F429281

General Info

Members Datasets Scaffolds Average Seq Length
382 180 764 177

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10044866|Ga0213872_100448661
Length 187
Sequence MNKRMNPLINRARPLALVVPLLLAGCGDSDVQEVRAWMKLTDSQAQVAVQPLSEPKTFIPFAYASADAIDPFNPNKLLAELARAARASGKGLKPDLDRPKEQLEAFPLDTIKMVGSLQKGSQIFAQLQIDRSYYQVKTGQHIGQNFGLITSVTENSVSIKEIVQDASGDWVERMSKLELQESKETTK

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
29 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
30 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
31 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
32 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
33 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
34 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
35 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
51 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
52 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
53 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
56 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
57 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
67 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
71 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
72 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
75 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
81 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
82 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
83 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
89 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
90 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
91 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
92 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
120 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
124 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
151 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
155 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
156 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
157 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
158 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
161 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
162 2643221638 Duganella sp. Root336D2 Isolate Unclassified
163 2643221645 Massilia sp. Root351 Isolate Unclassified
164 2643221664 Massilia sp. Root418 Isolate Unclassified
165 2738541280 Massilia sp. GV090 Isolate Unclassified
166 2738541297 Duganella sp. GV083 Isolate Unclassified
167 2738541300 Massilia sp. GV016 Isolate Unclassified
168 2738541357 Duganella sp. GV053 Isolate Unclassified
169 2738543003 Duganella sp. GV066 Isolate Unclassified
170 2738543018 Massilia sp. GV045 Isolate Unclassified
171 2738543026 Duganella sp. GV089 Isolate Unclassified
172 2738543029 Duganella sp. GV039 Isolate Unclassified
173 2738543030 Massilia sp. GV097 Isolate Unclassified
174 2821131069 Duganella sp. 1224 Isolate Unclassified
175 2842711865 Duganella sp. R-73148 Isolate Unclassified
176 2857553236 Duganella sp. R-74557 Isolate Unclassified
177 2857558681 Duganella sp. R-74565 Isolate Unclassified
178 2857564685 Duganella sp. R-74599 Isolate Unclassified
179 2904424332 Duganella sp. 1411 Isolate Rhizosphere
180 2919476304 Duganella sp. 3397 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.67
Metatranscriptomes 2.09
Isolates 5.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.9
Nodule 0.79
Rhizoplane 1.05
Rhizosphere 67.54
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10044866 3300021361 Bacteria 2011
2 JGI25154J39366_1002311 3300002738 Bacteria 5097
3 JGI25158J39367_1004283 3300002739 Bacteria 2149
4 JGI25152J39213_1000224 3300002773 Bacteria 38367
5 JGI25152J39213_1030272 3300002773 Bacteria 843
6 JGI25150J39212_1000695 3300002774 Bacteria 12175
7 JGI25150J39212_1003218 3300002774 Bacteria 3864
8 JGI25150J39212_1022086 3300002774 Bacteria 960
