F429280

General Info

Members Datasets Scaffolds Average Seq Length
382 240 382 283

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10238006|Ga0163161_102380062
Length 329
Sequence VRSATSPAGDDGAREVPAGEDAAVAAAGAATHDAHVVPLPWAGLALATVGAIAFSGKAIVAKLLYRHGLDAVTVLGLRMLFALPLFLLLAWWAGRGKPPLSASDKRLVLLLGVTGYYLASFLDFLGLQYISASLERLILYLNPTLVLALGIVLFGRRVTLRQAVAIGVSYAGVLLVFGHEVGFQGPDAALGTALVFASAVSYAVYLVYSGEIVRRLGSMRLVGLASTVACVLCIGQFLLLRPAGLLLELPAPALWLSLLNATACTVAPVLMVMMAIERIGATMAAQTGMIGPVSTIMMGVLILGEPFTGWVAAGTALVIAGIWLLARSR

Samples

Sample ID Description Type Environment
1 2643221660 Methylibium sp. Root1272 Isolate Unclassified
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
146 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
174 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
175 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
176 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
232 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
233 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
240 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.06
Nodule 0.26
Rhizoplane 2.88
Rhizosphere 70.68
Stem 0
Stem Tuber 0
Unclassified 8.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1017808 3300002987 Bacteria 1453
2 JGI25153J46596_10004449 3300003215 Bacteria 7555
3 rootH1_10013718 3300003316 Bacteria 2335
4 rootH1_10013718 3300003323 Bacteria 1571
5 rootH1_10013735 3300003316 Bacteria 4059
6 rootL2_10028669 3300003322 Bacteria 3769
7 rootH1_10021821 3300003323 Bacteria 5472
8 Ga0055539_1000465 3300003752 Bacteria 13352
9 Ga0055533_1000024 3300003756 Bacteria 338067
10 Ga0055525_1000985 3300003759 Bacteria 7679
11 Ga0055537_1000599 3300003773 Bacteria 20074
12 Ga0055536_1000931 3300003781 Bacteria 18847
13 Ga0055534_1000016 3300003784 Bacteria 144444
14 Ga0055528_1000144 3300003790 Bacteria 58098
15 Ga0055530_10018130 3300003791 Bacteria 2182
16 Ga0055540_1006832 3300003792 Bacteria 4442
17 Ga0065165_1003088 3300005262 Bacteria 12409
18 Ga0065707_10083342 3300005295 Bacteria 9500
19 Ga0070658_10033922 3300005327 Bacteria 4107
20 Ga0070658_10117122 3300005327 Bacteria 2212
21 Ga0070676_10018282 3300005328 Bacteria 3882
22 Ga0070683_100531860 3300005329 Bacteria 1124
23 Ga0070690_100010756 3300005330 Bacteria 5336
24 Ga0070670_100107980 3300005331 Bacteria 2398
25 Ga0070670_100164644 3300005331 Bacteria 1922
26 Ga0068869_100003632 3300005334 Bacteria 9466
27 Ga0068869_100245162 3300005334 Bacteria 1429
28 Ga0070666_10124245 3300005335 Bacteria 1791
29 Ga0068868_100006601 3300005338 Bacteria 8224
30 Ga0068868_100028448 3300005338 Bacteria 4274
31 Ga0068868_100344686 3300005338 Bacteria 1275
32 Ga0068868_100544785 3300005338 Bacteria 1022
33 Ga0070660_100135799 3300005339 Bacteria 1970
34 Ga0070669_100008890 3300005353 Bacteria 7166
35 Ga0070669_100166869 3300005353 Bacteria 1714
36 Ga0070675_100041841 3300005354 Bacteria 3743
37 Ga0070675_100109339 3300005354 Bacteria 2336
38 Ga0070671_100048834 3300005355 Bacteria 3520
39 Ga0070671_100051521 3300005355 Bacteria 3423
40 Ga0070674_100291872 3300005356 Bacteria 1297
41 Ga0070659_100245449 3300005366 Bacteria 1483
42 Ga0070667_100010167 3300005367 Bacteria 7777
43 Ga0070667_100165548 3300005367 Bacteria 1950
44 Ga0070663_100266271 3300005455 Bacteria 1361
45 Ga0070662_100008550 3300005457 Bacteria 6676
46 Ga0070662_100249388 3300005457 Bacteria 1426
47 Ga0068867_100013416 3300005459 Bacteria 5805
48 Ga0068867_100254644 3300005459 Bacteria 1429
49 Ga0070679_100152415 3300005530 Bacteria 2288
50 Ga0068853_100043732 3300005539 Bacteria 3832
51 Ga0068853_100433507 3300005539 Bacteria 1234
52 Ga0070672_100011944 3300005543 Bacteria 6071
53 Ga0070672_100349708 3300005543 Bacteria 1260
54 Ga0070665_100012277 3300005548 Bacteria 8636
55 Ga0070665_100203595 3300005548 Bacteria 1979
56 Ga0068855_100028947 3300005563 Bacteria 6627
57 Ga0068857_100163295 3300005577 Bacteria 2022
58 Ga0068854_100233271 3300005578 Bacteria 1462
59 Ga0068852_100186411 3300005616 Bacteria 1954
60 Ga0068859_100083382 3300005617 Bacteria 3240
61 Ga0068864_100028890 3300005618 Bacteria 4692
62 Ga0068864_100303058 3300005618 Bacteria 1496
63 Ga0068866_10164541 3300005718 Bacteria 1297
64 Ga0068861_100002195 3300005719 Bacteria 12667
65 Ga0068861_100010648 3300005719 Bacteria 6386
66 Ga0068863_100031410 3300005841 Bacteria 5067
67 Ga0068858_100011322 3300005842 Bacteria 8425
68 Ga0068858_100017363 3300005842 Bacteria 6750
69 Ga0068858_100072660 3300005842 Bacteria 3191
70 Ga0068858_100183722 3300005842 Bacteria 1975
71 Ga0068860_100087299 3300005843 Bacteria 2969
72 Ga0068860_100139376 3300005843 Bacteria 2330
73 Ga0068860_100226116 3300005843 Bacteria 1818
74 Ga0068860_100407013 3300005843 Bacteria 1347
75 Ga0068862_100023975 3300005844 Bacteria 5115
76 Ga0075363_100017695 3300006048 Bacteria 3539
77 Ga0075364_10063647 3300006051 Bacteria 2422
78 Ga0075362_10001325 3300006177 Bacteria 7837
79 Ga0075367_10018086 3300006178 Bacteria 3882
80 Ga0075367_10026447 3300006178 Bacteria 3291
81 Ga0075366_10004248 3300006195 Bacteria 7680
82 Ga0075366_10017042 3300006195 Bacteria 4177
83 Ga0075366_10068225 3300006195 Bacteria 2116
84 Ga0075366_10197036 3300006195 Bacteria 1224
85 Ga0075370_10000264 3300006353 Bacteria 18889
86 Ga0075370_10006198 3300006353 Bacteria 6002
87 Ga0075370_10007969 3300006353 Bacteria 5428
88 Ga0075370_10030474 3300006353 Bacteria 3010
89 Ga0075370_10032192 3300006353 Bacteria 2930
90 Ga0075370_10106231 3300006353 Bacteria 1628
