695_1000452953 182
41 3300005546 Ga0070696_100000978 Ga0070696_10000097818 182
42 3300005547 Ga0070693_100000254 Ga0070693_10000025418 182
43 3300005547 Ga0070693_100184295 Ga0070693_1001842952 182
44 3300005549 Ga0070704_100022922 Ga0070704_1000229222 182
45 3300005841 Ga0068863_100026154 Ga0068863_1000261541 182
46 3300005844 Ga0068862_100124945 Ga0068862_1001249452 182
47 3300006871 Ga0075434_100274135 Ga0075434_1002741352 182
48 3300009148 Ga0105243_10031842 Ga0105243_100318422 182
49 3300009174 Ga0105241_10009734 Ga0105241_100097348 182
50 3300009553 Ga0105249_10030664 Ga0105249_100306642 182
51 3300013306 Ga0163162_10606289 Ga0163162_106062892 182
52 3300025901 Ga0207688_10008862 Ga0207688_100088625 182
53 3300025907 Ga0207645_10000584 Ga0207645_1000058416 182
54 3300025907 Ga0207645_10067189 Ga0207645_100671892 182
55 3300025912 Ga0207707_10290816 Ga0207707_102908163 182
56 3300025921 Ga0207652_10007073 Ga0207652_100070732 182
57 3300025923 Ga0207681_10272968 Ga0207681_102729682 182
58 3300025942 Ga0207689_10006150 Ga0207689_100061509 182
59 3300025961 Ga0207712_10055668 Ga0207712_100556682 182
60 3300026088 Ga0207641_10011793 Ga0207641_100117932 182
61 3300028380 Ga0268265_10040806 Ga0268265_100408064 182
62 3300035088 Ga0373940_0048876 Ga0373940_0048876_121_822 182
63 3300035121 Ga0373960_0157701 Ga0373960_0157701_26_727 182
64 3300050512 nmdc:mga0n895_33687_c1 nmdc:mga0n895_33687_c1_3886_4587 182
65 3300050515 nmdc:mga0a205_77017_c1 nmdc:mga0a205_77017_c1_1763_2464 182
66 3300007076 Ga0075435_100351299 Ga0075435_1003512992 183
67 3300050513 nmdc:mga0rr50_320532_c1 nmdc:mga0rr50_320532_c1_301_1026 183
68 3300005434 Ga0070709_10646997 Ga0070709_106469971 184
69 3300005618 Ga0068864_100859735 Ga0068864_1008597351 185
70 3300006058 Ga0075432_10072493 Ga0075432_100724931 185
71 3300009094 Ga0111539_10009287 Ga0111539_1000928716 185
72 3300009147 Ga0114129_10960644 Ga0114129_109606441 185
73 3300026095 Ga0207676_10773831 Ga0207676_107738311 185
74 3300027907 Ga0207428_10000628 Ga0207428_1000062830 185
75 3300050507 nmdc:mga05p37_227100_c1 nmdc:mga05p37_227100_c1_1456_2187 185
76 3300050511 nmdc:mga08y16_6386_c1 nmdc:mga08y16_6386_c1_758_1489 185
77 3300005445 Ga0070708_100089392 Ga0070708_1000893924 187
78 3300005445 Ga0070708_100250852 Ga0070708_1002508522 187
79 3300005468 Ga0070707_100043560 Ga0070707_1000435603 187
80 3300005518 Ga0070699_100035837 Ga0070699_1000358375 187
81 3300005518 Ga0070699_100305534 Ga0070699_1003055342 187
82 3300005536 Ga0070697_100200136 Ga0070697_1002001363 187
83 3300025910 Ga0207684_10060077 Ga0207684_100600776 187
84 3300025922 Ga0207646_10045173 Ga0207646_100451732 187
85 3300049582 Ga0501048_0184336 Ga0501048_0184336_260_976 187
86 3300005366 Ga0070659_100024100 Ga0070659_1000241002 188
87 3300010375 Ga0105239_10313707 Ga0105239_103137071 188
88 3300042008 Ga0439450_012779 Ga0439450_012779_249_944 188
89 3300005293 Ga0065715_10003875 Ga0065715_100038754 189
90 3300005331 Ga0070670_100009322 Ga0070670_1000093222 189
91 3300005334 Ga0068869_100052631 Ga0068869_1000526312 189
92 3300005336 Ga0070680_100009452 Ga0070680_1000094523 189
93 3300005339 Ga0070660_100000205 Ga0070660_10000020519 189
94 3300005344 Ga0070661_100000447 Ga0070661_10000044714 189
95 3300005345 Ga0070692_10000692 Ga0070692_100006929 189
96 3300005366 Ga0070659_100000317 Ga0070659_1000003178 189
97 3300005444 Ga0070694_100000789 Ga0070694_10000078918 189
98 3300005457 Ga0070662_100011296 Ga0070662_1000112963 189