9 JGI25159J45721_1000892 3300002987 Bacteria 12977
10 JGI25151J46595_10109159 3300003187 Bacteria 727
11 JGI25153J46596_10002862 3300003215 Bacteria 9802
12 JGI25153J46596_10014209 3300003215 Bacteria 3323
13 rootH2_10106881 3300003320 Bacteria 2122
14 rootL2_10043261 3300003322 Bacteria 4959
15 rootL2_10117747 3300003322 Bacteria 2951
16 JGI25160J50197_1004010 3300003354 Bacteria 6424
17 JGI25161J50226_1004038 3300003374 Bacteria 3168
18 Ga0055529_1000079 3300003763 Bacteria 149370
19 Ga0055526_1000228 3300003771 Bacteria 47559
20 Ga0055526_1000337 3300003771 Bacteria 38516
21 Ga0055526_1000651 3300003771 Bacteria 26844
22 Ga0055526_1009451 3300003771 Bacteria 4684
23 Ga0055537_1000038 3300003773 Bacteria 92762
24 Ga0055537_1008149 3300003773 Bacteria 2447
25 Ga0055524_1000024 3300003775 Bacteria 217953
26 Ga0055524_1001031 3300003775 Bacteria 17211
27 Ga0055524_1013018 3300003775 Bacteria 3162
28 Ga0055524_1038195 3300003775 Bacteria 1260
29 Ga0055534_1000074 3300003784 Bacteria 77272
30 Ga0055534_1001588 3300003784 Bacteria 8816
31 Ga0055528_1000231 3300003790 Bacteria 46568
32 Ga0055528_1001043 3300003790 Bacteria 18281
33 Ga0055543_1006902 3300004625 Bacteria 2686
34 Ga0065165_1000504 3300005262 Bacteria 60378
35 Ga0065165_1050750 3300005262 Bacteria 1180
36 Ga0065715_10030871 3300005293 Bacteria 1725
37 Ga0068869_100286311 3300005334 Bacteria 1326
38 Ga0070682_101122185 3300005337 Bacteria 659
39 Ga0068867_101198689 3300005459 Bacteria 697
40 Ga0099826_10000010 3300006948 Bacteria 314346
41 Ga0105244_10000158 3300009036 Bacteria 70253
42 Ga0105244_10003379 3300009036 Bacteria 11424
43 Ga0105248_10533713 3300009177 Bacteria 1323
44 Ga0182006_1000141 3300015261 Bacteria 77478
45 Ga0182005_1000016 3300015265 Bacteria 346889
46 Ga0213872_10000005 3300021361 Bacteria 290165
47 Ga0213872_10000541 3300021361 Bacteria 29407
48 Ga0213872_10002380 3300021361 Bacteria 11120
49 Ga0213872_10060394 3300021361 Bacteria 1714
50 Ga0209436_100928 3300025208 Bacteria 11575
51 Ga0209436_110096 3300025208 Bacteria 1748
52 Ga0207425_1000021 3300025245 Bacteria 367537
53 Ga0207425_1000223 3300025245 Bacteria 44555
54 Ga0207425_1000640 3300025245 Bacteria 19664
55 Ga0207425_1012715 3300025245 Bacteria 1963
56 Ga0209646_1000068 3300025246 Bacteria 233765
57 Ga0209129_1000020 3300025258 Bacteria 457053
58 Ga0209129_1004870 3300025258 Bacteria 5021
59 Ga0209129_1022167 3300025258 Bacteria 1152
60 Ga0209233_1040856 3300025261 Bacteria 1006
61 Ga0209565_1000123 3300025263 Bacteria 111069
62 Ga0209565_1001882 3300025263 Bacteria 8324
63 Ga0209565_1006129 3300025263 Bacteria 3413
64 Ga0209565_1006737 3300025263 Bacteria 3185
65 Ga0209565_1007111 3300025263 Bacteria 3054
66 Ga0209565_1013406 3300025263 Bacteria 1919
67 Ga0209455_1000070 3300025272 Bacteria 307867
68 Ga0209673_1000040 3300025273 Bacteria 312633
69 Ga0209673_1002575 3300025273 Bacteria 12297
70 Ga0209130_1000290 3300025284 Bacteria 61271
71 Ga0209130_1007638 3300025284 Bacteria 3307
72 Ga0209675_1000117 3300025291 Bacteria 111087
73 Ga0209675_1000650 3300025291 Bacteria 24546
74 Ga0209675_1003691 3300025291 Bacteria 7143
75 Ga0209025_1058436 3300025294 Bacteria 1465
76 Ga0209564_1000027 3300025295 Bacteria 518458
77 Ga0209564_1000047 3300025295 Bacteria 368031
78 Ga0209564_1000121 3300025295 Bacteria 204081
79 Ga0209564_1000780 3300025295 Bacteria 44199
80 Ga0209564_1006698 3300025295 Bacteria 6124
81 Ga0209564_1011409 3300025295 Bacteria 3984
82 Ga0209758_1000077 3300025297 Bacteria 268195
83 Ga0209758_1000322 3300025297 Bacteria 92458
84 Ga0209050_1000050 3300025298 Bacteria 362578
85 Ga0209050_1000795 3300025298 Bacteria 44648
86 Ga0209256_1000054 3300025299 Bacteria 298431
87 Ga0209256_1000288 3300025299 Bacteria 88470
88 Ga0209256_1000674 3300025299 Bacteria 46225
89 Ga0209256_1001001 3300025299 Bacteria 33573
90 Ga0209256_1002870 3300025299 Bacteria 13096
91 Ga0207426_1004227 3300025302 Bacteria 7136