91 Ga0075370_10117059 3300006353 Bacteria 1549
92 Ga0068871_100017300 3300006358 Bacteria 5451
93 Ga0068871_100367729 3300006358 Bacteria 1275
94 Ga0075428_100312860 3300006844 Bacteria 1688
95 Ga0068865_100002804 3300006881 Bacteria 10357
96 Ga0097620_100083378 3300006931 Bacteria 3240
97 Ga0099826_10007552 3300006948 Bacteria 8028
98 Ga0105240_10092444 3300009093 Bacteria 3694
99 Ga0105240_10113377 3300009093 Bacteria 3276
100 Ga0105245_10072848 3300009098 Bacteria 3122
101 Ga0105247_10153879 3300009101 Bacteria 1517
102 Ga0105243_10110978 3300009148 Bacteria 2295
103 Ga0105241_10297215 3300009174 Bacteria 1385
104 Ga0105241_10584604 3300009174 Bacteria 1007
105 Ga0105242_10004482 3300009176 Bacteria 10851
106 Ga0105248_10043244 3300009177 Bacteria 5052
107 Ga0105248_10075478 3300009177 Bacteria 3789
108 Ga0105237_10005095 3300009545 Bacteria 14917
109 Ga0105237_10006644 3300009545 Bacteria 12782
110 Ga0105237_10059668 3300009545 Bacteria 3816
111 Ga0105237_10256289 3300009545 Bacteria 1752
112 Ga0105238_10032234 3300009551 Bacteria 5333
113 Ga0105238_10390953 3300009551 Bacteria 1383
114 Ga0105238_10756047 3300009551 Bacteria 986
115 Ga0105249_10020590 3300009553 Bacteria 5898
116 Ga0105249_10242455 3300009553 Bacteria 1783
117 Ga0105249_10314567 3300009553 Bacteria 1575
118 Ga0105239_10000486 3300010375 Bacteria 57901
119 Ga0105239_10148905 3300010375 Bacteria 2612
120 Ga0157374_10123613 3300013296 Bacteria 2500
121 Ga0157378_10003993 3300013297 Bacteria 13031
122 Ga0163162_10008661 3300013306 Bacteria 9902
123 Ga0163162_10009634 3300013306 Bacteria 9395
124 Ga0163162_10061417 3300013306 Bacteria 3796
125 Ga0157375_10061805 3300013308 Bacteria 3720
126 Ga0157380_10018554 3300014326 Bacteria 5164
127 Ga0157380_10297808 3300014326 Bacteria 1484
128 Ga0157377_10001366 3300014745 Bacteria 10491
129 Ga0157379_10002433 3300014968 Bacteria 15584
130 Ga0157379_10015699 3300014968 Bacteria 6655
131 Ga0157379_10022529 3300014968 Bacteria 5579
132 Ga0157379_10051122 3300014968 Bacteria 3691
133 Ga0157379_10150558 3300014968 Bacteria 2098
134 Ga0157376_10019939 3300014969 Bacteria 5178
135 Ga0157376_10266716 3300014969 Bacteria 1606
136 Ga0182007_10041389 3300015262 Bacteria 1536
137 Ga0163161_10189982 3300017792 Bacteria 1578
138 Ga0163161_10238006 3300017792 Bacteria 1415
139 Ga0213876_10045713 3300021384 Bacteria 2315
140 Ga0209674_100007 3300025226 Bacteria 1077082
141 Ga0209563_100060 3300025230 Bacteria 284876
142 Ga0209677_100088 3300025253 Bacteria 108817
143 Ga0209565_1000046 3300025263 Bacteria 226073
144 Ga0209673_1000058 3300025273 Bacteria 269028
145 Ga0209675_1000010 3300025291 Bacteria 541927
146 Ga0209675_1002779 3300025291 Bacteria 8737
147 Ga0209676_1001118 3300025292 Bacteria 29703
148 Ga0209758_1000232 3300025297 Bacteria 117382
149 Ga0209050_1000268 3300025298 Bacteria 111281
150 Ga0209050_1018379 3300025298 Bacteria 2719
151 Ga0209051_1000452 3300025303 Bacteria 54387
152 Ga0209051_1007209 3300025303 Bacteria 6115
153 Ga0209257_1006788 3300025304 Bacteria 7204
154 Ga0207642_10189469 3300025899 Bacteria 1127
155 Ga0207688_10005297 3300025901 Bacteria 7007
156 Ga0207645_10015157 3300025907 Bacteria 5133
157 Ga0207643_10152850 3300025908 Bacteria 1385
158 Ga0207705_10021379 3300025909 Bacteria 4617
159 Ga0207705_10077083 3300025909 Bacteria 2424
160 Ga0207695_10063912 3300025913 Bacteria 3792
161 Ga0207695_10067376 3300025913 Bacteria 3672
162 Ga0207671_10015218 3300025914 Bacteria 6040
163 Ga0207671_10026887 3300025914 Bacteria 4304
164 Ga0207657_10019615 3300025919 Bacteria 6413
165 Ga0207657_10228258 3300025919 Bacteria 1490
166 Ga0207649_10005250 3300025920 Bacteria 7000
167 Ga0207681_10006690 3300025923 Bacteria 7073
168 Ga0207681_10045330 3300025923 Bacteria 2952
169 Ga0207694_10024519 3300025924 Bacteria 4582
170 Ga0207694_10085725 3300025924 Bacteria 2480
171 Ga0207694_10155507 3300025924 Bacteria 1844
172 Ga0207650_10075880 3300025925 Bacteria 2538
173 Ga0207650_10132711 3300025925 Bacteria 1951
174 Ga0207687_10062877 3300025927 Bacteria 2627
175 Ga0207687_10180371 3300025927 Bacteria 1636
176 Ga0207644_10025597 3300025931 Bacteria 4058
177 Ga0207690_10078270 3300025932 Bacteria 2300
178 Ga0207690_10230911 3300025932 Bacteria 1420
179 Ga0207706_10004996 3300025933 Bacteria 12390
180 Ga0207706_10323547 3300025933 Bacteria 1342
181 Ga0207686_10041325 3300025934 Bacteria 2810
182 Ga0207686_10060615 3300025934 Bacteria 2396
183 Ga0207709_10000518 3300025935 Bacteria 33631
184 Ga0207669_10025153 3300025937 Bacteria 3212
185 Ga0207669_10085831 3300025937 Bacteria 2033
186 Ga0207669_10308821 3300025937 Bacteria 1205
187 Ga0207704_10035251 3300025938 Bacteria 2865
188 Ga0207704_10042057 3300025938 Bacteria 2686
189 Ga0207704_10400511 3300025938 Bacteria 1083
190 Ga0207665_10094281 3300025939 Bacteria 2079
191 Ga0207691_10018881 3300025940 Bacteria 6531
192 Ga0207691_10124595 3300025940 Bacteria 2281
193 Ga0207711_10299307 3300025941 Bacteria 1483
194 Ga0207689_10000381 3300025942 Bacteria 41638
195 Ga0207689_10241212 3300025942 Bacteria 1494
196 Ga0207667_10008091 3300025949 Bacteria 12535
197 Ga0207667_10323329 3300025949 Bacteria 1575
198 Ga0207712_10014556 3300025961 Bacteria 5064
199 Ga0207712_10146674 3300025961 Bacteria 1817
200 Ga0207658_10069777 3300025986 Bacteria 2657
201 Ga0207658_10144984 3300025986 Bacteria 1927
202 Ga0207677_10001546 3300026023 Bacteria 12175
203 Ga0207677_10086284 3300026023 Bacteria 2268
204 Ga0207703_10130784 3300026035 Bacteria 2167
