F429265

General Info

Members Datasets Scaffolds Average Seq Length
382 237 764 270

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10003826|Ga0157370_100038266
Length 315
Sequence VERHAGPPRRDSGSRLGAGAGRSLIDLISLSSSFSTHKDNSTMTTNNANTIPAFGLGTFRLQGQVVIDSVKNGLDVGYRVIDTAQIYGNEAEVGQAIAESGVARNDLFITTKIWTDNYAKAKLVPSLKDSLAKLRTDYVDLTLIHWPSPGNTVSVAEFMGALAEAKALGLTKRIGVSNFNIALMKEAIAAVGAENIATNQVELHPYLQNRKVAEFAKSQGIHITSYMTLAYGKVIADPVIEAIAKAHNATTAQVTLAWAMQLGYAVIPSSTKRANLEGNLKAQQLKLTDAEMAQIAALDRNERLTDPAGLSPAWD

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
93 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
94 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
95 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
96 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
108 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
138 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
144 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
145 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
149 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
165 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
168 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
175 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
176 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
177 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
178 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
179 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
180 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
181 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
182 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
183 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
184 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
187 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
188 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
189 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
192 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
193 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
194 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
195 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
196 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
197 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
198 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
199 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
200 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
201 2643221556 Massilia sp. Root1485 Isolate Unclassified
202 2643221593 Lysobacter sp. Root690 Isolate Unclassified
203 2643221658 Variovorax sp. Root411 Isolate Unclassified
204 2643221672 Variovorax sp. Root434 Isolate Unclassified
205 2643221683 Variovorax sp. Root473 Isolate Unclassified
206 2643221684 Massilia sp. Root133 Isolate Unclassified
207 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
208 2738541297 Duganella sp. GV083 Isolate Unclassified
209 2738541307 Variovorax sp. GV008 Isolate Unclassified
210 2738541357 Duganella sp. GV053 Isolate Unclassified
211 2738543003 Duganella sp. GV066 Isolate Unclassified
212 2738543012 Acidovorax sp. CF301 Isolate Unclassified
213 2738543026 Duganella sp. GV089 Isolate Unclassified
214 2738543029 Duganella sp. GV039 Isolate Unclassified
215 2818991441 Niallia circulans 3243 Isolate Rhizosphere
216 2818991446 Variovorax sp. 1180 Isolate Unclassified
217 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
218 2842677519 Variovorax sp. R-72495 Isolate Unclassified
219 2857564685 Duganella sp. R-74599 Isolate Unclassified
220 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
221 2885198086 Variovorax sp. 679 Isolate Unclassified
222 2885211737 Variovorax sp. 553 Isolate Unclassified
223 2899924645 Variovorax sp. 369 Isolate Unclassified
224 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
225 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
226 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
227 2928037797 Variovorax sp. 1126 Isolate Unclassified
228 2928044640 Variovorax sp. 1128 Isolate Unclassified
229 2928051484 Variovorax sp. 1133 Isolate Unclassified