92 Ga0209051_1025401 3300025303 Bacteria 2412
93 Ga0209257_1000075 3300025304 Bacteria 324855
94 Ga0207655_1000710 3300025728 Bacteria 38274
95 Ga0207655_1013418 3300025728 Bacteria 4706
96 Ga0207648_11061836 3300026089 Bacteria 759
97 Ga0209281_1002515 3300027111 Bacteria 7212
98 Ga0209282_1000072 3300027666 Bacteria 81137
99 Ga0265337_1070525 3300028556 Bacteria 961
100 Ga0265336_10000272 3300028666 Bacteria 36231
101 Ga0265336_10038807 3300028666 Bacteria 1461
102 Ga0265338_10027334 3300028800 Bacteria 5727
103 Ga0265324_10000004 3300029957 Bacteria 356972
104 Ga0265324_10001557 3300029957 Bacteria 12848
105 Ga0316181_1030715 3300030744 Bacteria 1369
106 Ga0316182_1083480 3300030745 Bacteria 1248
107 Ga0316182_1257485 3300030745 Bacteria 845
108 Ga0265325_10002699 3300031241 Bacteria 11862
109 Ga0265331_10029158 3300031250 Bacteria 2756
110 Ga0265316_10287757 3300031344 Unclassified 1200
111 Ga0307408_100000531 3300031548 Bacteria 32967
112 Ga0307408_100001492 3300031548 Bacteria 17360
113 Ga0307408_100002211 3300031548 Bacteria 13890
114 Ga0316575_10030052 3300031665 Bacteria 2123
115 Ga0265314_10003992 3300031711 Bacteria 13952
116 Ga0265314_10011332 3300031711 Bacteria 7369
117 Ga0265314_10049794 3300031711 Bacteria 2930
118 Ga0265314_10097456 3300031711 Bacteria 1899
119 Ga0307518_10013386 3300031838 Bacteria 5865
120 Ga0307416_100013029 3300032002 Bacteria 5633
121 Ga0373939_0004293 3300035114 Bacteria 3368
122 Ga0316582_0101418 3300036647 Bacteria 1907
123 Ga0395898_0335880 3300037466 Bacteria 1441
124 Ga0436361_0002419 3300039447 Bacteria 2615
125 Ga0436361_0235534 3300039447 Bacteria 12344
126 Ga0436361_0820978 3300039447 Bacteria 73779
127 Ga0436361_0906875 3300039447 Bacteria 3330
128 Ga0436361_0938421 3300039447 Bacteria 11081
129 Ga0439455_0064969 3300042012 Bacteria 973
130 Ga0450911_057040 3300042115 Bacteria 507
131 Ga0450893_0003027 3300042532 Bacteria 2646
132 Ga0451577_0000002 3300042876 Bacteria 1731375
133 Ga0451577_0000375 3300042876 Bacteria 83271
134 Ga0451577_0068618 3300042876 Bacteria 3162
135 Ga0466982_0078051 3300044672 Bacteria 2049
136 Ga0453683_0000013 3300044673 Bacteria 371932
137 Ga0453683_0028559 3300044673 Bacteria 3531
138 Ga0466965_0003099 3300044683 Bacteria 7247
139 Ga0453684_0000002 3300044712 Bacteria 1731375
140 Ga0453684_0000040 3300044712 Bacteria 690210
141 Ga0453684_0261508 3300044712 Bacteria 1982
142 Ga0466968_0003648 3300044735 Bacteria 5707
143 Ga0451576_0000006 3300045051 Bacteria 949698
144 Ga0451576_0000037 3300045051 Bacteria 372173
145 Ga0451576_0005709 3300045051 Bacteria 15522
146 Ga0495617_000245 3300046452 Bacteria 32248
147 Ga0495617_004444 3300046452 Bacteria 5103
148 Ga0495617_005143 3300046452 Bacteria 4670
149 Ga0495617_024214 3300046452 Bacteria 2048
150 Ga0495617_148003 3300046452 Bacteria 747
151 Ga0495627_000011 3300046453 Bacteria 354522
152 Ga0495627_048776 3300046453 Bacteria 1280
153 Ga0495627_057028 3300046453 Bacteria 1163
154 Ga0495590_0000020 3300046457 Bacteria 212352
155 Ga0495590_0008308 3300046457 Bacteria 3966
156 Ga0495591_021444 3300046458 Bacteria 2108
157 Ga0495629_0001463 3300046459 Bacteria 18603
158 Ga0495638_0000235 3300046460 Bacteria 75760
159 Ga0495638_0002305 3300046460 Bacteria 15718
160 Ga0495638_0005619 3300046460 Bacteria 9256
161 Ga0495638_0011136 3300046460 Bacteria 6213
162 Ga0495638_0069208 3300046460 Bacteria 2163
163 Ga0495653_0000067 3300046463 Bacteria 90116
164 Ga0495653_0440275 3300046463 Bacteria 821
165 Ga0495650_0000436 3300046471 Bacteria 67167
166 Ga0495650_0000864 3300046471 Bacteria 36231
167 Ga0495650_0004386 3300046471 Bacteria 9699
168 Ga0495650_0006085 3300046471 Bacteria 7609
169 Ga0495650_0013779 3300046471 Bacteria 4252
170 Ga0495650_0018453 3300046471 Bacteria 3465
171 Ga0495605_0000061 3300046474 Bacteria 145286
172 Ga0495605_0000764 3300046474 Bacteria 23490
173 Ga0495605_0059479 3300046474 Bacteria 1835