205 Ga0207703_10326332 3300026035 Bacteria 1407
206 Ga0207639_10035273 3300026041 Bacteria 3700
207 Ga0207678_10046359 3300026067 Bacteria 3759
208 Ga0207702_10013233 3300026078 Bacteria 6862
209 Ga0207702_10043410 3300026078 Bacteria 3775
210 Ga0207702_10074330 3300026078 Bacteria 2933
211 Ga0207641_10076200 3300026088 Bacteria 2899
212 Ga0207641_10079711 3300026088 Bacteria 2839
213 Ga0207641_10202796 3300026088 Bacteria 1830
214 Ga0207641_10259411 3300026088 Bacteria 1626
215 Ga0207648_10066693 3300026089 Bacteria 3138
216 Ga0207648_10181729 3300026089 Bacteria 1862
217 Ga0207674_10185015 3300026116 Bacteria 2034
218 Ga0207674_10296285 3300026116 Bacteria 1566
219 Ga0207675_100001673 3300026118 Bacteria 22193
220 Ga0207675_100007955 3300026118 Bacteria 10000
221 Ga0207683_10019535 3300026121 Bacteria 5787
222 Ga0207683_10440953 3300026121 Bacteria 1200
223 Ga0207698_10055703 3300026142 Bacteria 3049
224 Ga0209981_1006918 3300027378 Bacteria 1524
225 Ga0209995_1000740 3300027471 Bacteria 4999
226 Ga0209968_1000277 3300027526 Bacteria 8845
227 Ga0209999_1018504 3300027543 Bacteria 1275
228 Ga0209966_1000039 3300027695 Bacteria 54525
229 Ga0268266_10038308 3300028379 Bacteria 4081
230 Ga0268265_10085325 3300028380 Bacteria 2506
231 Ga0268265_10124363 3300028380 Bacteria 2131
232 Ga0268264_10051626 3300028381 Bacteria 3427
233 Ga0268264_10170403 3300028381 Bacteria 1968
234 Ga0265336_10000039 3300028666 Bacteria 149376
235 Ga0307517_10055621 3300028786 Bacteria 3881
236 Ga0307517_10216366 3300028786 Bacteria 1171
237 Ga0307515_10000026 3300028794 Bacteria 382411
238 Ga0307515_10000132 3300028794 Bacteria 176547
239 Ga0307515_10027002 3300028794 Bacteria 9845
240 Ga0307515_10061619 3300028794 Bacteria 5316
241 Ga0307515_10139294 3300028794 Bacteria 2613
242 Ga0265324_10005627 3300029957 Bacteria 5366
243 Ga0307512_10034593 3300030522 Bacteria 4320
244 Ga0265330_10014250 3300031235 Bacteria 3691
245 Ga0265332_10015924 3300031238 Bacteria 3319
246 Ga0307513_10197272 3300031456 Bacteria 1858
247 Ga0307509_10002567 3300031507 Bacteria 29157
248 Ga0307509_10004470 3300031507 Bacteria 20127
249 Ga0307509_10007637 3300031507 Bacteria 14056
250 Ga0307509_10108219 3300031507 Bacteria 2794
251 Ga0307408_100035974 3300031548 Bacteria 3477
252 Ga0307408_100136531 3300031548 Bacteria 1920
253 Ga0307408_100210098 3300031548 Bacteria 1581
254 Ga0307508_10029270 3300031616 Bacteria 4980
255 Ga0307508_10040034 3300031616 Bacteria 4210
256 Ga0265314_10003400 3300031711 Bacteria 15415
257 Ga0307516_10001731 3300031730 Bacteria 29956
258 Ga0307516_10017059 3300031730 Bacteria 7581
259 Ga0307405_10107307 3300031731 Bacteria 1885
260 Ga0307405_10124589 3300031731 Bacteria 1769
261 Ga0307518_10082343 3300031838 Bacteria 2323
262 Ga0307406_10000905 3300031901 Bacteria 16636
263 Ga0307416_100214566 3300032002 Bacteria 1839
264 Ga0307416_100263229 3300032002 Bacteria 1687
265 Ga0307510_10006149 3300033180 Bacteria 14304
266 Ga0307510_10085073 3300033180 Bacteria 3042
267 Ga0373952_0006949 3300035092 Bacteria 2107
268 Ga0373960_0065666 3300035121 Bacteria 1110
269 Ga0373943_0162164 3300035170 Bacteria 1218
270 Ga0373931_0001119 3300035691 Bacteria 11387
271 Ga0395899_0047545 3300037312 Bacteria 3194
272 Ga0395899_0066770 3300037312 Bacteria 2641
273 Ga0395899_0153499 3300037312 Bacteria 1631
274 Ga0395900_0007905 3300037418 Bacteria 10955
275 Ga0395900_0017566 3300037418 Bacteria 7299
276 Ga0395900_0113108 3300037418 Bacteria 2786
277 Ga0395900_0157737 3300037418 Bacteria 2317
278 Ga0395900_0214515 3300037418 Bacteria 1943
279 Ga0395898_0003019 3300037466 Bacteria 19093
280 Ga0395898_0032162 3300037466 Bacteria 5235
281 Ga0395905_0007893 3300037471 Bacteria 10528
282 Ga0395905_0013295 3300037471 Bacteria 7893
283 Ga0395905_0098432 3300037471 Bacteria 2747
284 Ga0395905_0179537 3300037471 Bacteria 1987
285 Ga0395905_0196405 3300037471 Bacteria 1892
286 Ga0395905_0431947 3300037471 Bacteria 1214
287 Ga0395905_0447522 3300037471 Bacteria 1189
288 Ga0395901_0022560 3300038443 Bacteria 6452
289 Ga0395901_0078076 3300038443 Bacteria 3456
290 Ga0395901_0315130 3300038443 Bacteria 1619
291 Ga0395901_0404837 3300038443 Bacteria 1401
292 Ga0436365_1397186 3300039437 Bacteria 5079
293 Ga0436363_1022311 3300039450 Bacteria 2192
294 Ga0439449_0000395 3300042007 Bacteria 16164
295 Ga0439462_0010577 3300042015 Bacteria 2338
296 Ga0450919_001188 3300042121 Bacteria 3397
297 Ga0450923_003540 3300042125 Bacteria 2371
298 Ga0450904_008137 3300042139 Bacteria 1036
299 Ga0450918_000150 3300042531 Bacteria 15323
300 Ga0451577_0097657 3300042876 Bacteria 2623
301 Ga0466969_0056217 3300044656 Bacteria 1922
302 Ga0453683_0083642 3300044673 Bacteria 2000
303 Ga0466966_0073787 3300044684 Bacteria 2133
304 Ga0466966_0110075 3300044684 Bacteria 1699
305 Ga0466966_0122338 3300044684 Bacteria 1598
306 Ga0466961_0012937 3300044693 Bacteria 5337
307 Ga0453684_0110031 3300044712 Bacteria 3350
308 Ga0466970_0244303 3300044765 Bacteria 1005
309 Ga0466957_0109673 3300044842 Bacteria 1749
310 Ga0466959_0028034 3300045049 Bacteria 4176
311 Ga0466959_0148524 3300045049 Bacteria 1653
312 Ga0451576_0139750 3300045051 Bacteria 2526
313 Ga0466958_0124116 3300045836 Bacteria 1618
314 Ga0466967_0197945 3300045976 Bacteria 1902
315 Ga0495627_025663 3300046453 Bacteria 1908
316 Ga0495592_0000761 3300046454 Bacteria 22421
317 Ga0495590_0052697 3300046457 Bacteria 1421
318 Ga0495590_0070436 3300046457 Bacteria 1226
319 Ga0495650_0014022 3300046471 Bacteria 4200