230 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
231 2928070936 Variovorax gossypii 1167 Isolate Unclassified
232 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
233 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
234 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
235 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
236 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
237 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.7
Metatranscriptomes 0
Isolates 12.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.94
Nodule 0.26
Rhizoplane 2.36
Rhizosphere 48.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10003826 3300013104 Bacteria 17548
2 JGI24740J21852_10011997 3300001979 Bacteria 3279
3 JGI24739J22299_10079591 3300001989 Bacteria 1008
4 JGI25152J39213_1006909 3300002773 Bacteria 3001
5 JGI25152J39213_1010078 3300002773 Bacteria 2188
6 JGI25150J39212_1001279 3300002774 Bacteria 7194
7 JGI25150J39212_1001363 3300002774 Bacteria 6934
8 JGI25159J45721_1001762 3300002987 Bacteria 8702
9 JGI25151J46595_10000324 3300003187 Bacteria 51796
10 JGI25151J46595_10001164 3300003187 Bacteria 18973
11 JGI25151J46595_10035670 3300003187 Bacteria 1886
12 JGI25153J46596_10029434 3300003215 Bacteria 1886
13 JGI25160J50197_1002414 3300003354 Bacteria 8713
14 JGI25161J50226_1001167 3300003374 Bacteria 8713
15 JGI25161J50226_1001715 3300003374 Bacteria 6234
16 Ga0055535_1000108 3300003761 Bacteria 89707
17 Ga0055542_1000051 3300003762 Bacteria 175242
18 Ga0055526_1000052 3300003771 Bacteria 116035
19 Ga0055526_1004231 3300003771 Bacteria 8713
20 Ga0055526_1004926 3300003771 Bacteria 7849
21 Ga0055537_1001568 3300003773 Bacteria 8713
22 Ga0055537_1015488 3300003773 Bacteria 1333
23 Ga0055537_1015607 3300003773 Bacteria 1324
24 Ga0055524_1002826 3300003775 Bacteria 8713
25 Ga0055524_1018080 3300003775 Bacteria 2461
26 Ga0055536_1004226 3300003781 Bacteria 7416
27 Ga0055536_1004235 3300003781 Bacteria 7405
28 Ga0055536_1008124 3300003781 Bacteria 4572
29 Ga0055534_1002084 3300003784 Bacteria 7208
30 Ga0055534_1003214 3300003784 Bacteria 5251
31 Ga0055534_1016513 3300003784 Bacteria 1324
32 Ga0055528_1003003 3300003790 Bacteria 8713
33 Ga0055528_1032434 3300003790 Bacteria 1333
34 Ga0055528_1032621 3300003790 Bacteria 1324
35 Ga0055530_10016430 3300003791 Bacteria 2364
36 Ga0055530_10058226 3300003791 Bacteria 870
37 Ga0055540_1002243 3300003792 Bacteria 10445
38 Ga0055540_1003134 3300003792 Bacteria 8189
39 Ga0055531_10000506 3300003794 Bacteria 35446
40 Ga0055531_10024330 3300003794 Bacteria 2238
41 Ga0055543_1001589 3300004625 Bacteria 8751
42 Ga0065165_1004420 3300005262 Bacteria 8751
43 Ga0065165_1036022 3300005262 Bacteria 1513
44 Ga0065165_1042691 3300005262 Bacteria 1336
45 Ga0065714_10077000 3300005288 Bacteria 2732
46 Ga0070666_10184780 3300005335 Bacteria 1463
47 Ga0070680_100093306 3300005336 Bacteria 2494
48 Ga0070660_100043420 3300005339 Bacteria 3436
49 Ga0070660_100330811 3300005339 Bacteria 1253
50 Ga0070667_100062302 3300005367 Bacteria 3159
51 Ga0070678_100410753 3300005456 Bacteria 1178
52 Ga0070662_100017603 3300005457 Bacteria 4821
53 Ga0068853_100056550 3300005539 Bacteria 3384
54 Ga0068855_100219029 3300005563 Bacteria 2135
55 Ga0070664_100007670 3300005564 Bacteria 8714
56 Ga0068857_100334238 3300005577 Bacteria 1401
57 Ga0068860_100244400 3300005843 Bacteria 1746
58 Ga0075364_10118251 3300006051 Bacteria 1773
59 Ga0075364_10263531 3300006051 Bacteria 1172
60 Ga0075370_10001484 3300006353 Bacteria 10221
61 Ga0105251_10003726 3300009011 Bacteria 10912
62 Ga0105244_10005378 3300009036 Bacteria 8524
63 Ga0105244_10027904 3300009036 Bacteria 3036
64 Ga0105244_10148511 3300009036 Bacteria 1124
65 Ga0105243_10036676 3300009148 Bacteria 3807
66 Ga0105243_10180298 3300009148 Bacteria 1836
67 Ga0105242_10173078 3300009176 Bacteria 1899
68 Ga0105237_10632694 3300009545 Bacteria 1077
69 Ga0105238_10019143 3300009551 Bacteria 6976
70 Ga0105239_10248570 3300010375 Bacteria 1997
71 Ga0157373_10034174 3300013100 Bacteria 3652
72 Ga0157373_10219405 3300013100 Bacteria 1341
73 Ga0157371_10000158 3300013102 Bacteria 99529