174 Ga0495639_0040830 3300046475 Bacteria 2089
175 Ga0495584_0005003 3300046491 Bacteria 7054
176 Ga0495584_0016308 3300046491 Bacteria 3788
177 Ga0495584_0090112 3300046491 Bacteria 1546
178 Ga0495585_0018339 3300046492 Bacteria 4037
179 Ga0495585_0028549 3300046492 Bacteria 3181
180 Ga0495585_0167801 3300046492 Bacteria 1135
181 Ga0495607_0000514 3300046501 Bacteria 38263
182 Ga0495607_0004516 3300046501 Bacteria 10213
183 Ga0495607_0074363 3300046501 Bacteria 1886
184 Ga0495607_0137403 3300046501 Bacteria 1264
185 Ga0495607_0194350 3300046501 Bacteria 1008
186 Ga0495583_0000214 3300046506 Bacteria 97639
187 Ga0495583_0000317 3300046506 Bacteria 76193
188 Ga0495583_0000900 3300046506 Bacteria 35357
189 Ga0495583_0005716 3300046506 Bacteria 8350
190 Ga0495606_0000120 3300046507 Bacteria 133907
191 Ga0495606_0000262 3300046507 Bacteria 92896
192 Ga0495606_0002563 3300046507 Bacteria 20868
193 Ga0495606_0003347 3300046507 Bacteria 17098
194 Ga0495606_0003569 3300046507 Bacteria 16403
195 Ga0495606_0007596 3300046507 Bacteria 9646
196 Ga0495606_0039459 3300046507 Bacteria 3181
197 Ga0495606_0059224 3300046507 Bacteria 2457
198 Ga0495610_0000017 3300046512 Bacteria 365675
199 Ga0495610_0003795 3300046512 Bacteria 11523
200 Ga0495610_0006344 3300046512 Bacteria 8172
201 Ga0495610_0064710 3300046512 Bacteria 1727
202 Ga0495610_0139651 3300046512 Bacteria 1044
203 Ga0495616_0001575 3300046513 Bacteria 15690
204 Ga0495616_0005282 3300046513 Bacteria 7963
205 Ga0495616_0036761 3300046513 Bacteria 2525
206 Ga0495637_0000179 3300046520 Bacteria 49260
207 Ga0495637_0004230 3300046520 Bacteria 7457
208 Ga0495643_0001510 3300046522 Bacteria 21024
209 Ga0495643_0002282 3300046522 Bacteria 15491
210 Ga0495644_0004709 3300046523 Bacteria 5365
211 Ga0495644_0018436 3300046523 Bacteria 2666
212 Ga0495648_0000350 3300046524 Bacteria 50788
213 Ga0495648_0002610 3300046524 Bacteria 16463
214 Ga0495648_0009718 3300046524 Bacteria 7410
215 Ga0495648_0010369 3300046524 Bacteria 7100
216 Ga0495648_0035985 3300046524 Bacteria 3202
217 Ga0495648_0052546 3300046524 Bacteria 2474
218 Ga0495648_0184069 3300046524 Bacteria 1059
219 Ga0495663_0102530 3300046525 Bacteria 944
220 Ga0495642_0001943 3300046528 Bacteria 8727
221 Ga0495642_0009415 3300046528 Bacteria 3739
222 Ga0495642_0014244 3300046528 Bacteria 3081
223 Ga0495642_0143057 3300046528 Bacteria 1033
224 Ga0495654_0000060 3300046530 Bacteria 134307
225 Ga0495654_0003528 3300046530 Bacteria 9549
226 Ga0495654_0094064 3300046530 Bacteria 1387
227 Ga0495609_0001337 3300046538 Bacteria 16700
228 Ga0495609_0002743 3300046538 Bacteria 10602
229 Ga0495609_0003502 3300046538 Bacteria 8970
230 Ga0495609_0063156 3300046538 Bacteria 1634
231 Ga0495609_0146335 3300046538 Bacteria 1006
232 Ga0495597_0001017 3300046542 Bacteria 21453
233 Ga0495597_0001085 3300046542 Bacteria 20660
234 Ga0495597_0025389 3300046542 Bacteria 2727
235 Ga0495622_0000210 3300046557 Bacteria 46319
236 Ga0495622_0000292 3300046557 Bacteria 37769
237 Ga0495622_0027453 3300046557 Bacteria 2657
238 Ga0495633_0001329 3300046558 Bacteria 19396
239 Ga0495633_0002397 3300046558 Bacteria 13276
240 Ga0495633_0016905 3300046558 Bacteria 3744
241 Ga0495633_0024806 3300046558 Bacteria 2958
242 Ga0495633_0071246 3300046558 Bacteria 1621
243 Ga0495633_0149361 3300046558 Bacteria 1079
244 Ga0495656_0014975 3300046615 Bacteria 2917
245 Ga0495668_0000162 3300046616 Bacteria 101114
246 Ga0495668_0000427 3300046616 Bacteria 54797
247 Ga0495668_0000769 3300046616 Bacteria 37454
248 Ga0495668_0002786 3300046616 Bacteria 13924
249 Ga0495668_0006299 3300046616 Bacteria 7815
250 Ga0495668_0149885 3300046616 Bacteria 1277
251 Ga0495625_0001192 3300046660 Bacteria 33259
252 Ga0495625_0001372 3300046660 Bacteria 29946
253 Ga0495625_0001954 3300046660 Bacteria 23300
254 Ga0495625_0003285 3300046660 Bacteria 16318
255 Ga0495625_0007946 3300046660 Bacteria 9118