320 Ga0495620_0104462 3300046515 Bacteria 1127
321 Ga0495632_0005508 3300046519 Bacteria 8351
322 Ga0495642_0010096 3300046528 Bacteria 3616
323 Ga0495621_0031211 3300046539 Bacteria 1826
324 Ga0495597_0023230 3300046542 Bacteria 2870
325 Ga0495625_0036420 3300046660 Bacteria 3617
326 Ga0495669_0030043 3300046684 Bacteria 2385
327 Ga0495649_0001817 3300046694 Bacteria 15673
328 Ga0495649_0056850 3300046694 Bacteria 2111
329 Ga0495660_0025883 3300046810 Bacteria 3330
330 Ga0495687_000915 3300047443 Bacteria 30729
331 Ga0495677_0084611 3300047445 Bacteria 1191
332 Ga0495686_0007071 3300047472 Bacteria 8461
333 Ga0495615_0009159 3300048090 Bacteria 1939
334 Ga0496100_0034939 3300048903 Bacteria 3159
335 Ga0496101_0061535 3300048904 Bacteria 2727
336 Ga0496102_0116184 3300048905 Bacteria 2497
337 Ga0496104_0026313 3300048907 Bacteria 5370
338 Ga0496105_0079820 3300048908 Bacteria 2702
339 Ga0496105_0115223 3300048908 Bacteria 2217
340 Ga0496106_0017146 3300048909 Bacteria 5362
341 Ga0496107_0008109 3300048910 Bacteria 7259
342 Ga0496108_0027013 3300048911 Bacteria 4737
343 Ga0496113_0090598 3300048916 Bacteria 2356
344 Ga0496113_0494945 3300048916 Bacteria 982
345 Ga0496117_0064838 3300048920 Bacteria 2487
346 Ga0496121_0161415 3300048924 Bacteria 1638
347 Ga0496123_0095537 3300048926 Bacteria 1748
348 Ga0501034_0224763 3300049571 Bacteria 1828
349 Ga0501046_0071141 3300049580 Bacteria 2703
350 Ga0501047_0090699 3300049581 Bacteria 2933
351 Ga0501080_0050401 3300049742 Bacteria 3875
352 Ga0501035_0107380 3300049822 Bacteria 2447
353 Ga0501044_0076484 3300049823 Bacteria 3397
354 nmdc:mga03n38_119000_c1 3300050490 Bacteria 1296
355 nmdc:mga0yw44_166652_c1 3300050492 Bacteria 1445
356 nmdc:mga0k408_13199_c1 3300050493 Bacteria 4527
357 nmdc:mga0k408_16155_c1 3300050493 Bacteria 4138
358 nmdc:mga0k408_191417_c1 3300050493 Bacteria 1221
359 nmdc:mga0k408_26935_c1 3300050493 Bacteria 3261
360 nmdc:mga0k408_8187_c1 3300050493 Bacteria 5241
361 nmdc:mga0k408_8445_c1 3300050493 Bacteria 5529
362 nmdc:mga06z11_105105_c1 3300050494 Bacteria 1555
363 nmdc:mga07m45_13542_c1 3300050496 Bacteria 4331
364 nmdc:mga07m45_149_c1 3300050496 Bacteria 28005
365 nmdc:mga07m45_1872_c1 3300050496 Bacteria 9721
366 nmdc:mga07m45_2947_c1 3300050496 Bacteria 8086
367 nmdc:mga07m45_4735_c1 3300050496 Bacteria 6684
368 nmdc:mga07m45_68052_c1 3300050496 Bacteria 2024
369 nmdc:mga0sz30_51560_c1 3300050516 Bacteria 1746
370 Ga0495619_0173316 3300053085 Bacteria 1492
371 Ga0500578_0000011 3300053086 Bacteria 217243
372 Ga0500578_0060375 3300053086 Bacteria 2422
373 Ga0500644_0055918 3300053088 Bacteria 1372
374 Ga0500594_0035984 3300053118 Bacteria 1330
375 Ga0500559_0000014 3300053136 Bacteria 160139
376 Ga0500568_0016434 3300053139 Bacteria 3291
377 Ga0500619_000166 3300053154 Bacteria 16058
378 Ga0500619_085587 3300053154 Bacteria 1062
379 Ga0500622_0006694 3300053156 Bacteria 6640
380 Ga0500636_0036412 3300053177 Bacteria 2913
381 Ga0500587_001800 3300053739 Bacteria 3049
382 Ga0590071_014446 3300059421 Bacteria 1853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_10043410 Ga0207702_100434103 227
2 3300053154 Ga0500619_085587 Ga0500619_085587_21_875 236
3 3300031616 Ga0307508_10029270 Ga0307508_100292704 241
4 3300025920 Ga0207649_10005250 Ga0207649_100052506 244
5 3300005563 Ga0068855_100028947 Ga0068855_1000289478 246
6 3300005719 Ga0068861_100010648 Ga0068861_1000106488 246
7 3300005842 Ga0068858_100183722 Ga0068858_1001837222 246
8 3300017792 Ga0163161_10189982 Ga0163161_101899822 246
9 3300025901 Ga0207688_10005297 Ga0207688_100052974 246
10 3300025907 Ga0207645_10015157 Ga0207645_100151573 246
11 3300025919 Ga0207657_10019615 Ga0207657_100196154 246
12 3300025923 Ga0207681_10006690 Ga0207681_100066902 246
13 3300025927 Ga0207687_10180371 Ga0207687_101803712 246
14 3300025933 Ga0207706_10004996 Ga0207706_100049969 246
15 3300025942 Ga0207689_10000381 Ga0207689_1000038115 246
16 3300025961 Ga0207712_10146674 Ga0207712_101466742 246
17 3300026023 Ga0207677_10001546 Ga0207677_100015466 246
18 3300026035 Ga0207703_10130784 Ga0207703_101307843 246
19 3300026041 Ga0207639_10035273 Ga0207639_100352733 246
20 3300026078 Ga0207702_10013233 Ga0207702_100132335 246
21 3300026088 Ga0207641_10259411 Ga0207641_102594112 246
22 3300026118 Ga0207675_100007955 Ga0207675_1000079555 246
23 3300028380 Ga0268265_10085325 Ga0268265_100853252 246
24 3300037418 Ga0395900_0157737 Ga0395900_0157737_1312_2226 248
25 3300025940 Ga0207691_10124595 Ga0207691_101245952 250
26 3300025303 Ga0209051_1007209 Ga0209051_10072092 257
27 3300025925 Ga0207650_10075880 Ga0207650_100758803 257
28 3300046454 Ga0495592_0000761 Ga0495592_0000761_1700_2617 257
29 3300005355 Ga0070671_100048834 Ga0070671_1000488342 258
30 3300005548 Ga0070665_100012277 Ga0070665_1000122776 258
31 3300005618 Ga0068864_100028890 Ga0068864_1000288903 258
32 3300005841 Ga0068863_100031410 Ga0068863_1000314102 258
33 3300005843 Ga0068860_100226116 Ga0068860_1002261162 258
34 3300009098 Ga0105245_10072848 Ga0105245_100728482 258
35 3300009545 Ga0105237_10256289 Ga0105237_102562892 258
36 3300013296 Ga0157374_10123613 Ga0157374_101236134 258
37 3300014968 Ga0157379_10015699 Ga0157379_100156998 258
38 3300025927 Ga0207687_10062877 Ga0207687_100628772 258
39 3300025931 Ga0207644_10025597 Ga0207644_100255973 258
40 3300026088 Ga0207641_10079711 Ga0207641_100797114 258
41 3300026121 Ga0207683_10440953 Ga0207683_104409531 258
42 3300028379 Ga0268266_10038308 Ga0268266_100383083 258