99 3300005458 Ga0070681_10006327 Ga0070681_100063278 189
100 3300005459 Ga0068867_100000839 Ga0068867_1000008398 189
101 3300005530 Ga0070679_100000646 Ga0070679_1000006463 189
102 3300005535 Ga0070684_100277571 Ga0070684_1002775711 189
103 3300005539 Ga0068853_100036165 Ga0068853_1000361653 189
104 3300005543 Ga0070672_100212912 Ga0070672_1002129122 189
105 3300005546 Ga0070696_100037591 Ga0070696_1000375912 189
106 3300005546 Ga0070696_100055828 Ga0070696_1000558283 189
107 3300005563 Ga0068855_100043224 Ga0068855_1000432242 189
108 3300005564 Ga0070664_100011899 Ga0070664_1000118994 189
109 3300005577 Ga0068857_100098437 Ga0068857_1000984372 189
110 3300005614 Ga0068856_100030823 Ga0068856_1000308232 189
111 3300005616 Ga0068852_100441399 Ga0068852_1004413992 189
112 3300005617 Ga0068859_100000673 Ga0068859_10000067329 189
113 3300005719 Ga0068861_100003194 Ga0068861_1000031948 189
114 3300006931 Ga0097620_100000673 Ga0097620_1000006733 189
115 3300013100 Ga0157373_10001228 Ga0157373_1000122817 189
116 3300013307 Ga0157372_10001508 Ga0157372_1000150819 189
117 3300014745 Ga0157377_10420383 Ga0157377_104203831 189
118 3300025885 Ga0207653_10010692 Ga0207653_100106921 189
119 3300025908 Ga0207643_10099531 Ga0207643_100995312 189
120 3300025911 Ga0207654_10004291 Ga0207654_100042912 189
121 3300025912 Ga0207707_10000251 Ga0207707_1000025145 189
122 3300025917 Ga0207660_10000250 Ga0207660_1000025012 189
123 3300025919 Ga0207657_10000802 Ga0207657_100008022 189
124 3300025920 Ga0207649_10022251 Ga0207649_100222512 189
125 3300025921 Ga0207652_10000359 Ga0207652_100003593 189
126 3300025923 Ga0207681_10127583 Ga0207681_101275832 189
127 3300025925 Ga0207650_10023155 Ga0207650_100231552 189
128 3300025932 Ga0207690_10000701 Ga0207690_1000070119 189
129 3300025933 Ga0207706_10038007 Ga0207706_100380072 189
130 3300025936 Ga0207670_10017215 Ga0207670_100172154 189
131 3300025940 Ga0207691_10012327 Ga0207691_100123272 189
132 3300025942 Ga0207689_10002375 Ga0207689_100023753 189
133 3300025945 Ga0207679_10007020 Ga0207679_100070208 189
134 3300025949 Ga0207667_10009758 Ga0207667_100097588 189
135 3300025960 Ga0207651_10133796 Ga0207651_101337961 189
136 3300025981 Ga0207640_10001304 Ga0207640_1000130410 189
137 3300026041 Ga0207639_10003624 Ga0207639_100036242 189
138 3300026067 Ga0207678_10000988 Ga0207678_1000098812 189
139 3300026078 Ga0207702_10005888 Ga0207702_100058889 189
140 3300026089 Ga0207648_10001427 Ga0207648_1000142721 189
141 3300026116 Ga0207674_10002580 Ga0207674_1000258018 189
142 3300026118 Ga0207675_100005158 Ga0207675_1000051583 189
143 3300028380 Ga0268265_10020874 Ga0268265_100208742 189
144 3300028381 Ga0268264_10093820 Ga0268264_100938201 189
145 3300042005 Ga0439448_0002625 Ga0439448_0002625_1138_1857 189
146 3300042012 Ga0439455_0008301 Ga0439455_0008301_774_1493 189
147 3300042157 Ga0439458_0003423 Ga0439458_0003423_890_1609 189
148 3300042438 Ga0439459_0000611 Ga0439459_0000611_2249_2968 189
149 3300042876 Ga0451577_0129368 Ga0451577_0129368_326_1045 189
150 3300048909 Ga0496106_0181807 Ga0496106_0181807_765_1484 189
151 3300048923 Ga0496120_0064587 Ga0496120_0064587_1269_1901 189
152 3300009094 Ga0111539_10042850 Ga0111539_100428503 190
153 3300025910 Ga0207684_10515018 Ga0207684_105150181 190
154 3300027907 Ga0207428_10004424 Ga0207428_100044242 190
155 3300038443 Ga0395901_0006617 Ga0395901_0006617_9519_10319 190
156 3300046474 Ga0495605_0019046 Ga0495605_0019046_1682_2377 190