74 Ga0157370_10008069 3300013104 Bacteria 11397
75 Ga0163162_10213565 3300013306 Bacteria 2059
76 Ga0163162_10500353 3300013306 Bacteria 1346
77 Ga0157372_10138429 3300013307 Bacteria 2804
78 Ga0157372_10233036 3300013307 Bacteria 2135
79 Ga0182008_10000063 3300014497 Bacteria 89315
80 Ga0182008_10031760 3300014497 Bacteria 2656
81 Ga0182008_10042928 3300014497 Bacteria 2252
82 Ga0182007_10000019 3300015262 Bacteria 194770
83 Ga0182007_10002877 3300015262 Bacteria 8373
84 Ga0182005_1000088 3300015265 Bacteria 69427
85 Ga0183360_10004 3300015689 Bacteria 289992
86 Ga0163161_10000409 3300017792 Bacteria 36015
87 Ga0163161_10001836 3300017792 Bacteria 15508
88 Ga0209436_101415 3300025208 Bacteria 8428
89 Ga0209436_102196 3300025208 Bacteria 6078
90 Ga0209672_100305 3300025228 Bacteria 33130
91 Ga0209147_100738 3300025229 Bacteria 16190
92 Ga0209563_100007 3300025230 Bacteria 1579402
93 Ga0209258_100132 3300025242 Bacteria 175292
94 Ga0207425_1000719 3300025245 Bacteria 17769
95 Ga0207425_1000872 3300025245 Bacteria 14751
96 Ga0209148_1000007 3300025254 Bacteria 1592273
97 Ga0209759_1004485 3300025256 Bacteria 5195
98 Ga0209129_1000084 3300025258 Bacteria 182554
99 Ga0209129_1001133 3300025258 Bacteria 15435
100 Ga0209129_1002047 3300025258 Bacteria 10411
101 Ga0209565_1000499 3300025263 Bacteria 28588
102 Ga0209565_1002618 3300025263 Bacteria 6358
103 Ga0209565_1003482 3300025263 Bacteria 5070
104 Ga0209565_1003813 3300025263 Bacteria 4758
105 Ga0209673_1000753 3300025273 Bacteria 44125
106 Ga0209673_1001028 3300025273 Bacteria 33067
107 Ga0209673_1001819 3300025273 Bacteria 17493
108 Ga0209130_1000362 3300025284 Bacteria 51625
109 Ga0209130_1000385 3300025284 Bacteria 49275
110 Ga0209675_1000701 3300025291 Bacteria 23100
111 Ga0209675_1001529 3300025291 Bacteria 13205
112 Ga0209675_1017963 3300025291 Bacteria 1996
113 Ga0209675_1021867 3300025291 Bacteria 1695
114 Ga0209676_1000542 3300025292 Bacteria 58278
115 Ga0209676_1000748 3300025292 Bacteria 44052
116 Ga0209676_1001700 3300025292 Bacteria 19042
117 Ga0209676_1007569 3300025292 Bacteria 5057
118 Ga0209025_1000021 3300025294 Bacteria 593083
119 Ga0209025_1000942 3300025294 Bacteria 44278
120 Ga0209025_1001442 3300025294 Bacteria 31264
121 Ga0209025_1009399 3300025294 Bacteria 6817
122 Ga0209025_1020095 3300025294 Bacteria 3671
123 Ga0209025_1023324 3300025294 Bacteria 3237
124 Ga0209564_1000026 3300025295 Bacteria 519154
125 Ga0209564_1000414 3300025295 Bacteria 75224
126 Ga0209564_1000613 3300025295 Bacteria 55031
127 Ga0209564_1020754 3300025295 Bacteria 2393
128 Ga0209758_1000184 3300025297 Bacteria 140021
129 Ga0209758_1023869 3300025297 Bacteria 2748
130 Ga0209050_1000836 3300025298 Bacteria 42507
131 Ga0209050_1027488 3300025298 Bacteria 1874
132 Ga0209050_1027569 3300025298 Bacteria 1869
133 Ga0209256_1000156 3300025299 Bacteria 144277
134 Ga0209256_1000239 3300025299 Bacteria 97580
135 Ga0207426_1000049 3300025302 Bacteria 401954
136 Ga0207426_1000086 3300025302 Bacteria 292089
137 Ga0207426_1050532 3300025302 Bacteria 1239
138 Ga0209051_1000349 3300025303 Bacteria 68709
139 Ga0209051_1009746 3300025303 Bacteria 4922
140 Ga0209257_1000411 3300025304 Bacteria 83024
141 Ga0209257_1000719 3300025304 Bacteria 50884
142 Ga0209257_1002613 3300025304 Bacteria 17420
143 Ga0207655_1055337 3300025728 Bacteria 1571
144 Ga0207655_1067840 3300025728 Bacteria 1341
145 Ga0207655_1070644 3300025728 Bacteria 1299
146 Ga0207713_1011043 3300025735 Bacteria 4947
147 Ga0207680_10357764 3300025903 Bacteria 1026
148 Ga0207695_10028597 3300025913 Bacteria 6175
149 Ga0207660_10083548 3300025917 Bacteria 2352
150 Ga0207690_10207871 3300025932 Bacteria 1491
151 Ga0207706_10004266 3300025933 Bacteria 13451
152 Ga0207709_10000351 3300025935 Bacteria 47249
153 Ga0207709_10001488 3300025935 Bacteria 16178
154 Ga0207709_10103915 3300025935 Bacteria 1884
155 Ga0207689_10205588 3300025942 Bacteria 1626
156 Ga0207679_10013094 3300025945 Bacteria 5430
157 Ga0207667_10060311 3300025949 Bacteria 3971
158 Ga0207667_10387268 3300025949 Bacteria 1424
159 Ga0207678_10403424 3300026067 Bacteria 1184