43 3300030522 Ga0307512_10034593 Ga0307512_100345933 258
44 3300031507 Ga0307509_10007637 Ga0307509_1000763711 258
45 3300031838 Ga0307518_10082343 Ga0307518_100823432 258
46 3300033180 Ga0307510_10006149 Ga0307510_100061494 258
47 3300003316 rootH1_10013735 rootH1_100137352 259
48 3300003323 rootH1_10021821 rootH1_100218217 259
49 3300003752 Ga0055539_1000465 Ga0055539_10004653 259
50 3300003756 Ga0055533_1000024 Ga0055533_1000024126 259
51 3300003759 Ga0055525_1000985 Ga0055525_10009856 259
52 3300025226 Ga0209674_100007 Ga0209674_100007171 259
53 3300025230 Ga0209563_100060 Ga0209563_10006098 259
54 3300025253 Ga0209677_100088 Ga0209677_10008882 259
55 3300006178 Ga0075367_10018086 Ga0075367_100180863 260
56 3300026089 Ga0207648_10181729 Ga0207648_101817292 260
57 3300005329 Ga0070683_100531860 Ga0070683_1005318601 262
58 3300005335 Ga0070666_10124245 Ga0070666_101242452 262
59 3300005356 Ga0070674_100291872 Ga0070674_1002918722 262
60 3300005367 Ga0070667_100010167 Ga0070667_1000101677 262
61 3300005459 Ga0068867_100254644 Ga0068867_1002546442 262
62 3300005539 Ga0068853_100043732 Ga0068853_1000437323 262
63 3300005617 Ga0068859_100083382 Ga0068859_1000833822 262
64 3300005842 Ga0068858_100011322 Ga0068858_1000113224 262
65 3300006931 Ga0097620_100083378 Ga0097620_1000833782 262
66 3300014968 Ga0157379_10002433 Ga0157379_1000243311 262
67 3300025932 Ga0207690_10230911 Ga0207690_102309112 262
68 3300025937 Ga0207669_10308821 Ga0207669_103088212 262
69 3300025938 Ga0207704_10035251 Ga0207704_100352513 262
70 3300031507 Ga0307509_10002567 Ga0307509_1000256717 263
71 3300053088 Ga0500644_0055918 Ga0500644_0055918_386_1303 263
72 3300053136 Ga0500559_0000014 Ga0500559_0000014_61013_61930 263
73 3300053177 Ga0500636_0036412 Ga0500636_0036412_126_1043 263
74 3300053739 Ga0500587_001800 Ga0500587_001800_2002_2919 263
75 3300003316 rootH1_10013718 rootH1_100137182 264
76 3300005330 Ga0070690_100010756 Ga0070690_1000107565 264
77 3300005339 Ga0070660_100135799 Ga0070660_1001357992 264
78 3300025939 Ga0207665_10094281 Ga0207665_100942812 264
79 3300042139 Ga0450904_008137 Ga0450904_008137_103_1008 264
80 3300006353 Ga0075370_10117059 Ga0075370_101170592 265
81 3300006358 Ga0068871_100017300 Ga0068871_1000173003 265
82 3300025899 Ga0207642_10189469 Ga0207642_101894692 265
83 3300050496 nmdc:mga07m45_68052_c1 nmdc:mga07m45_68052_c1_893_1825 265
84 3300053118 Ga0500594_0035984 Ga0500594_0035984_35_952 265
85 3300053156 Ga0500622_0006694 Ga0500622_0006694_2459_3376 265
86 3300009545 Ga0105237_10059668 Ga0105237_100596682 267
87 3300028794 Ga0307515_10061619 Ga0307515_100616193 267
88 3300042876 Ga0451577_0097657 Ga0451577_0097657_922_1815 267
89 3300046694 Ga0495649_0056850 Ga0495649_0056850_319_1251 267
90 3300053085 Ga0495619_0173316 Ga0495619_0173316_35_934 267
91 3300031507 Ga0307509_10004470 Ga0307509_100044709 268
92 3300031730 Ga0307516_10017059 Ga0307516_100170594 268
93 3300047472 Ga0495686_0007071 Ga0495686_0007071_5892_6821 268
94 3300031616 Ga0307508_10040034 Ga0307508_100400343 269
95 3300048909 Ga0496106_0017146 Ga0496106_0017146_3871_4704 269
96 3300053139 Ga0500568_0016434 Ga0500568_0016434_41_973 269
97 3300006048 Ga0075363_100017695 Ga0075363_1000176952 270
98 3300006177 Ga0075362_10001325 Ga0075362_100013256 270
99 3300006353 Ga0075370_10032192 Ga0075370_100321922 270
100 3300021384 Ga0213876_10045713 Ga0213876_100457132 270
101 3300026116 Ga0207674_10296285 Ga0207674_102962852 270
102 3300039437 Ga0436365_1397186 Ga0436365_1397186_906_1844 270
103 3300050490 nmdc:mga03n38_119000_c1 nmdc:mga03n38_119000_c1_309_1226 270
104 3300050493 nmdc:mga0k408_8445_c1 nmdc:mga0k408_8445_c1_3952_4869 270
105 3300050496 nmdc:mga07m45_1872_c1 nmdc:mga07m45_1872_c1_953_1870 270
106 3300050516 nmdc:mga0sz30_51560_c1 nmdc:mga0sz30_51560_c1_800_1717 270
107 3300025949 Ga0207667_10008091 Ga0207667_100080912 271
108 3300033180 Ga0307510_10085073 Ga0307510_100850733 271
109 3300037312 Ga0395899_0066770 Ga0395899_0066770_742_1611 271
110 3300038443 Ga0395901_0404837 Ga0395901_0404837_260_1129 271
111 3300031456 Ga0307513_10197272 Ga0307513_101972722 272
112 3300037471 Ga0395905_0098432 Ga0395905_0098432_1638_2570 272
113 3300053086 Ga0500578_0060375 Ga0500578_0060375_1254_2108 272
114 3300006195 Ga0075366_10068225 Ga0075366_100682252 273
115 3300006353 Ga0075370_10000264 Ga0075370_1000026416 273
116 3300009177 Ga0105248_10043244 Ga0105248_100432442 273
117 3300050493 nmdc:mga0k408_16155_c1 nmdc:mga0k408_16155_c1_357_1289 273
118 3300050496 nmdc:mga07m45_149_c1 nmdc:mga07m45_149_c1_21268_22200 273
119 3300045976 Ga0466967_0197945 Ga0466967_0197945_875_1816 274
120 3300053154 Ga0500619_000166 Ga0500619_000166_13784_14701 274
121 3300005328 Ga0070676_10018282 Ga0070676_100182824 275
122 3300005334 Ga0068869_100003632 Ga0068869_1000036328 275
123 3300005338 Ga0068868_100006601 Ga0068868_10000660110 275
124 3300005353 Ga0070669_100166869 Ga0070669_1001668692 275
125 3300005354 Ga0070675_100041841 Ga0070675_1000418414 275
126 3300005355 Ga0070671_100051521 Ga0070671_1000515213 275
127 3300005457 Ga0070662_100008550 Ga0070662_1000085503 275
128 3300005618 Ga0068864_100303058 Ga0068864_1003030582 275
129 3300006195 Ga0075366_10017042 Ga0075366_100170424 275
130 3300009174 Ga0105241_10297215 Ga0105241_102972152 275
131 3300009553 Ga0105249_10242455 Ga0105249_102424552 275
132 3300013306 Ga0163162_10009634 Ga0163162_100096344 275
133 3300014745 Ga0157377_10001366 Ga0157377_100013664 275