157 3300046491 Ga0495584_0012060 Ga0495584_0012060_52_747 190
158 3300046501 Ga0495607_0006020 Ga0495607_0006020_38_733 190
159 3300046513 Ga0495616_0002199 Ga0495616_0002199_9704_10399 190
160 3300046538 Ga0495609_0000009 Ga0495609_0000009_24122_24817 190
161 3300046665 Ga0495661_0000032 Ga0495661_0000032_129579_130274 190
162 3300046794 Ga0495589_0000049 Ga0495589_0000049_21768_22463 190
163 3300047443 Ga0495687_000024 Ga0495687_000024_111173_111868 190
164 3300047445 Ga0495677_0000017 Ga0495677_0000017_9623_10318 190
165 3300048091 Ga0495626_0000287 Ga0495626_0000287_7375_8070 190
166 3300050511 nmdc:mga08y16_9870_c1 nmdc:mga08y16_9870_c1_1044_1772 190
167 3300005440 Ga0070705_100091481 Ga0070705_1000914814 191
168 3300005445 Ga0070708_100027070 Ga0070708_1000270701 191
169 3300005468 Ga0070707_100034310 Ga0070707_1000343104 191
170 3300005536 Ga0070697_100416092 Ga0070697_1004160922 191
171 3300005544 Ga0070686_100578354 Ga0070686_1005783541 191
172 3300009098 Ga0105245_10909841 Ga0105245_109098412 191
173 3300013297 Ga0157378_10180934 Ga0157378_101809342 191
174 3300025922 Ga0207646_10016766 Ga0207646_100167663 191
175 3300036401 Ga0373937_0900930 Ga0373937_0900930_102_740 191
176 3300005343 Ga0070687_100100235 Ga0070687_1001002352 192
177 3300005445 Ga0070708_100795097 Ga0070708_1007950971 192
178 3300005843 Ga0068860_100294720 Ga0068860_1002947202 192
179 3300026095 Ga0207676_10291204 Ga0207676_102912042 192
180 3300026118 Ga0207675_100940849 Ga0207675_1009408492 192
181 3300009545 Ga0105237_10563506 Ga0105237_105635061 193
182 3300049569 Ga0501032_0238048 Ga0501032_0238048_400_1017 193
183 3300049570 Ga0501033_0032024 Ga0501033_0032024_2677_3294 193
184 3300049571 Ga0501034_0071817 Ga0501034_0071817_1006_1623 193
185 3300049573 Ga0501037_0418470 Ga0501037_0418470_90_707 193
186 3300049574 Ga0501038_0077334 Ga0501038_0077334_760_1377 193
187 3300049575 Ga0501039_0278539 Ga0501039_0278539_420_1037 193
188 3300049579 Ga0501043_0374126 Ga0501043_0374126_399_1016 193
189 3300049581 Ga0501047_0271232 Ga0501047_0271232_514_1131 193
190 3300006914 Ga0075436_100038648 Ga0075436_1000386481 194
191 3300009174 Ga0105241_10032206 Ga0105241_100322063 194
192 3300025911 Ga0207654_10744903 Ga0207654_107449031 194
193 3300048909 Ga0496106_0548492 Ga0496106_0548492_69_713 194
194 3300050514 nmdc:mga08x19_19218_c2 nmdc:mga08x19_19218_c2_329_979 194
195 3300006846 Ga0075430_100201540 Ga0075430_1002015402 195
196 3300006847 Ga0075431_100033984 Ga0075431_1000339845 195
197 3300006880 Ga0075429_100387054 Ga0075429_1003870542 195
198 3300050508 nmdc:mga09592_33714_c1 nmdc:mga09592_33714_c1_2084_2815 195
199 3300050509 nmdc:mga0qj67_171125_c1 nmdc:mga0qj67_171125_c1_917_1648 195
200 3300050510 nmdc:mga06r32_81750_c1 nmdc:mga06r32_81750_c1_1338_2069 195
201 3300013102 Ga0157371_10628404 Ga0157371_106284041 197
202 3300049568 Ga0501031_0084349 Ga0501031_0084349_561_1247 197
203 3300044684 Ga0466966_0492980 Ga0466966_0492980_38_712 198
204 3300049590 Ga0501074_0313056 Ga0501074_0313056_139_765 198
205 3300021361 Ga0213872_10079559 Ga0213872_100795591 200
206 3300005339 Ga0070660_100628618 Ga0070660_1006286181 201
207 3300005564 Ga0070664_100446755 Ga0070664_1004467552 201
208 3300009093 Ga0105240_10054689 Ga0105240_100546894 201
209 3300025924 Ga0207694_10145763 Ga0207694_101457632 201
210 3300026142 Ga0207698_10245054 Ga0207698_102450542 201
211 3300039447 Ga0436361_0082970 Ga0436361_0082970_6227_6862 201
212 3300039447 Ga0436361_0459777 Ga0436361_0459777_328_963 201