160 Ga0207674_10130004 3300026116 Bacteria 2482
161 Ga0207674_10187143 3300026116 Bacteria 2021
162 Ga0207683_10168806 3300026121 Bacteria 1981
163 Ga0207683_10203815 3300026121 Bacteria 1799
164 Ga0268266_10728695 3300028379 Bacteria 956
165 Ga0307515_10087173 3300028794 Bacteria 3967
166 Ga0316177_1114200 3300030731 Bacteria 2074
167 Ga0314311_1045908 3300030733 Bacteria 1940
168 Ga0316178_1102817 3300030735 Bacteria 2114
169 Ga0316180_1178586 3300030736 Bacteria 1258
170 Ga0316183_1017432 3300030742 Bacteria 13923
171 Ga0307509_10015769 3300031507 Bacteria 8790
172 Ga0307408_100062382 3300031548 Bacteria 2723
173 Ga0265314_10050252 3300031711 Bacteria 2914
174 Ga0307405_10034244 3300031731 Bacteria 3020
175 Ga0307405_10623271 3300031731 Bacteria 883
176 Ga0307412_10034834 3300031911 Bacteria 3211
177 Ga0307409_100108890 3300031995 Bacteria 2318
178 Ga0307411_10010441 3300032005 Bacteria 4951
179 Ga0395899_0002089 3300037312 Bacteria 16385
180 Ga0395900_0034162 3300037418 Bacteria 5235
181 Ga0395905_0155671 3300037471 Bacteria 2149
182 Ga0439447_007340 3300041407 Bacteria 3510
183 Ga0439463_000482 3300042016 Bacteria 11114
184 Ga0439463_001749 3300042016 Bacteria 5650
185 Ga0466958_0018825 3300045836 Bacteria 4012
186 Ga0495617_000061 3300046452 Bacteria 96850
187 Ga0495627_002823 3300046453 Bacteria 8047
188 Ga0495591_000128 3300046458 Bacteria 82830
189 Ga0495591_003754 3300046458 Bacteria 7676
190 Ga0495638_0001147 3300046460 Bacteria 25579
191 Ga0495638_0037483 3300046460 Bacteria 3084
192 Ga0495650_0000472 3300046471 Bacteria 62014
193 Ga0495650_0011461 3300046471 Bacteria 4853
194 Ga0495650_0040920 3300046471 Bacteria 1985
195 Ga0495605_0000254 3300046474 Bacteria 63277
196 Ga0495584_0000006 3300046491 Bacteria 301775
197 Ga0495584_0074614 3300046491 Bacteria 1705
198 Ga0495585_0003240 3300046492 Bacteria 11096
199 Ga0495596_0001281 3300046500 Bacteria 14537
200 Ga0495607_0000004 3300046501 Bacteria 317271
201 Ga0495607_0000186 3300046501 Bacteria 66578
202 Ga0495607_0000223 3300046501 Bacteria 60292
203 Ga0495607_0016762 3300046501 Bacteria 4724
204 Ga0495607_0045132 3300046501 Bacteria 2594
205 Ga0495583_0001004 3300046506 Bacteria 32303
206 Ga0495583_0001562 3300046506 Bacteria 22647
207 Ga0495583_0139334 3300046506 Bacteria 1011
208 Ga0495606_0000328 3300046507 Bacteria 81999
209 Ga0495606_0004103 3300046507 Bacteria 14792
210 Ga0495606_0018421 3300046507 Bacteria 5235
211 Ga0495606_0128016 3300046507 Bacteria 1512
212 Ga0495606_0258965 3300046507 Bacteria 961
213 Ga0495610_0000021 3300046512 Bacteria 336300
214 Ga0495610_0004116 3300046512 Bacteria 10882
215 Ga0495610_0017910 3300046512 Bacteria 4020
216 Ga0495616_0000097 3300046513 Bacteria 74443
217 Ga0495616_0003028 3300046513 Bacteria 10897
218 Ga0495620_0055936 3300046515 Bacteria 1661
219 Ga0495620_0128503 3300046515 Bacteria 995
220 Ga0495631_0000404 3300046518 Bacteria 29812
221 Ga0495637_0009486 3300046520 Bacteria 4743
222 Ga0495637_0018700 3300046520 Bacteria 3210
223 Ga0495637_0024603 3300046520 Bacteria 2724
224 Ga0495637_0032237 3300046520 Bacteria 2310
225 Ga0495637_0038299 3300046520 Bacteria 2077
226 Ga0495643_0000498 3300046522 Bacteria 49557
227 Ga0495643_0014072 3300046522 Bacteria 4770
228 Ga0495648_0002704 3300046524 Bacteria 16023
229 Ga0495648_0005785 3300046524 Bacteria 10198
230 Ga0495663_0001896 3300046525 Bacteria 6436
231 Ga0495663_0014713 3300046525 Bacteria 2196
232 Ga0495654_0012401 3300046530 Bacteria 4580
233 Ga0495587_0213631 3300046536 Bacteria 1089
234 Ga0495609_0005596 3300046538 Bacteria 6553
235 Ga0495622_0068753 3300046557 Bacteria 1636
236 Ga0495668_0000619 3300046616 Bacteria 42997
237 Ga0495668_0002319 3300046616 Bacteria 15918
238 Ga0495668_0002378 3300046616 Bacteria 15614
239 Ga0495668_0016349 3300046616 Bacteria 4312
240 Ga0495611_0193020 3300046648 Bacteria 950
241 Ga0495625_0021679 3300046660 Bacteria 4942
242 Ga0495625_0234407 3300046660 Bacteria 1198
243 Ga0495625_0244632 3300046660 Bacteria 1166
244 Ga0495661_0016581 3300046665 Bacteria 4879
245 Ga0495661_0018886 3300046665 Bacteria 4525
246 Ga0495661_0025997 3300046665 Bacteria 3773