134 3300014968 Ga0157379_10051122 Ga0157379_100511223 275
135 3300014969 Ga0157376_10019939 Ga0157376_100199394 275
136 3300035092 Ga0373952_0006949 Ga0373952_0006949_476_1417 275
137 3300035121 Ga0373960_0065666 Ga0373960_0065666_52_993 275
138 3300035691 Ga0373931_0001119 Ga0373931_0001119_6894_7835 275
139 3300048903 Ga0496100_0034939 Ga0496100_0034939_706_1647 275
140 3300048904 Ga0496101_0061535 Ga0496101_0061535_1748_2689 275
141 3300048905 Ga0496102_0116184 Ga0496102_0116184_330_1271 275
142 3300048908 Ga0496105_0115223 Ga0496105_0115223_30_971 275
143 3300048910 Ga0496107_0008109 Ga0496107_0008109_3524_4465 275
144 3300048911 Ga0496108_0027013 Ga0496108_0027013_2872_3813 275
145 3300048916 Ga0496113_0090598 Ga0496113_0090598_1236_2177 275
146 3300050493 nmdc:mga0k408_8187_c1 nmdc:mga0k408_8187_c1_1381_2298 275
147 3300005455 Ga0070663_100266271 Ga0070663_1002662712 276
148 3300005459 Ga0068867_100013416 Ga0068867_1000134163 276
149 3300005543 Ga0070672_100011944 Ga0070672_1000119443 276
150 3300005719 Ga0068861_100002195 Ga0068861_10000219513 276
151 3300005842 Ga0068858_100017363 Ga0068858_1000173634 276
152 3300005843 Ga0068860_100087299 Ga0068860_1000872992 276
153 3300005843 Ga0068860_100407013 Ga0068860_1004070132 276
154 3300005844 Ga0068862_100023975 Ga0068862_1000239753 276
155 3300006881 Ga0068865_100002804 Ga0068865_1000028043 276
156 3300009553 Ga0105249_10020590 Ga0105249_100205903 276
157 3300013297 Ga0157378_10003993 Ga0157378_100039937 276
158 3300013306 Ga0163162_10008661 Ga0163162_100086615 276
159 3300013308 Ga0157375_10061805 Ga0157375_100618053 276
160 3300014326 Ga0157380_10018554 Ga0157380_100185543 276
161 3300015262 Ga0182007_10041389 Ga0182007_100413892 276
162 3300025923 Ga0207681_10045330 Ga0207681_100453302 276
163 3300025937 Ga0207669_10025153 Ga0207669_100251533 276
164 3300025938 Ga0207704_10042057 Ga0207704_100420572 276
165 3300025940 Ga0207691_10018881 Ga0207691_100188814 276
166 3300025961 Ga0207712_10014556 Ga0207712_100145563 276
167 3300025986 Ga0207658_10069777 Ga0207658_100697772 276
168 3300026035 Ga0207703_10326332 Ga0207703_103263321 276
169 3300026089 Ga0207648_10066693 Ga0207648_100666933 276
170 3300026118 Ga0207675_100001673 Ga0207675_10000167316 276
171 3300028380 Ga0268265_10124363 Ga0268265_101243632 276
172 3300028381 Ga0268264_10051626 Ga0268264_100516262 276
173 3300028381 Ga0268264_10170403 Ga0268264_101704032 276
174 3300037312 Ga0395899_0047545 Ga0395899_0047545_458_1420 276
175 3300037418 Ga0395900_0007905 Ga0395900_0007905_7087_8049 276
176 3300037466 Ga0395898_0003019 Ga0395898_0003019_9399_10361 276
177 3300037471 Ga0395905_0007893 Ga0395905_0007893_944_1906 276
178 3300038443 Ga0395901_0022560 Ga0395901_0022560_3597_4559 276
179 3300009093 Ga0105240_10092444 Ga0105240_100924444 277
180 3300009545 Ga0105237_10005095 Ga0105237_1000509511 277
181 3300009551 Ga0105238_10032234 Ga0105238_100322347 277
182 3300010375 Ga0105239_10000486 Ga0105239_1000048639 277
183 3300025913 Ga0207695_10067376 Ga0207695_100673763 277
184 3300025914 Ga0207671_10015218 Ga0207671_100152182 277
185 3300025924 Ga0207694_10024519 Ga0207694_100245192 277
186 3300025924 Ga0207694_10155507 Ga0207694_101555071 277
187 3300039450 Ga0436363_1022311 Ga0436363_1022311_1017_1955 277
188 3300009551 Ga0105238_10390953 Ga0105238_103909532 278
189 iso_pu_bacteria 2643221660 2644338747 278
190 3300005262 Ga0065165_1003088 Ga0065165_10030887 279
191 3300005338 Ga0068868_100544785 Ga0068868_1005447851 279
192 3300005577 Ga0068857_100163295 Ga0068857_1001632951 279
193 3300005578 Ga0068854_100233271 Ga0068854_1002332712 279
194 3300005616 Ga0068852_100186411 Ga0068852_1001864112 279
195 3300006178 Ga0075367_10026447 Ga0075367_100264472 279
196 3300025913 Ga0207695_10063912 Ga0207695_100639122 279
197 3300025914 Ga0207671_10026887 Ga0207671_100268873 279
198 3300025932 Ga0207690_10078270 Ga0207690_100782702 279
199 3300025938 Ga0207704_10400511 Ga0207704_104005112 279
200 3300026023 Ga0207677_10086284 Ga0207677_100862842 279
201 3300026116 Ga0207674_10185015 Ga0207674_101850153 279
202 3300026142 Ga0207698_10055703 Ga0207698_100557032 279
203 3300037471 Ga0395905_0431947 Ga0395905_0431947_143_1039 279
204 3300050493 nmdc:mga0k408_191417_c1 nmdc:mga0k408_191417_c1_51_953 279
205 3300050496 nmdc:mga07m45_2947_c1 nmdc:mga07m45_2947_c1_2812_3714 279
206 3300005327 Ga0070658_10033922 Ga0070658_100339222 280
207 3300025909 Ga0207705_10021379 Ga0207705_100213792 280
208 3300028666 Ga0265336_10000039 Ga0265336_1000003928 280
209 3300028794 Ga0307515_10000026 Ga0307515_1000002663 280
210 3300029957 Ga0265324_10005627 Ga0265324_100056275 280
211 3300042121 Ga0450919_001188 Ga0450919_001188_485_1414 280
212 3300042125 Ga0450923_003540 Ga0450923_003540_1309_2238 280
213 3300042531 Ga0450918_000150 Ga0450918_000150_10897_11826 280
214 3300006353 Ga0075370_10106231 Ga0075370_101062312 281
215 3300028794 Ga0307515_10000132 Ga0307515_1000013293 282
216 3300032002 Ga0307416_100214566 Ga0307416_1002145662 282
217 3300006353 Ga0075370_10006198 Ga0075370_100061983 283
218 3300028786 Ga0307517_10216366 Ga0307517_102163661 283
219 3300044712 Ga0453684_0110031 Ga0453684_0110031_2295_3161 283
220 3300046457 Ga0495590_0052697 Ga0495590_0052697_143_1060 283
221 3300046515 Ga0495620_0104462 Ga0495620_0104462_23_940 283
222 3300046519 Ga0495632_0005508 Ga0495632_0005508_4721_5638 283
223 3300046660 Ga0495625_0036420 Ga0495625_0036420_96_1037 283
224 3300046694 Ga0495649_0001817 Ga0495649_0001817_11605_12522 283