213 3300053146 Ga0500588_0006744 Ga0500588_0006744_1508_2143 201
214 3300053146 Ga0500588_0009650 Ga0500588_0009650_1104_1739 201
215 3300042146 Ga0450907_016025 Ga0450907_016025_563_1171 202
216 3300046543 Ga0495645_0067122 Ga0495645_0067122_408_1058 202
217 3300005330 Ga0070690_100064381 Ga0070690_1000643812 203
218 3300005336 Ga0070680_100067759 Ga0070680_1000677592 203
219 3300005366 Ga0070659_100261854 Ga0070659_1002618541 203
220 3300005457 Ga0070662_100070072 Ga0070662_1000700722 203
221 3300005458 Ga0070681_10018938 Ga0070681_100189382 203
222 3300005458 Ga0070681_10096369 Ga0070681_100963692 203
223 3300005458 Ga0070681_10356511 Ga0070681_103565112 203
224 3300005459 Ga0068867_100300936 Ga0068867_1003009361 203
225 3300005530 Ga0070679_100037049 Ga0070679_1000370494 203
226 3300005530 Ga0070679_100253737 Ga0070679_1002537372 203
227 3300005535 Ga0070684_100011549 Ga0070684_1000115494 203
228 3300005535 Ga0070684_100403419 Ga0070684_1004034191 203
229 3300005539 Ga0068853_100225426 Ga0068853_1002254262 203
230 3300005545 Ga0070695_100078740 Ga0070695_1000787402 203
231 3300005563 Ga0068855_100012039 Ga0068855_1000120395 203
232 3300005563 Ga0068855_100212724 Ga0068855_1002127241 203
233 3300005577 Ga0068857_100192901 Ga0068857_1001929013 203
234 3300005614 Ga0068856_101263021 Ga0068856_1012630211 203
235 3300005616 Ga0068852_100887810 Ga0068852_1008878101 203
236 3300005842 Ga0068858_100386208 Ga0068858_1003862081 203
237 3300006358 Ga0068871_100356938 Ga0068871_1003569382 203
238 3300009093 Ga0105240_10001370 Ga0105240_1000137040 203
239 3300009093 Ga0105240_10054246 Ga0105240_100542463 203
240 3300009098 Ga0105245_10079289 Ga0105245_100792891 203
241 3300009174 Ga0105241_10023491 Ga0105241_100234915 203
242 3300009174 Ga0105241_10595584 Ga0105241_105955841 203
243 3300009176 Ga0105242_10004396 Ga0105242_100043966 203
244 3300009176 Ga0105242_10005181 Ga0105242_100051815 203
245 3300009177 Ga0105248_10024439 Ga0105248_100244395 203
246 3300009551 Ga0105238_10055283 Ga0105238_100552832 203
247 3300009551 Ga0105238_10273844 Ga0105238_102738442 203
248 3300009551 Ga0105238_10355208 Ga0105238_103552082 203
249 3300010375 Ga0105239_10423438 Ga0105239_104234382 203
250 3300013104 Ga0157370_10456645 Ga0157370_104566452 203
251 3300013105 Ga0157369_10186202 Ga0157369_101862023 203
252 3300013105 Ga0157369_10959432 Ga0157369_109594321 203
253 3300013307 Ga0157372_10018833 Ga0157372_100188332 203
254 3300013307 Ga0157372_10650754 Ga0157372_106507542 203
255 3300013307 Ga0157372_10827750 Ga0157372_108277502 203
256 3300013308 Ga0157375_10436047 Ga0157375_104360472 203
257 3300014325 Ga0163163_10193545 Ga0163163_101935452 203
258 3300025911 Ga0207654_10015860 Ga0207654_100158604 203
259 3300025912 Ga0207707_10067280 Ga0207707_100672802 203
260 3300025912 Ga0207707_10210016 Ga0207707_102100162 203
261 3300025912 Ga0207707_10255711 Ga0207707_102557112 203
262 3300025913 Ga0207695_10045267 Ga0207695_100452672 203
263 3300025913 Ga0207695_10066129 Ga0207695_100661294 203
264 3300025913 Ga0207695_10539521 Ga0207695_105395211 203
265 3300025914 Ga0207671_10600080 Ga0207671_106000801 203
266 3300025921 Ga0207652_10245052 Ga0207652_102450522 203
267 3300025921 Ga0207652_10702700 Ga0207652_107027001 203
268 3300025924 Ga0207694_10080934 Ga0207694_100809342 203
269 3300025924 Ga0207694_10116206 Ga0207694_101162062 203
270 3300025927 Ga0207687_10070668 Ga0207687_100706681 203
271 3300025933 Ga0207706_10009146 Ga0207706_100091462 203