256 Ga0495625_0095897 3300046660 Bacteria 2044
257 Ga0495625_0180233 3300046660 Bacteria 1405
258 Ga0495659_0000114 3300046664 Bacteria 35846
259 Ga0495659_0001470 3300046664 Bacteria 7989
260 Ga0495659_0001963 3300046664 Bacteria 6766
261 Ga0495661_0015210 3300046665 Bacteria 5138
262 Ga0495661_0015705 3300046665 Bacteria 5047
263 Ga0495661_0094679 3300046665 Bacteria 1692
264 Ga0495588_0160896 3300046674 Bacteria 1187
265 Ga0495623_0146114 3300046679 Bacteria 1402
266 Ga0495669_0000844 3300046684 Bacteria 13033
267 Ga0495670_0004436 3300046691 Bacteria 6884
268 Ga0495670_0018028 3300046691 Bacteria 3478
269 Ga0495670_0043035 3300046691 Bacteria 2253
270 Ga0495670_0145396 3300046691 Bacteria 1242
271 Ga0495670_0347554 3300046691 Unclassified 798
272 Ga0495671_0000037 3300046692 Bacteria 177605
273 Ga0495671_0000437 3300046692 Bacteria 33043
274 Ga0495671_0015212 3300046692 Bacteria 4129
275 Ga0495671_0069641 3300046692 Bacteria 1729
276 Ga0495671_0086301 3300046692 Bacteria 1538
277 Ga0495671_0090165 3300046692 Bacteria 1500
278 Ga0495671_0110878 3300046692 Bacteria 1340
279 Ga0495649_0007513 3300046694 Bacteria 6632
280 Ga0495649_0027194 3300046694 Bacteria 3175
281 Ga0495660_0000980 3300046810 Bacteria 20850
282 Ga0495660_0001240 3300046810 Bacteria 17748
283 Ga0495660_0003025 3300046810 Bacteria 10486
284 Ga0495660_0004378 3300046810 Bacteria 8553
285 Ga0495660_0009294 3300046810 Bacteria 5737
286 Ga0495660_0021388 3300046810 Bacteria 3705
287 Ga0495660_0185408 3300046810 Bacteria 1003
288 Ga0495636_0001201 3300047318 Bacteria 9794
289 Ga0495636_0012088 3300047318 Bacteria 3420
290 Ga0495636_0032332 3300047318 Bacteria 2146
291 Ga0495636_0032665 3300047318 Bacteria 2135
292 Ga0495674_0000762 3300047319 Bacteria 30538
293 Ga0495672_0000297 3300047320 Bacteria 68017
294 Ga0495672_0000353 3300047320 Bacteria 58748
295 Ga0495672_0024677 3300047320 Bacteria 3867
296 Ga0495672_0047519 3300047320 Bacteria 2551
297 Ga0495683_0000773 3300047323 Bacteria 22984
298 Ga0495683_0043314 3300047323 Bacteria 2267
299 Ga0495687_000342 3300047443 Bacteria 59692
300 Ga0495687_013104 3300047443 Bacteria 4342
301 Ga0495677_0002300 3300047445 Bacteria 7531
302 Ga0495677_0004779 3300047445 Bacteria 5160
303 Ga0495679_006195 3300047446 Bacteria 5192
304 Ga0495685_000088 3300047447 Bacteria 33952
305 Ga0495685_043343 3300047447 Bacteria 1535
306 Ga0495673_0000179 3300047469 Bacteria 102128
307 Ga0495673_0000201 3300047469 Bacteria 92885
308 Ga0495673_0000248 3300047469 Bacteria 75224
309 Ga0495673_0004072 3300047469 Bacteria 9300
310 Ga0495681_0012354 3300047470 Bacteria 5022
311 Ga0495681_0020287 3300047470 Bacteria 3609
312 Ga0495686_0001233 3300047472 Bacteria 29192
313 Ga0495686_0002872 3300047472 Bacteria 15482
314 Ga0495686_0010721 3300047472 Bacteria 6503
315 Ga0495686_0025863 3300047472 Bacteria 3844
316 Ga0495686_0075751 3300047472 Bacteria 2062
317 Ga0495686_0167568 3300047472 Bacteria 1279
318 Ga0495615_0017385 3300048090 Bacteria 1566
319 Ga0496102_0756293 3300048905 Bacteria 894
320 Ga0496103_0002217 3300048906 Bacteria 12309
321 Ga0496110_1538122 3300048913 Bacteria 575
322 Ga0496114_0065855 3300048917 Bacteria 3036
323 Ga0496116_0048163 3300048919 Bacteria 2862
324 Ga0496116_0171499 3300048919 Bacteria 1175
325 Ga0496116_0298258 3300048919 Bacteria 769
326 Ga0496120_0087668 3300048923 Bacteria 1670
327 Ga0496121_0169425 3300048924 Bacteria 1588
328 Ga0496122_0011421 3300048925 Bacteria 8992
329 Ga0496122_0063246 3300048925 Bacteria 2702
330 Ga0496123_0004566 3300048926 Bacteria 14439
331 Ga0496124_0054348 3300048927 Bacteria 3390
332 Ga0496124_0057347 3300048927 Bacteria 3282
333 Ga0496124_0064848 3300048927 Bacteria 3048
334 Ga0496124_0324293 3300048927 Bacteria 1101
335 Ga0496125_0114112 3300048928 Bacteria 1947
336 Ga0496126_0006579 3300048929 Bacteria 12945
337 Ga0496126_0472267 3300048929 Bacteria 1006
338 Ga0501306_004281 3300049127 Bacteria 1592