225 3300046810 Ga0495660_0025883 Ga0495660_0025883_641_1558 283
226 3300009093 Ga0105240_10113377 Ga0105240_101133772 284
227 3300009545 Ga0105237_10006644 Ga0105237_100066442 284
228 3300010375 Ga0105239_10148905 Ga0105239_101489054 284
229 3300046542 Ga0495597_0023230 Ga0495597_0023230_1644_2561 284
230 3300047443 Ga0495687_000915 Ga0495687_000915_18197_19114 284
231 3300005327 Ga0070658_10117122 Ga0070658_101171222 285
232 3300005331 Ga0070670_100164644 Ga0070670_1001646441 285
233 3300025925 Ga0207650_10132711 Ga0207650_101327112 285
234 3300025934 Ga0207686_10060615 Ga0207686_100606152 285
235 3300025937 Ga0207669_10085831 Ga0207669_100858312 285
236 3300028794 Ga0307515_10027002 Ga0307515_100270024 285
237 3300044684 Ga0466966_0073787 Ga0466966_0073787_785_1654 285
238 3300044693 Ga0466961_0012937 Ga0466961_0012937_3787_4656 285
239 3300044765 Ga0466970_0244303 Ga0466970_0244303_123_992 285
240 3300045049 Ga0466959_0148524 Ga0466959_0148524_121_990 285
241 3300053086 Ga0500578_0000011 Ga0500578_0000011_11208_12122 285
242 3300006353 Ga0075370_10030474 Ga0075370_100304742 286
243 3300006358 Ga0068871_100367729 Ga0068871_1003677292 286
244 3300009174 Ga0105241_10584604 Ga0105241_105846041 286
245 3300028794 Ga0307515_10139294 Ga0307515_101392942 286
246 3300050496 nmdc:mga07m45_13542_c1 nmdc:mga07m45_13542_c1_603_1520 286
247 3300003322 rootL2_10028669 rootL2_100286692 287
248 3300003791 Ga0055530_10018130 Ga0055530_100181303 287
249 3300009553 Ga0105249_10314567 Ga0105249_103145672 287
250 3300025298 Ga0209050_1000268 Ga0209050_100026836 287
251 3300045051 Ga0451576_0139750 Ga0451576_0139750_384_1271 287
252 3300003773 Ga0055537_1000599 Ga0055537_100059914 288
253 3300003784 Ga0055534_1000016 Ga0055534_100001614 288
254 3300003790 Ga0055528_1000144 Ga0055528_10001446 288
255 3300006353 Ga0075370_10007969 Ga0075370_100079692 288
256 3300006844 Ga0075428_100312860 Ga0075428_1003128602 288
257 3300006948 Ga0099826_10007552 Ga0099826_100075526 288
258 3300025263 Ga0209565_1000046 Ga0209565_1000046181 288
259 3300025273 Ga0209673_1000058 Ga0209673_100005887 288
260 3300025291 Ga0209675_1000010 Ga0209675_1000010178 288
261 3300037471 Ga0395905_0447522 Ga0395905_0447522_222_1130 288
262 3300050496 nmdc:mga07m45_4735_c1 nmdc:mga07m45_4735_c1_1222_2172 288
263 3300005843 Ga0068860_100139376 Ga0068860_1001393762 289
264 3300009101 Ga0105247_10153879 Ga0105247_101538791 289
265 3300014968 Ga0157379_10150558 Ga0157379_101505581 289
266 3300026088 Ga0207641_10202796 Ga0207641_102027962 289
267 3300047445 Ga0495677_0084611 Ga0495677_0084611_24_929 289
268 3300026121 Ga0207683_10019535 Ga0207683_100195353 290
269 3300045049 Ga0466959_0028034 Ga0466959_0028034_438_1355 290
270 3300045836 Ga0466958_0124116 Ga0466958_0124116_657_1574 290
271 3300005366 Ga0070659_100245449 Ga0070659_1002454492 291
272 3300026088 Ga0207641_10076200 Ga0207641_100762002 291
273 3300037312 Ga0395899_0153499 Ga0395899_0153499_64_987 291
274 3300037471 Ga0395905_0179537 Ga0395905_0179537_774_1697 291
275 3300003215 JGI25153J46596_10004449 JGI25153J46596_100044496 294
276 3300005331 Ga0070670_100107980 Ga0070670_1001079802 294
277 3300005354 Ga0070675_100109339 Ga0070675_1001093392 294
278 3300005367 Ga0070667_100165548 Ga0070667_1001655482 294
279 3300005457 Ga0070662_100249388 Ga0070662_1002493882 294
280 3300005539 Ga0068853_100433507 Ga0068853_1004335071 294
281 3300005543 Ga0070672_100349708 Ga0070672_1003497081 294
282 3300025297 Ga0209758_1000232 Ga0209758_10002322 294
283 3300025919 Ga0207657_10228258 Ga0207657_102282582 294
284 3300025933 Ga0207706_10323547 Ga0207706_103235472 294
285 3300025986 Ga0207658_10144984 Ga0207658_101449842 294
286 3300026067 Ga0207678_10046359 Ga0207678_100463593 294
287 3300031731 Ga0307405_10107307 Ga0307405_101073071 294
288 3300027378 Ga0209981_1006918 Ga0209981_10069182 295
289 3300027471 Ga0209995_1000740 Ga0209995_10007403 295
290 3300027526 Ga0209968_1000277 Ga0209968_10002777 295
291 3300027543 Ga0209999_1018504 Ga0209999_10185042 295
292 3300027695 Ga0209966_1000039 Ga0209966_100003952 295
293 3300006051 Ga0075364_10063647 Ga0075364_100636473 296
294 3300006195 Ga0075366_10004248 Ga0075366_100042482 296
295 3300014969 Ga0157376_10266716 Ga0157376_102667162 296
296 3300050493 nmdc:mga0k408_13199_c1 nmdc:mga0k408_13199_c1_659_1561 296
297 3300050494 nmdc:mga06z11_105105_c1 nmdc:mga06z11_105105_c1_42_944 296
298 3300005338 Ga0068868_100344686 Ga0068868_1003446861 297
299 3300005718 Ga0068866_10164541 Ga0068866_101645411 297
300 3300005842 Ga0068858_100072660 Ga0068858_1000726603 297
301 3300009176 Ga0105242_10004482 Ga0105242_1000448214 297
302 3300009177 Ga0105248_10075478 Ga0105248_100754783 297
303 3300009551 Ga0105238_10756047 Ga0105238_107560471 297
304 3300013306 Ga0163162_10061417 Ga0163162_100614173 297
305 3300014968 Ga0157379_10022529 Ga0157379_100225293 297
306 3300025924 Ga0207694_10085725 Ga0207694_100857252 297
307 3300025934 Ga0207686_10041325 Ga0207686_100413252 297
308 3300025941 Ga0207711_10299307 Ga0207711_102993071 297
309 3300031548 Ga0307408_100210098 Ga0307408_1002100982 297
310 3300032002 Ga0307416_100263229 Ga0307416_1002632292 297
311 3300042007 Ga0439449_0000395 Ga0439449_0000395_2302_3237 297
312 3300042015 Ga0439462_0010577 Ga0439462_0010577_245_1180 297
313 3300005295 Ga0065707_10083342 Ga0065707_100833429 298
314 3300006195 Ga0075366_10197036 Ga0075366_101970362 298
315 3300025909 Ga0207705_10077083 Ga0207705_100770832 298