272 3300025934 Ga0207686_10036231 Ga0207686_100362312 203
273 3300025934 Ga0207686_10058321 Ga0207686_100583214 203
274 3300025941 Ga0207711_10105668 Ga0207711_101056682 203
275 3300025944 Ga0207661_10098001 Ga0207661_100980012 203
276 3300025949 Ga0207667_10262978 Ga0207667_102629781 203
277 3300026035 Ga0207703_10413167 Ga0207703_104131672 203
278 3300026078 Ga0207702_11002551 Ga0207702_110025511 203
279 3300026089 Ga0207648_10041278 Ga0207648_100412782 203
280 3300026095 Ga0207676_10175784 Ga0207676_101757841 203
281 3300026116 Ga0207674_10215818 Ga0207674_102158182 203
282 3300039447 Ga0436361_0996666 Ga0436361_0996666_496_1185 203
283 3300042876 Ga0451577_0066438 Ga0451577_0066438_2335_2961 203
284 3300044673 Ga0453683_0011277 Ga0453683_0011277_1573_2199 203
285 3300044712 Ga0453684_0037997 Ga0453684_0037997_5206_5832 203
286 3300044712 Ga0453684_0080216 Ga0453684_0080216_2654_3280 203
287 3300045051 Ga0451576_0002517 Ga0451576_0002517_25805_26431 203
288 3300045051 Ga0451576_0083627 Ga0451576_0083627_26_652 203
289 3300005435 Ga0070714_100211929 Ga0070714_1002119292 204
290 3300006175 Ga0070712_100115762 Ga0070712_1001157621 204
291 3300006871 Ga0075434_100420860 Ga0075434_1004208602 204
292 3300007076 Ga0075435_100051586 Ga0075435_1000515863 204
293 3300009147 Ga0114129_10182825 Ga0114129_101828254 204
294 3300024227 Ga0228598_1008187 Ga0228598_10081871 204
295 3300025898 Ga0207692_10153292 Ga0207692_101532921 204
296 3300025915 Ga0207693_10159670 Ga0207693_101596702 204
297 3300025929 Ga0207664_10689364 Ga0207664_106893641 204
298 3300031090 Ga0265760_10014516 Ga0265760_100145162 204
299 3300046472 Ga0495580_0215605 Ga0495580_0215605_223_864 204
300 3300049572 Ga0501036_0396948 Ga0501036_0396948_70_750 204
301 3300050512 nmdc:mga0n895_231367_c1 nmdc:mga0n895_231367_c1_997_1728 204
302 3300050513 nmdc:mga0rr50_104625_c1 nmdc:mga0rr50_104625_c1_858_1589 204
303 3300050515 nmdc:mga0a205_85554_c1 nmdc:mga0a205_85554_c1_1452_2183 204
304 3300006173 Ga0070716_100818217 Ga0070716_1008182171 205
305 3300037312 Ga0395899_0000003 Ga0395899_0000003_779837_780454 205
306 3300021384 Ga0213876_10265416 Ga0213876_102654161 206
307 3300039437 Ga0436365_1053770 Ga0436365_1053770_589_1248 206
308 3300049576 Ga0501040_0066843 Ga0501040_0066843_79_705 206
309 3300049577 Ga0501041_0267321 Ga0501041_0267321_98_724 206
310 3300049580 Ga0501046_0494198 Ga0501046_0494198_197_823 206
311 3300049587 Ga0501071_0035930 Ga0501071_0035930_2704_3330 206
312 3300049591 Ga0501075_0123981 Ga0501075_0123981_448_1074 206
313 3300049593 Ga0501077_0024894 Ga0501077_0024894_172_798 206
314 3300049824 Ga0501045_0133854 Ga0501045_0133854_473_1099 206
315 3300054114 Ga0501084_0091799 Ga0501084_0091799_13_639 206
316 3300060353 Ga0501082_0014975 Ga0501082_0014975_5921_6547 206
317 3300049824 Ga0501045_0118270 Ga0501045_0118270_206_910 207
318 3300054114 Ga0501084_0067748 Ga0501084_0067748_54_758 207
319 3300049582 Ga0501048_0019221 Ga0501048_0019221_1158_1811 208
320 3300005614 Ga0068856_100552759 Ga0068856_1005527592 209
321 3300025254 Ga0209148_1001290 Ga0209148_100129010 209
322 3300037418 Ga0395900_0232650 Ga0395900_0232650_254_916 209
323 3300045976 Ga0466967_0611146 Ga0466967_0611146_227_856 209
324 3300025912 Ga0207707_10171311 Ga0207707_101713112 210
325 3300049577 Ga0501041_0073776 Ga0501041_0073776_56_688 210
326 3300049584 Ga0501068_0137269 Ga0501068_0137269_769_1401 210
327 3300049587 Ga0501071_0438587 Ga0501071_0438587_113_745 210