247 Ga0495661_0206215 3300046665 Bacteria 1026
248 Ga0495588_0000077 3300046674 Bacteria 215338
249 Ga0495670_0001513 3300046691 Bacteria 11342
250 Ga0495671_0000024 3300046692 Bacteria 246812
251 Ga0495671_0013308 3300046692 Bacteria 4459
252 Ga0495671_0054735 3300046692 Bacteria 1977
253 Ga0495660_0001829 3300046810 Bacteria 13969
254 Ga0495660_0002049 3300046810 Bacteria 13106
255 Ga0495676_0062280 3300047321 Bacteria 2913
256 Ga0495676_0213337 3300047321 Bacteria 1334
257 Ga0495683_0028656 3300047323 Bacteria 2846
258 Ga0495683_0044414 3300047323 Bacteria 2235
259 Ga0495679_002281 3300047446 Bacteria 9897
260 Ga0495679_015386 3300047446 Bacteria 2799
261 Ga0495673_0000120 3300047469 Bacteria 144972
262 Ga0495673_0004158 3300047469 Bacteria 9152
263 Ga0495673_0011315 3300047469 Bacteria 4807
264 Ga0495686_0244175 3300047472 Bacteria 1011
265 Ga0495593_0046231 3300047673 Bacteria 2320
266 Ga0495614_0024480 3300048089 Bacteria 2606
267 Ga0495626_0000574 3300048091 Bacteria 36427
268 Ga0496102_0281779 3300048905 Bacteria 1567
269 Ga0496103_0315330 3300048906 Bacteria 1006
270 Ga0496104_0232270 3300048907 Bacteria 1756
271 Ga0496116_0047039 3300048919 Bacteria 2907
272 Ga0496116_0082400 3300048919 Bacteria 1990
273 Ga0496117_0002092 3300048920 Bacteria 26276
274 Ga0496117_0011289 3300048920 Bacteria 8010
275 Ga0496117_0197048 3300048920 Bacteria 1141
276 Ga0496118_0000108 3300048921 Bacteria 153902
277 Ga0496118_0017280 3300048921 Bacteria 6578
278 Ga0496118_0048075 3300048921 Bacteria 3300
279 Ga0496118_0136353 3300048921 Bacteria 1565
280 Ga0496119_0000587 3300048922 Bacteria 49190
281 Ga0496120_0001074 3300048923 Bacteria 36034
282 Ga0496121_0005005 3300048924 Bacteria 17346
283 Ga0496121_0012841 3300048924 Bacteria 9064
284 Ga0496121_0070040 3300048924 Bacteria 2827
285 Ga0496121_0164533 3300048924 Bacteria 1618
286 Ga0496122_0009107 3300048925 Bacteria 10524
287 Ga0496122_0015440 3300048925 Bacteria 7301
288 Ga0496122_0069978 3300048925 Bacteria 2510
289 Ga0496122_0076806 3300048925 Bacteria 2348
290 Ga0496122_0195788 3300048925 Bacteria 1187
291 Ga0496123_0005058 3300048926 Bacteria 13473
292 Ga0496123_0005518 3300048926 Bacteria 12698
293 Ga0496123_0014041 3300048926 Bacteria 6666
294 Ga0496124_0000586 3300048927 Bacteria 61341
295 Ga0496124_0004904 3300048927 Bacteria 15378
296 Ga0496124_0005734 3300048927 Bacteria 13827
297 Ga0496124_0028527 3300048927 Bacteria 4991
298 Ga0496124_0053097 3300048927 Bacteria 3438
299 Ga0496124_0128271 3300048927 Bacteria 2019
300 Ga0496124_0200228 3300048927 Bacteria 1519
301 Ga0496125_0003002 3300048928 Bacteria 21117
302 Ga0496125_0137646 3300048928 Bacteria 1704
303 Ga0496126_0001975 3300048929 Bacteria 29049
304 Ga0495678_008568 3300049459 Bacteria 5144
305 Ga0495682_0000027 3300049460 Bacteria 143927
306 Ga0495682_0000386 3300049460 Bacteria 31914
307 Ga0501067_0001716 3300049583 Bacteria 12039
308 Ga0501249_012317 3300049679 Bacteria 1806
309 Ga0501225_0013060 3300049705 Bacteria 2327
310 Ga0501083_0001367 3300049744 Bacteria 16542
311 Ga0501262_000026 3300049759 Bacteria 20810
312 nmdc:mga00v17_115563_c1 3300050491 Bacteria 1705
313 nmdc:mga00v17_42758_c2 3300050491 Bacteria 1739
314 nmdc:mga0yw44_10846_c1 3300050492 Bacteria 4671
315 nmdc:mga07m45_5667_c1 3300050496 Bacteria 6243
316 Ga0500610_0000663 3300053079 Bacteria 10605
317 Ga0500610_0010714 3300053079 Bacteria 4138
318 Ga0500610_0035811 3300053079 Bacteria 2548
319 Ga0500643_003991 3300053087 Bacteria 6824
320 Ga0500651_0069721 3300053093 Bacteria 2188
321 Ga0500562_017323 3300053108 Bacteria 1857
322 Ga0500571_000034 3300053110 Bacteria 44157
323 Ga0500593_000364 3300053117 Bacteria 18228
324 Ga0500594_0094378 3300053118 Bacteria 912
325 Ga0500607_001372 3300053121 Bacteria 22112
326 Ga0500608_027640 3300053122 Bacteria 2674
327 Ga0500626_117142 3300053128 Bacteria 1144
328 Ga0500658_0000434 3300053134 Bacteria 17958
329 Ga0500658_0000616 3300053134 Bacteria 14745
330 Ga0500568_0035262 3300053139 Bacteria 2042
331 Ga0500574_024361 3300053141 Bacteria 1566
332 Ga0500586_000405 3300053145 Bacteria 8610
333 Ga0500627_0000530 3300053158 Bacteria 10314