339 Ga0501309_001993 3300049129 Bacteria 2130
340 Ga0501310_007132 3300049130 Bacteria 1189
341 Ga0501305_006085 3300049161 Bacteria 1487
342 Ga0501307_009086 3300049162 Bacteria 1130
343 Ga0495678_000010 3300049459 Bacteria 357896
344 Ga0495678_001298 3300049459 Bacteria 20180
345 Ga0495678_006816 3300049459 Bacteria 6012
346 Ga0495678_034719 3300049459 Bacteria 2072
347 Ga0495682_0001031 3300049460 Bacteria 16453
348 Ga0495682_0009029 3300049460 Bacteria 3911
349 Ga0501311_000115 3300049527 Bacteria 4029
350 Ga0501315_015797 3300049531 Bacteria 971
351 Ga0501323_003508 3300049539 Bacteria 1606
352 Ga0501227_000633 3300049665 Bacteria 7650
353 Ga0501238_014268 3300049671 Bacteria 1088
354 Ga0501229_016137 3300049706 Bacteria 971
355 Ga0501269_000202 3300049766 Bacteria 17720
356 Ga0501269_008932 3300049766 Bacteria 1214
357 Ga0501279_002391 3300049775 Bacteria 2463
358 Ga0501279_006138 3300049775 Bacteria 1586
359 Ga0501279_080001 3300049775 Bacteria 562
360 Ga0500618_000139 3300053125 Bacteria 60811
361 Ga0500618_016037 3300053125 Bacteria 1882
362 Ga0500586_001237 3300053145 Bacteria 5335
363 2643792042 2643221554 Bacteria 6603920
364 2644216477 2643221638 Bacteria 6579467
365 2644254777 2643221645 Bacteria 7207331
366 2644360330 2643221664 Bacteria 7272945
367 2738738085 2738541280 Bacteria 6630198
368 2738826822 2738541297 Bacteria 6549566
369 2738843124 2738541300 Bacteria 6675882
370 2739150619 2738541357 Bacteria 6549408
371 2739192538 2738543003 Bacteria 6549560
372 2739273875 2738543018 Bacteria 6718814
373 2739319015 2738543026 Bacteria 6549408
374 2739337256 2738543029 Bacteria 6549249
375 2739342919 2738543030 Bacteria 6719714
376 2821135845 2821131069 Bacteria 6108407
377 2842712307 2842711865 Bacteria 7155354
378 2857556244 2857553236 Bacteria 6166726
379 2857560832 2857558681 Bacteria 6617694
380 2857568032 2857564685 Bacteria 6290584
381 2904428829 2904424332 Bacteria 7633521
382 2919476998 2919476304 Bacteria 5888696
383 Ga0213872_10044866
384 JGI25154J39366_1002311
385 JGI25158J39367_1004283
386 JGI25152J39213_1000224
387 JGI25152J39213_1030272
388 JGI25150J39212_1000695
389 JGI25150J39212_1003218
390 JGI25150J39212_1022086
391 JGI25159J45721_1000892
392 JGI25151J46595_10109159
393 JGI25153J46596_10002862
394 JGI25153J46596_10014209
395 rootH2_10106881
396 rootL2_10043261
397 rootL2_10117747
398 JGI25160J50197_1004010
399 JGI25161J50226_1004038
400 Ga0055529_1000079
401 Ga0055526_1000228
402 Ga0055526_1000337
403 Ga0055526_1000651
404 Ga0055526_1009451
405 Ga0055537_1000038
406 Ga0055537_1008149
407 Ga0055524_1000024
408 Ga0055524_1001031
409 Ga0055524_1013018
410 Ga0055524_1038195
411 Ga0055534_1000074
412 Ga0055534_1001588
413 Ga0055528_1000231
414 Ga0055528_1001043
415 Ga0055543_1006902
416 Ga0065165_1000504
417 Ga0065165_1050750
418 Ga0065715_10030871
419 Ga0068869_100286311
420 Ga0070682_101122185
421 Ga0068867_101198689
422 Ga0099826_10000010
423 Ga0105244_10000158
424 Ga0105244_10003379
425 Ga0105248_10533713
426 Ga0182006_1000141
427 Ga0182005_1000016
428 Ga0213872_10000005
429 Ga0213872_10000541
430 Ga0213872_10002380
431 Ga0213872_10060394
432 Ga0209436_100928
433 Ga0209436_110096
434 Ga0207425_1000021
435 Ga0207425_1000223
436 Ga0207425_1000640
437 Ga0207425_1012715
438 Ga0209646_1000068
439 Ga0209129_1000020
440 Ga0209129_1004870
441 Ga0209129_1022167
442 Ga0209233_1040856
443 Ga0209565_1000123
444 Ga0209565_1001882
445 Ga0209565_1006129
446 Ga0209565_1006737
447 Ga0209565_1007111
448 Ga0209565_1013406
449 Ga0209455_1000070
450 Ga0209673_1000040
451 Ga0209673_1002575
452 Ga0209130_1000290
453 Ga0209130_1007638
454 Ga0209675_1000117
455 Ga0209675_1000650
456 Ga0209675_1003691
457 Ga0209025_1058436
458 Ga0209564_1000027
459 Ga0209564_1000047
460 Ga0209564_1000121
461 Ga0209564_1000780
462 Ga0209564_1006698
463 Ga0209564_1011409
464 Ga0209758_1000077
465 Ga0209758_1000322
466 Ga0209050_1000050