328 3300049591 Ga0501075_0362150 Ga0501075_0362150_35_667 210
329 3300049592 Ga0501076_0084805 Ga0501076_0084805_399_1031 210
330 3300049592 Ga0501076_0208863 Ga0501076_0208863_103_735 210
331 3300061734 Ga0530510_0351130 Ga0530510_0351130_449_1081 210
332 3300005435 Ga0070714_100529516 Ga0070714_1005295161 211
333 3300049741 Ga0501079_0147183 Ga0501079_0147183_311_949 211
334 3300049743 Ga0501081_0329134 Ga0501081_0329134_129_767 211
335 3300050507 nmdc:mga05p37_408086_c1 nmdc:mga05p37_408086_c1_288_1013 211
336 3300054114 Ga0501084_0799877 Ga0501084_0799877_39_677 211
337 3300010375 Ga0105239_10461946 Ga0105239_104619462 212
338 3300005468 Ga0070707_100046503 Ga0070707_1000465032 213
339 3300005471 Ga0070698_100127717 Ga0070698_1001277173 213
340 3300005518 Ga0070699_100085742 Ga0070699_1000857422 213
341 3300006173 Ga0070716_100054408 Ga0070716_1000544082 213
342 3300006852 Ga0075433_10342690 Ga0075433_103426902 213
343 3300006852 Ga0075433_10445903 Ga0075433_104459032 213
344 3300009147 Ga0114129_10124926 Ga0114129_101249265 213
345 3300009147 Ga0114129_10973398 Ga0114129_109733982 213
346 3300025922 Ga0207646_10040230 Ga0207646_100402305 213
347 3300032002 Ga0307416_100539403 Ga0307416_1005394032 213
348 3300049572 Ga0501036_0727431 Ga0501036_0727431_123_785 213
349 3300049583 Ga0501067_0078572 Ga0501067_0078572_396_1124 213
350 3300049587 Ga0501071_0592107 Ga0501071_0592107_113_775 213
351 3300050507 nmdc:mga05p37_69016_c1 nmdc:mga05p37_69016_c1_501_1229 213
352 3300050515 nmdc:mga0a205_351654_c1 nmdc:mga0a205_351654_c1_107_796 213
353 3300050515 nmdc:mga0a205_375938_c1 nmdc:mga0a205_375938_c1_341_1072 213
354 3300005329 Ga0070683_100761436 Ga0070683_1007614361 214
355 3300005434 Ga0070709_10056796 Ga0070709_100567961 214
356 3300005435 Ga0070714_100182786 Ga0070714_1001827862 214
357 3300005436 Ga0070713_100532007 Ga0070713_1005320071 214
358 3300005535 Ga0070684_100267400 Ga0070684_1002674002 214
359 3300005563 Ga0068855_100568641 Ga0068855_1005686411 214
360 3300005564 Ga0070664_100633752 Ga0070664_1006337522 214
361 3300005616 Ga0068852_100689707 Ga0068852_1006897072 214
362 3300009545 Ga0105237_10285593 Ga0105237_102855932 214
363 3300009551 Ga0105238_10399404 Ga0105238_103994042 214
364 3300013307 Ga0157372_10754720 Ga0157372_107547202 214
365 3300025915 Ga0207693_10312652 Ga0207693_103126521 214
366 3300037418 Ga0395900_0017238 Ga0395900_0017238_5495_6163 214
367 3300037466 Ga0395898_0012591 Ga0395898_0012591_1877_2545 214
368 3300038443 Ga0395901_0008781 Ga0395901_0008781_1396_2064 214
369 3300042005 Ga0439448_0161428 Ga0439448_0161428_61_729 214
370 3300049822 Ga0501035_0226335 Ga0501035_0226335_653_1324 214
371 3300013307 Ga0157372_10510788 Ga0157372_105107881 215
372 3300005439 Ga0070711_100176180 Ga0070711_1001761801 216
373 3300005530 Ga0070679_100752149 Ga0070679_1007521491 216
374 3300010375 Ga0105239_10505675 Ga0105239_105056752 216
375 3300003322 rootL2_10089571 rootL2_100895711 224
376 3300006846 Ga0075430_100021961 Ga0075430_1000219616 224
377 3300006847 Ga0075431_100000350 Ga0075431_10000035028 224
378 3300006880 Ga0075429_100002202 Ga0075429_1000022027 224
379 3300025901 Ga0207688_10287816 Ga0207688_102878162 224
380 3300050508 nmdc:mga09592_16788_c1 nmdc:mga09592_16788_c1_1600_2274 224
381 3300050509 nmdc:mga0qj67_14244_c1 nmdc:mga0qj67_14244_c1_3915_4589 224
382 3300050510 nmdc:mga06r32_2269_c1 nmdc:mga06r32_2269_c1_12038_12712 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03458