334 Ga0500636_0146308 3300053177 Bacteria 1302
335 Ga0501082_0096692 3300060353 Bacteria 2553
336 2511380102 2511231025 Bacteria 5324661
337 2513228767 2513020051 Bacteria 6053213
338 2578456471 2576861471 Bacteria 4648976
339 2597859148 2597489887 Bacteria 6666321
340 2599620919 2599185214 Bacteria 8209958
341 2599674275 2599185226 Bacteria 8233575
342 2599678465 2599185227 Bacteria 8246414
343 2599690430 2599185229 Bacteria 8216126
344 2599806254 2599185257 Bacteria 6492581
345 2599972196 2599185307 Bacteria 6194719
346 2643802246 2643221556 Bacteria 7251154
347 2643974750 2643221593 Bacteria 6296053
348 2644326132 2643221658 Bacteria 6064537
349 2644400798 2643221672 Bacteria 6322190
350 2644466035 2643221683 Bacteria 5749203
351 2644475754 2643221684 Bacteria 7145183
352 2671772682 2671180172 Bacteria 6495783
353 2738825837 2738541297 Bacteria 6549566
354 2738882354 2738541307 Bacteria 8606193
355 2739149634 2738541357 Bacteria 6549408
356 2739191553 2738543003 Bacteria 6549560
357 2739241988 2738543012 Bacteria 7115078
358 2739318030 2738543026 Bacteria 6549408
359 2739336271 2738543029 Bacteria 6549249
360 2819566718 2818991441 Bacteria 5062707
361 2819602043 2818991446 Bacteria 7757362
362 2838055109 2838054893 Bacteria 7451788
363 2842681600 2842677519 Bacteria 5615038
364 2857566238 2857564685 Bacteria 6290584
365 2857580874 2857576091 Bacteria 5465855
366 2885201895 2885198086 Bacteria 7212419
367 2885215395 2885211737 Bacteria 7212420
368 2899927199 2899924645 Bacteria 7487985
369 2904482764 2904479285 Bacteria 5073931
370 2908448942 2908446538 Bacteria 6829095
371 2919465372 2919462493 Bacteria 5817112
372 2928044039 2928037797 Bacteria 7273642
373 2928048687 2928044640 Bacteria 7271509
374 2928055013 2928051484 Bacteria 7773759
375 2928068447 2928064002 Bacteria 7419480
376 2928073650 2928070936 Bacteria 8062541
377 2928089640 2928084124 Bacteria 7159212
378 2941479432 2941475908 Bacteria 4145589
379 2945914259 2945909444 Bacteria 7065066
380 2945990358 2945984333 Bacteria 7358892
381 2995954126 2995948881 Bacteria 6358104
382 3007424157 3007419365 Bacteria 7026924
383 Ga0157370_10003826
384 JGI24740J21852_10011997
385 JGI24739J22299_10079591
386 JGI25152J39213_1006909
387 JGI25152J39213_1010078
388 JGI25150J39212_1001279
389 JGI25150J39212_1001363
390 JGI25159J45721_1001762
391 JGI25151J46595_10000324
392 JGI25151J46595_10001164
393 JGI25151J46595_10035670
394 JGI25153J46596_10029434
395 JGI25160J50197_1002414
396 JGI25161J50226_1001167
397 JGI25161J50226_1001715
398 Ga0055535_1000108
399 Ga0055542_1000051
400 Ga0055526_1000052
401 Ga0055526_1004231
402 Ga0055526_1004926
403 Ga0055537_1001568
404 Ga0055537_1015488
405 Ga0055537_1015607
406 Ga0055524_1002826
407 Ga0055524_1018080
408 Ga0055536_1004226
409 Ga0055536_1004235
410 Ga0055536_1008124
411 Ga0055534_1002084
412 Ga0055534_1003214
413 Ga0055534_1016513
414 Ga0055528_1003003
415 Ga0055528_1032434
416 Ga0055528_1032621
417 Ga0055530_10016430
418 Ga0055530_10058226
419 Ga0055540_1002243
420 Ga0055540_1003134
421 Ga0055531_10000506
422 Ga0055531_10024330
423 Ga0055543_1001589
424 Ga0065165_1004420
425 Ga0065165_1036022
426 Ga0065165_1042691
427 Ga0065714_10077000
428 Ga0070666_10184780
429 Ga0070680_100093306
430 Ga0070660_100043420
431 Ga0070660_100330811
432 Ga0070667_100062302
433 Ga0070678_100410753
434 Ga0070662_100017603
435 Ga0068853_100056550
436 Ga0068855_100219029
437 Ga0070664_100007670
438 Ga0068857_100334238
439 Ga0068860_100244400
440 Ga0075364_10118251
441 Ga0075364_10263531
442 Ga0075370_10001484
443 Ga0105251_10003726
444 Ga0105244_10005378
445 Ga0105244_10027904
446 Ga0105244_10148511
447 Ga0105243_10036676
448 Ga0105243_10180298
449 Ga0105242_10173078
450 Ga0105237_10632694
451 Ga0105238_10019143
452 Ga0105239_10248570
453 Ga0157373_10034174
454 Ga0157373_10219405
455 Ga0157371_10000158
456 Ga0157370_10008069
457 Ga0163162_10213565
458 Ga0163162_10500353
459 Ga0157372_10138429
460 Ga0157372_10233036
461 Ga0182008_10000063
462 Ga0182008_10031760
463 Ga0182008_10042928
464 Ga0182007_10000019
465 Ga0182007_10002877
466 Ga0182005_1000088