467 Ga0209050_1000795
468 Ga0209256_1000054
469 Ga0209256_1000288
470 Ga0209256_1000674
471 Ga0209256_1001001
472 Ga0209256_1002870
473 Ga0207426_1004227
474 Ga0209051_1025401
475 Ga0209257_1000075
476 Ga0207655_1000710
477 Ga0207655_1013418
478 Ga0207648_11061836
479 Ga0209281_1002515
480 Ga0209282_1000072
481 Ga0265337_1070525
482 Ga0265336_10000272
483 Ga0265336_10038807
484 Ga0265338_10027334
485 Ga0265324_10000004
486 Ga0265324_10001557
487 Ga0316181_1030715
488 Ga0316182_1083480
489 Ga0316182_1257485
490 Ga0265325_10002699
491 Ga0265331_10029158
492 Ga0265316_10287757
493 Ga0307408_100000531
494 Ga0307408_100001492
495 Ga0307408_100002211
496 Ga0316575_10030052
497 Ga0265314_10003992
498 Ga0265314_10011332
499 Ga0265314_10049794
500 Ga0265314_10097456
501 Ga0307518_10013386
502 Ga0307416_100013029
503 Ga0373939_0004293
504 Ga0316582_0101418
505 Ga0395898_0335880
506 Ga0436361_0002419
507 Ga0436361_0235534
508 Ga0436361_0820978
509 Ga0436361_0906875
510 Ga0436361_0938421
511 Ga0439455_0064969
512 Ga0450911_057040
513 Ga0450893_0003027
514 Ga0451577_0000002
515 Ga0451577_0000375
516 Ga0451577_0068618
517 Ga0466982_0078051
518 Ga0453683_0000013
519 Ga0453683_0028559
520 Ga0466965_0003099
521 Ga0453684_0000002
522 Ga0453684_0000040
523 Ga0453684_0261508
524 Ga0466968_0003648
525 Ga0451576_0000006
526 Ga0451576_0000037
527 Ga0451576_0005709
528 Ga0495617_000245
529 Ga0495617_004444
530 Ga0495617_005143
531 Ga0495617_024214
532 Ga0495617_148003
533 Ga0495627_000011
534 Ga0495627_048776
535 Ga0495627_057028
536 Ga0495590_0000020
537 Ga0495590_0008308
538 Ga0495591_021444
539 Ga0495629_0001463
540 Ga0495638_0000235
541 Ga0495638_0002305
542 Ga0495638_0005619
543 Ga0495638_0011136
544 Ga0495638_0069208
545 Ga0495653_0000067
546 Ga0495653_0440275
547 Ga0495650_0000436
548 Ga0495650_0000864
549 Ga0495650_0004386
550 Ga0495650_0006085
551 Ga0495650_0013779
552 Ga0495650_0018453
553 Ga0495605_0000061
554 Ga0495605_0000764
555 Ga0495605_0059479
556 Ga0495639_0040830
557 Ga0495584_0005003
558 Ga0495584_0016308
559 Ga0495584_0090112
560 Ga0495585_0018339
561 Ga0495585_0028549
562 Ga0495585_0167801
563 Ga0495607_0000514
564 Ga0495607_0004516
565 Ga0495607_0074363
566 Ga0495607_0137403
567 Ga0495607_0194350
568 Ga0495583_0000214
569 Ga0495583_0000317
570 Ga0495583_0000900
571 Ga0495583_0005716
572 Ga0495606_0000120
573 Ga0495606_0000262
574 Ga0495606_0002563
575 Ga0495606_0003347
576 Ga0495606_0003569
577 Ga0495606_0007596
578 Ga0495606_0039459
579 Ga0495606_0059224
580 Ga0495610_0000017
581 Ga0495610_0003795
582 Ga0495610_0006344
583 Ga0495610_0064710
584 Ga0495610_0139651
585 Ga0495616_0001575
586 Ga0495616_0005282
587 Ga0495616_0036761
588 Ga0495637_0000179
589 Ga0495637_0004230
590 Ga0495643_0001510
591 Ga0495643_0002282
592 Ga0495644_0004709
593 Ga0495644_0018436
594 Ga0495648_0000350
595 Ga0495648_0002610
596 Ga0495648_0009718
597 Ga0495648_0010369
598 Ga0495648_0035985
599 Ga0495648_0052546
600 Ga0495648_0184069
601 Ga0495663_0102530
602 Ga0495642_0001943
603 Ga0495642_0009415
604 Ga0495642_0014244
605 Ga0495642_0143057
606 Ga0495654_0000060
607 Ga0495654_0003528
608 Ga0495654_0094064
609 Ga0495609_0001337
610 Ga0495609_0002743
611 Ga0495609_0003502
612 Ga0495609_0063156
613 Ga0495609_0146335
614 Ga0495597_0001017
615 Ga0495597_0001085
616 Ga0495597_0025389
617 Ga0495622_0000210
618 Ga0495622_0000292
619 Ga0495622_0027453
620 Ga0495633_0001329
621 Ga0495633_0002397
622 Ga0495633_0016905
623 Ga0495633_0024806
624 Ga0495633_0071246
625 Ga0495633_0149361
626 Ga0495656_0014975
627 Ga0495668_0000162
628 Ga0495668_0000427
629 Ga0495668_0000769
630 Ga0495668_0002786
631 Ga0495668_0006299
632 Ga0495668_0149885
633 Ga0495625_0001192
634 Ga0495625_0001372
635 Ga0495625_0001954
636 Ga0495625_0003285
637 Ga0495625_0007946
638 Ga0495625_0095897
639 Ga0495625_0180233
640 Ga0495659_0000114
641 Ga0495659_0001470
642 Ga0495659_0001963
643 Ga0495661_0015210