Gly_transporter

Glycine transporter

30

106

0.96

PF03458

Gly_transporter

Glycine transporter

119

194

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h36-assembly1.cif.gz_E crystal structures of the tric trimeric intracellular cation channel orthologue from rhodobacter sphaeroides 0.957 3 195
5h36-assembly1.cif.gz_E crystal structures of the tric trimeric intracellular cation channel orthologue from rhodobacter sphaeroides 0.9475 3 195
5wuf-assembly1.cif.gz_A structural basis for conductance through tric cation channels 0.9445 6 198
5wuf-assembly1.cif.gz_A structural basis for conductance through tric cation channels 0.9305 6 198
5wtr-assembly2.cif.gz_F crystal structure of a prokaryotic tric channel in 0.5 m kcl 0.9243 1 197
ID Description Score Start End Superfamily
af_P0AFP0_91_166_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.9697 93 166 1.10.10.1740
af_P0AFP0_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.9527 8 81 1.10.10.1740
af_P0AFP0_91_166_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.9331 93 166 1.10.10.1740
af_P0AFP0_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.906 8 81 1.10.10.1740
af_P0AGM2_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8854 7 81 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A535GVG5-F1-model_v4 Trimeric intracellular cation channel family protein 0.9852 1 203 GO:0005886
AF-A0A7X7PYY9-F1-model_v4 Trimeric intracellular cation channel family protein 0.985 90 200 GO:0005886
AF-A0A3A8K3R2-F1-model_v4 Trimeric intracellular cation channel family protein 0.9803 2 198 GO:0005886
AF-A0A2V8C1N6-F1-model_v4 Glycine transporter domain-containing protein 0.9776 2 136 GO:0005886
AF-A0A1K1QCW4-F1-model_v4 Uncharacterized membrane protein YeiH 0.9769 2 199 GO:0005886

Feature Viewer

pLDDT pTM Quality
86.83 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map