467 Ga0183360_10004
468 Ga0163161_10000409
469 Ga0163161_10001836
470 Ga0209436_101415
471 Ga0209436_102196
472 Ga0209672_100305
473 Ga0209147_100738
474 Ga0209563_100007
475 Ga0209258_100132
476 Ga0207425_1000719
477 Ga0207425_1000872
478 Ga0209148_1000007
479 Ga0209759_1004485
480 Ga0209129_1000084
481 Ga0209129_1001133
482 Ga0209129_1002047
483 Ga0209565_1000499
484 Ga0209565_1002618
485 Ga0209565_1003482
486 Ga0209565_1003813
487 Ga0209673_1000753
488 Ga0209673_1001028
489 Ga0209673_1001819
490 Ga0209130_1000362
491 Ga0209130_1000385
492 Ga0209675_1000701
493 Ga0209675_1001529
494 Ga0209675_1017963
495 Ga0209675_1021867
496 Ga0209676_1000542
497 Ga0209676_1000748
498 Ga0209676_1001700
499 Ga0209676_1007569
500 Ga0209025_1000021
501 Ga0209025_1000942
502 Ga0209025_1001442
503 Ga0209025_1009399
504 Ga0209025_1020095
505 Ga0209025_1023324
506 Ga0209564_1000026
507 Ga0209564_1000414
508 Ga0209564_1000613
509 Ga0209564_1020754
510 Ga0209758_1000184
511 Ga0209758_1023869
512 Ga0209050_1000836
513 Ga0209050_1027488
514 Ga0209050_1027569
515 Ga0209256_1000156
516 Ga0209256_1000239
517 Ga0207426_1000049
518 Ga0207426_1000086
519 Ga0207426_1050532
520 Ga0209051_1000349
521 Ga0209051_1009746
522 Ga0209257_1000411
523 Ga0209257_1000719
524 Ga0209257_1002613
525 Ga0207655_1055337
526 Ga0207655_1067840
527 Ga0207655_1070644
528 Ga0207713_1011043
529 Ga0207680_10357764
530 Ga0207695_10028597
531 Ga0207660_10083548
532 Ga0207690_10207871
533 Ga0207706_10004266
534 Ga0207709_10000351
535 Ga0207709_10001488
536 Ga0207709_10103915
537 Ga0207689_10205588
538 Ga0207679_10013094
539 Ga0207667_10060311
540 Ga0207667_10387268
541 Ga0207678_10403424
542 Ga0207674_10130004
543 Ga0207674_10187143
544 Ga0207683_10168806
545 Ga0207683_10203815
546 Ga0268266_10728695
547 Ga0307515_10087173
548 Ga0316177_1114200
549 Ga0314311_1045908
550 Ga0316178_1102817
551 Ga0316180_1178586
552 Ga0316183_1017432
553 Ga0307509_10015769
554 Ga0307408_100062382
555 Ga0265314_10050252
556 Ga0307405_10034244
557 Ga0307405_10623271
558 Ga0307412_10034834
559 Ga0307409_100108890
560 Ga0307411_10010441
561 Ga0395899_0002089
562 Ga0395900_0034162
563 Ga0395905_0155671
564 Ga0439447_007340
565 Ga0439463_000482
566 Ga0439463_001749
567 Ga0466958_0018825
568 Ga0495617_000061
569 Ga0495627_002823
570 Ga0495591_000128
571 Ga0495591_003754
572 Ga0495638_0001147
573 Ga0495638_0037483
574 Ga0495650_0000472
575 Ga0495650_0011461
576 Ga0495650_0040920
577 Ga0495605_0000254
578 Ga0495584_0000006
579 Ga0495584_0074614
580 Ga0495585_0003240
581 Ga0495596_0001281
582 Ga0495607_0000004
583 Ga0495607_0000186
584 Ga0495607_0000223
585 Ga0495607_0016762
586 Ga0495607_0045132
587 Ga0495583_0001004
588 Ga0495583_0001562
589 Ga0495583_0139334
590 Ga0495606_0000328
591 Ga0495606_0004103
592 Ga0495606_0018421
593 Ga0495606_0128016
594 Ga0495606_0258965
595 Ga0495610_0000021
596 Ga0495610_0004116
597 Ga0495610_0017910
598 Ga0495616_0000097
599 Ga0495616_0003028
600 Ga0495620_0055936
601 Ga0495620_0128503
602 Ga0495631_0000404
603 Ga0495637_0009486
604 Ga0495637_0018700
605 Ga0495637_0024603
606 Ga0495637_0032237
607 Ga0495637_0038299
608 Ga0495643_0000498
609 Ga0495643_0014072
610 Ga0495648_0002704
611 Ga0495648_0005785
612 Ga0495663_0001896
613 Ga0495663_0014713
614 Ga0495654_0012401
615 Ga0495587_0213631
616 Ga0495609_0005596
617 Ga0495622_0068753
618 Ga0495668_0000619
619 Ga0495668_0002319
620 Ga0495668_0002378
621 Ga0495668_0016349
622 Ga0495611_0193020
623 Ga0495625_0021679
624 Ga0495625_0234407
625 Ga0495625_0244632
626 Ga0495661_0016581
627 Ga0495661_0018886
628 Ga0495661_0025997
629 Ga0495661_0206215
630 Ga0495588_0000077
631 Ga0495670_0001513
632 Ga0495671_0000024
633 Ga0495671_0013308
634 Ga0495671_0054735
635 Ga0495660_0001829
636 Ga0495660_0002049
637 Ga0495676_0062280
638 Ga0495676_0213337
639 Ga0495683_0028656
640 Ga0495683_0044414
641 Ga0495679_002281
642 Ga0495679_015386
643 Ga0495673_0000120
644 Ga0495673_0004158
645 Ga0495673_0011315
646 Ga0495686_0244175
647 Ga0495593_0046231
648 Ga0495614_0024480
649 Ga0495626_0000574
650 Ga0496102_0281779
651 Ga0496103_0315330
652 Ga0496104_0232270
653 Ga0496116_0047039