644 Ga0495661_0015705
645 Ga0495661_0094679
646 Ga0495588_0160896
647 Ga0495623_0146114
648 Ga0495669_0000844
649 Ga0495670_0004436
650 Ga0495670_0018028
651 Ga0495670_0043035
652 Ga0495670_0145396
653 Ga0495670_0347554
654 Ga0495671_0000037
655 Ga0495671_0000437
656 Ga0495671_0015212
657 Ga0495671_0069641
658 Ga0495671_0086301
659 Ga0495671_0090165
660 Ga0495671_0110878
661 Ga0495649_0007513
662 Ga0495649_0027194
663 Ga0495660_0000980
664 Ga0495660_0001240
665 Ga0495660_0003025
666 Ga0495660_0004378
667 Ga0495660_0009294
668 Ga0495660_0021388
669 Ga0495660_0185408
670 Ga0495636_0001201
671 Ga0495636_0012088
672 Ga0495636_0032332
673 Ga0495636_0032665
674 Ga0495674_0000762
675 Ga0495672_0000297
676 Ga0495672_0000353
677 Ga0495672_0024677
678 Ga0495672_0047519
679 Ga0495683_0000773
680 Ga0495683_0043314
681 Ga0495687_000342
682 Ga0495687_013104
683 Ga0495677_0002300
684 Ga0495677_0004779
685 Ga0495679_006195
686 Ga0495685_000088
687 Ga0495685_043343
688 Ga0495673_0000179
689 Ga0495673_0000201
690 Ga0495673_0000248
691 Ga0495673_0004072
692 Ga0495681_0012354
693 Ga0495681_0020287
694 Ga0495686_0001233
695 Ga0495686_0002872
696 Ga0495686_0010721
697 Ga0495686_0025863
698 Ga0495686_0075751
699 Ga0495686_0167568
700 Ga0495615_0017385
701 Ga0496102_0756293
702 Ga0496103_0002217
703 Ga0496110_1538122
704 Ga0496114_0065855
705 Ga0496116_0048163
706 Ga0496116_0171499
707 Ga0496116_0298258
708 Ga0496120_0087668
709 Ga0496121_0169425
710 Ga0496122_0011421
711 Ga0496122_0063246
712 Ga0496123_0004566
713 Ga0496124_0054348
714 Ga0496124_0057347
715 Ga0496124_0064848
716 Ga0496124_0324293
717 Ga0496125_0114112
718 Ga0496126_0006579
719 Ga0496126_0472267
720 Ga0501306_004281
721 Ga0501309_001993
722 Ga0501310_007132
723 Ga0501305_006085
724 Ga0501307_009086
725 Ga0495678_000010
726 Ga0495678_001298
727 Ga0495678_006816
728 Ga0495678_034719
729 Ga0495682_0001031
730 Ga0495682_0009029
731 Ga0501311_000115
732 Ga0501315_015797
733 Ga0501323_003508
734 Ga0501227_000633
735 Ga0501238_014268
736 Ga0501229_016137
737 Ga0501269_000202
738 Ga0501269_008932
739 Ga0501279_002391
740 Ga0501279_006138
741 Ga0501279_080001
742 Ga0500618_000139
743 Ga0500618_016037
744 Ga0500586_001237
745 2643792042
746 2644216477
747 2644254777
748 2644360330
749 2738738085
750 2738826822
751 2738843124
752 2739150619
753 2739192538
754 2739273875
755 2739319015
756 2739337256
757 2739342919
758 2821135845
759 2842712307
760 2857556244
761 2857560832
762 2857568032
763 2904428829
764 2919476998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04351

PilP

Pilus assembly protein, PilP

33

179

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y4y-assembly1.cif.gz_C-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9675 92 174
2y4y-assembly1.cif.gz_D-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9622 87 173
2y4y-assembly1.cif.gz_B-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9595 92 174
2y4y-assembly1.cif.gz_A-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9577 86 174
2y4y-assembly1.cif.gz_D-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9506 87 173
ID Description Score Start End Superfamily
2y4yC00 Mainly Beta;Roll;SH3 type barrels.; 0.9675 92 174 2.30.30.830
2y4yC00 Mainly Beta;Roll;SH3 type barrels.; 0.932 92 174 2.30.30.830
af_Q7KRR5_243_283_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8853 106 130 3.10.620.30
2lc4A00 Mainly Beta;Roll;SH3 type barrels.; 0.8521 84 175 2.30.30.830
5qj4D00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8342 141 170 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A0P9HM69-F1-model_v4 Pilus assembly protein, PilQ 0.9675 87 175
AF-A0A382ZGV8-F1-model_v4 Pilus assembly protein PilP 0.9607 86 177
AF-A0A534C7M9-F1-model_v4 Pilus assembly protein PilP 0.9599 87 175
AF-A0A1B3PKD3-F1-model_v4 Pilus assembly, PilP family protein 0.9295 106 177
AF-A0A4Q3QI10-F1-model_v4 deleted 0.9268 104 174

Map