316 3300037471 Ga0395905_0013295 Ga0395905_0013295_3527_4453 298
317 3300046528 Ga0495642_0010096 Ga0495642_0010096_2281_3198 298
318 3300046684 Ga0495669_0030043 Ga0495669_0030043_479_1396 298
319 3300049571 Ga0501034_0224763 Ga0501034_0224763_391_1287 298
320 3300049580 Ga0501046_0071141 Ga0501046_0071141_448_1344 298
321 3300049581 Ga0501047_0090699 Ga0501047_0090699_1676_2572 298
322 3300049742 Ga0501080_0050401 Ga0501080_0050401_2488_3384 298
323 3300049823 Ga0501044_0076484 Ga0501044_0076484_114_1010 298
324 3300050492 nmdc:mga0yw44_166652_c1 nmdc:mga0yw44_166652_c1_386_1282 298
325 3300005530 Ga0070679_100152415 Ga0070679_1001524152 299
326 3300025908 Ga0207643_10152850 Ga0207643_101528502 299
327 3300031235 Ga0265330_10014250 Ga0265330_100142502 299
328 3300031238 Ga0265332_10015924 Ga0265332_100159243 299
329 3300031711 Ga0265314_10003400 Ga0265314_1000340013 299
330 3300037418 Ga0395900_0214515 Ga0395900_0214515_388_1296 299
331 3300038443 Ga0395901_0315130 Ga0395901_0315130_91_999 299
332 3300044656 Ga0466969_0056217 Ga0466969_0056217_914_1819 299
333 3300044673 Ga0453683_0083642 Ga0453683_0083642_544_1446 299
334 3300044842 Ga0466957_0109673 Ga0466957_0109673_628_1575 299
335 3300031507 Ga0307509_10108219 Ga0307509_101082192 300
336 3300044684 Ga0466966_0110075 Ga0466966_0110075_469_1419 300
337 3300048916 Ga0496113_0494945 Ga0496113_0494945_17_931 300
338 3300005548 Ga0070665_100203595 Ga0070665_1002035952 301
339 3300037471 Ga0395905_0196405 Ga0395905_0196405_164_1072 301
340 3300035170 Ga0373943_0162164 Ga0373943_0162164_19_927 302
341 3300044684 Ga0466966_0122338 Ga0466966_0122338_124_1038 302
342 3300048907 Ga0496104_0026313 Ga0496104_0026313_809_1717 302
343 3300048908 Ga0496105_0079820 Ga0496105_0079820_363_1271 302
344 3300028786 Ga0307517_10055621 Ga0307517_100556216 303
345 3300031730 Ga0307516_10001731 Ga0307516_1000173113 303
346 3300046453 Ga0495627_025663 Ga0495627_025663_579_1526 303
347 3300046457 Ga0495590_0070436 Ga0495590_0070436_228_1139 303
348 3300048090 Ga0495615_0009159 Ga0495615_0009159_687_1625 303
349 3300050493 nmdc:mga0k408_26935_c1 nmdc:mga0k408_26935_c1_1462_2373 303
350 3300059421 Ga0590071_014446 Ga0590071_014446_74_1000 303
351 3300003781 Ga0055536_1000931 Ga0055536_10009312 304
352 3300003792 Ga0055540_1006832 Ga0055540_10068324 304
353 3300009148 Ga0105243_10110978 Ga0105243_101109782 304
354 3300025291 Ga0209675_1002779 Ga0209675_10027795 304
355 3300025292 Ga0209676_1001118 Ga0209676_10011186 304
356 3300025298 Ga0209050_1018379 Ga0209050_10183792 304
357 3300025303 Ga0209051_1000452 Ga0209051_10004526 304
358 3300025304 Ga0209257_1006788 Ga0209257_10067886 304
359 3300025935 Ga0207709_10000518 Ga0207709_1000051826 304
360 3300031548 Ga0307408_100035974 Ga0307408_1000359744 304
361 3300031548 Ga0307408_100136531 Ga0307408_1001365312 304
362 3300031731 Ga0307405_10124589 Ga0307405_101245892 304
363 3300031901 Ga0307406_10000905 Ga0307406_1000090514 304
364 3300037418 Ga0395900_0113108 Ga0395900_0113108_1493_2446 304
365 3300046471 Ga0495650_0014022 Ga0495650_0014022_3000_3917 304
366 3300048920 Ga0496117_0064838 Ga0496117_0064838_331_1278 304
367 3300048924 Ga0496121_0161415 Ga0496121_0161415_405_1352 304
368 3300048926 Ga0496123_0095537 Ga0496123_0095537_95_1042 304
369 3300005334 Ga0068869_100245162 Ga0068869_1002451622 305
370 3300005338 Ga0068868_100028448 Ga0068868_1000284481 305
371 3300025942 Ga0207689_10241212 Ga0207689_102412122 305
372 3300025949 Ga0207667_10323329 Ga0207667_103233292 305
373 3300026078 Ga0207702_10074330 Ga0207702_100743302 305
374 3300046539 Ga0495621_0031211 Ga0495621_0031211_397_1383 305
375 3300005353 Ga0070669_100008890 Ga0070669_1000088904 306
376 3300014326 Ga0157380_10297808 Ga0157380_102978081 306
377 3300017792 Ga0163161_10238006 Ga0163161_102380062 306
378 3300037418 Ga0395900_0017566 Ga0395900_0017566_2374_3327 312
379 3300037466 Ga0395898_0032162 Ga0395898_0032162_3973_4926 312
380 3300038443 Ga0395901_0078076 Ga0395901_0078076_731_1684 312
381 3300049822 Ga0501035_0107380 Ga0501035_0107380_880_1827 312
382 3300002987 JGI25159J45721_1017808 JGI25159J45721_10178082 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

41

178

0.96

PF00892

EamA

EamA-like transporter family

189

327

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7635 26 316
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7307 26 316
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7138 31 313
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7073 31 313
7b0k-assembly1.cif.gz_A membrane protein structure 0.7007 27 313
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.909 35 315 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8166 35 315 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7788 26 316 1.20.1740.10
af_G4S7C7_57_179_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7238 234 313 1.10.3730.20
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7218 26 316 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A0Q8R9N4-F1-model_v4 EamA domain-containing protein 0.9572 23 317 GO:0016020
AF-A0A0B2UH77-F1-model_v4 Transporter 0.951 63 314 GO:0005886
AF-A0A840FWJ5-F1-model_v4 Drug/metabolite transporter (DMT)-like permease 0.9459 21 318 GO:0005886
AF-A0A2M8YE91-F1-model_v4 Drug/metabolite transporter (DMT)-like permease 0.9455 9 315 GO:0005886
AF-A0A2N6EBM7-F1-model_v4 EamA family transporter 0.9359 86 317 GO:0005886

Feature Viewer

pLDDT pTM Quality
84.41 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map