654 Ga0496116_0082400
655 Ga0496117_0002092
656 Ga0496117_0011289
657 Ga0496117_0197048
658 Ga0496118_0000108
659 Ga0496118_0017280
660 Ga0496118_0048075
661 Ga0496118_0136353
662 Ga0496119_0000587
663 Ga0496120_0001074
664 Ga0496121_0005005
665 Ga0496121_0012841
666 Ga0496121_0070040
667 Ga0496121_0164533
668 Ga0496122_0009107
669 Ga0496122_0015440
670 Ga0496122_0069978
671 Ga0496122_0076806
672 Ga0496122_0195788
673 Ga0496123_0005058
674 Ga0496123_0005518
675 Ga0496123_0014041
676 Ga0496124_0000586
677 Ga0496124_0004904
678 Ga0496124_0005734
679 Ga0496124_0028527
680 Ga0496124_0053097
681 Ga0496124_0128271
682 Ga0496124_0200228
683 Ga0496125_0003002
684 Ga0496125_0137646
685 Ga0496126_0001975
686 Ga0495678_008568
687 Ga0495682_0000027
688 Ga0495682_0000386
689 Ga0501067_0001716
690 Ga0501249_012317
691 Ga0501225_0013060
692 Ga0501083_0001367
693 Ga0501262_000026
694 nmdc:mga00v17_115563_c1
695 nmdc:mga00v17_42758_c2
696 nmdc:mga0yw44_10846_c1
697 nmdc:mga07m45_5667_c1
698 Ga0500610_0000663
699 Ga0500610_0010714
700 Ga0500610_0035811
701 Ga0500643_003991
702 Ga0500651_0069721
703 Ga0500562_017323
704 Ga0500571_000034
705 Ga0500593_000364
706 Ga0500594_0094378
707 Ga0500607_001372
708 Ga0500608_027640
709 Ga0500626_117142
710 Ga0500658_0000434
711 Ga0500658_0000616
712 Ga0500568_0035262
713 Ga0500574_024361
714 Ga0500586_000405
715 Ga0500627_0000530
716 Ga0500636_0146308
717 Ga0501082_0096692
718 2511380102
719 2513228767
720 2578456471
721 2597859148
722 2599620919
723 2599674275
724 2599678465
725 2599690430
726 2599806254
727 2599972196
728 2643802246
729 2643974750
730 2644326132
731 2644400798
732 2644466035
733 2644475754
734 2671772682
735 2738825837
736 2738882354
737 2739149634
738 2739191553
739 2739241988
740 2739318030
741 2739336271
742 2819566718
743 2819602043
744 2838055109
745 2842681600
746 2857566238
747 2857580874
748 2885201895
749 2885215395
750 2899927199
751 2904482764
752 2908448942
753 2919465372
754 2928044039
755 2928048687
756 2928055013
757 2928068447
758 2928073650
759 2928089640
760 2941479432
761 2945914259
762 2945990358
763 2995954126
764 3007424157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

53

300

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4otk-assembly1.cif.gz_A a structural characterization of the isoniazid mycobacterium tuberculosis drug target, rv2971, in its unliganded form 0.9658 8 260
4g5d-assembly2.cif.gz_B x-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to nadph 0.9587 8 260
3f7j-assembly2.cif.gz_B b.subtilis yvgn 0.9585 8 260
1m9h-assembly1.cif.gz_A corynebacterium 2,5-dkgr a and phe 22 replaced with tyr (f22y), lys 232 replaced with gly (k232g), arg 238 replaced with his (r238h)and ala 272 replaced with gly (a272g)in presence of nadh cofactor 0.9584 8 260
1a80-assembly1.cif.gz_A native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. complexed with nadph 0.9573 8 260
ID Description Score Start End Superfamily
af_P30863_1_265_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9987 8 267 3.20.20.100
af_P30863_1_265_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9762 8 267 3.20.20.100
af_Q2G2T8_4_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9658 8 260 3.20.20.100
af_Q2FXE2_1_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9575 8 260 3.20.20.100
af_Q9VTL0_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9544 8 257 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A4U6M0S1-F1-model_v4 2,5-didehydrogluconate reductase DkgB (EC 1.1.1.346) 0.9983 8 269 GO:0004033
GO:0019853
GO:0051596
GO:1990002
AF-A0A6I5AJR0-F1-model_v4 2,5-didehydrogluconate reductase DkgB (EC 1.1.1.346) 0.9973 8 269 GO:0004033
GO:0019853
GO:0051596
GO:1990002
AF-A0A6C8GS15-F1-model_v4 Methylglyoxal reductase 0.9973 86 269 GO:0004033
GO:0019853
GO:0051596
GO:1990002
AF-F4MZR4-F1-model_v4 2,5-diketo-D-gluconic acid reductase B (EC 1.1.1.21, EC 1.1.1.274) 0.9971 8 267 GO:0004032
GO:0019853
GO:0050580
GO:0051596
GO:1990002
AF-A0A3S4DER2-F1-model_v4 2,5-diketo-D-gluconic acid reductase B (EC 1.1.1.274) 0.9968 8 269 GO:0004033
GO:0019853
GO:0050580
GO:0051596
GO:1990002

Map