F429289

General Info

Members Datasets Scaffolds Average Seq Length
382 218 764 324

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10122116|Ga0207687_101221161
Length 334
Sequence MADGGPKRRGLERILVVKLSALGDFVLALAAMKKIRQAHPKAHISLLTTPPFESLAKASPYFNAVFTDGRPEGFAEWVALRRRLRAANYTRVYDLQTSAHSNRIFQILRPNPPPWSGVAFGCSLPHRNPLRNGMHTLERQADQLMYAGVWPDAPTESGTAPPPDLSWVLRPAEGARPPATGVKAKPYAMFVPGGSAHRQEKRWPVERYGELARILYARGLDIVIIGGPQEAALAQAIQRQVPRARDLTGRTDFASIAVMGAKAALAVGNDTGPLHLAAAAGAPTVVLFSSASDPTLSAPRGKVAVLQAAKLSELPVAKVAQAAARLAPAAQGAA

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
114 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
167 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
168 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
169 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
170 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
171 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
172 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
173 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
174 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
176 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
177 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
178 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
179 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
180 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
181 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
182 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
183 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
186 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
187 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
188 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
189 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
190 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
191 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
192 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
193 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
194 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
195 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
196 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
197 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
198 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
199 2643221583 Caulobacter sp. Root655 Isolate Unclassified
200 2643221584 Caulobacter sp. Root656 Isolate Unclassified
201 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
202 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
203 2643221640 Caulobacter sp. Root342 Isolate Unclassified
204 2643221642 Caulobacter sp. Root343 Isolate Unclassified
205 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
206 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
207 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
208 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
209 2818991435 Caulobacter henricii 536 Isolate Unclassified
210 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
211 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
212 2849560528 Caulobacter zeae 410 Isolate Unclassified
213 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
214 2851153111 Caulobacter radicis 736 Isolate Unclassified
215 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
216 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
217 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
218 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.93
Metatranscriptomes 0
Isolates 7.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.51
Nodule 0
Rhizoplane 3.14
Rhizosphere 64.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10122116 3300025927 Bacteria 1949
2 rootH1_10017946 3300003316 Bacteria 5770
3 Ga0055526_1010742 3300003771 Bacteria 4221
4 Ga0055537_1004942 3300003773 Bacteria 3681
5 Ga0055524_1001880 3300003775 Bacteria 11412
6 Ga0055524_1018935 3300003775 Bacteria 2371
7 Ga0055536_1005457 3300003781 Bacteria 6213
8 Ga0055536_1006698 3300003781 Bacteria 5296
9 Ga0055528_1008529 3300003790 Bacteria 4377
10 Ga0055530_10002041 3300003791 Bacteria 13622
11 Ga0055530_10005272 3300003791 Bacteria 6217
12 Ga0055531_10001208 3300003794 Bacteria 19802
13 Ga0055531_10001366 3300003794 Bacteria 18116
14 Ga0055531_10002112 3300003794 Bacteria 13651
15 Ga0065165_1000741 3300005262 Bacteria 45124
16 Ga0065165_1003166 3300005262 Bacteria 12064
17 Ga0065165_1010836 3300005262 Bacteria 3885
18 Ga0070658_10038866 3300005327 Bacteria 3838
19 Ga0070658_10068062 3300005327 Bacteria 2910
20 Ga0070670_100000009 3300005331 Bacteria 291074
21 Ga0070670_100127777 3300005331 Bacteria 2194
22 Ga0070666_10040669 3300005335 Bacteria 3103
23 Ga0070680_100007533 3300005336 Bacteria 8298
24 Ga0070680_100057512 3300005336 Bacteria 3179
25 Ga0070680_100401693 3300005336 Bacteria 1168
26 Ga0070660_100135455 3300005339 Bacteria 1973
27 Ga0070691_10039436 3300005341 Bacteria 2231
28 Ga0070668_100001021 3300005347 Bacteria 19600
29 Ga0070668_100011884 3300005347 Bacteria 6483
30 Ga0070668_100065142 3300005347 Bacteria 2826
31 Ga0070671_100000360 3300005355 Bacteria 31340
32 Ga0070671_100120421 3300005355 Bacteria 2208
33 Ga0070671_100123631 3300005355 Bacteria 2178
34 Ga0070659_100002612 3300005366 Bacteria 12812
35 Ga0070659_100030084 3300005366 Bacteria 4201
36 Ga0070667_100000218 3300005367 Bacteria 66273
37 Ga0070667_100002974 3300005367 Bacteria 14561
38 Ga0070663_100068967 3300005455 Bacteria 2568
39 Ga0070681_10006947 3300005458 Bacteria 11019
40 Ga0070681_10007323 3300005458 Bacteria 10775
41 Ga0070679_100003986 3300005530 Bacteria 13599
42 Ga0070679_100035838 3300005530 Bacteria 4922
43 Ga0068853_100014165 3300005539 Bacteria 6529
44 Ga0068853_100022620 3300005539 Bacteria 5252
45 Ga0068853_100149939 3300005539 Bacteria 2099
46 Ga0070665_100000200 3300005548 Bacteria 105708
47 Ga0070665_100007613 3300005548 Bacteria 11011
48 Ga0070665_100007934 3300005548 Bacteria 10760
49 Ga0068855_100029956 3300005563 Bacteria 6508
50 Ga0068855_100040244 3300005563 Bacteria 5548
51 Ga0068855_100058752 3300005563 Bacteria 4502
52 Ga0068855_100064580 3300005563 Bacteria 4269
53 Ga0070664_100161254 3300005564 Bacteria 1984
54 Ga0068859_100000093 3300005617 Bacteria 82384
55 Ga0068859_100210056 3300005617 Bacteria 2033
56 Ga0068864_100000200 3300005618 Bacteria 54059
57 Ga0068864_100002565 3300005618 Bacteria 14997
58 Ga0068864_100022889 3300005618 Bacteria 5242
59 Ga0068864_100024367 3300005618 Bacteria 5091
60 Ga0068863_100000470 3300005841 Bacteria 41201
61 Ga0068863_100002382 3300005841 Bacteria 18687
62 Ga0068863_100003281 3300005841 Bacteria 15975
63 Ga0068863_100025375 3300005841 Bacteria 5651
64 Ga0068858_100000240 3300005842 Bacteria 59201
65 Ga0068858_100001215 3300005842 Bacteria 26741
66 Ga0068858_100155890 3300005842 Bacteria 2149
67 Ga0068860_100000032 3300005843 Bacteria 251624
68 Ga0068860_100004381 3300005843 Bacteria 14416
69 Ga0068860_100025562 3300005843 Bacteria 5696
70 Ga0068862_100000564 3300005844 Bacteria 38624
71 Ga0068862_100012724 3300005844 Bacteria 6965
72 Ga0068862_100186916 3300005844 Bacteria 1862
73 Ga0070717_10073171 3300006028 Bacteria 2863
74 Ga0075368_10010380 3300006042 Bacteria 3366
75 Ga0075363_100056633 3300006048 Bacteria 2102
76 Ga0075363_100061140 3300006048 Bacteria 2029
77 Ga0075367_10000801 3300006178 Bacteria 12389
78 Ga0075369_10010913 3300006186 Bacteria 3560
79 Ga0075366_10007967 3300006195 Bacteria 5865
80 Ga0068865_100004841 3300006881 Bacteria 8139
81 Ga0097620_100000093 3300006931 Bacteria 82384
82 Ga0097620_100210050 3300006931 Bacteria 2033
83 Ga0105240_10009827 3300009093 Bacteria 13506
84 Ga0105240_10037852 3300009093 Bacteria 6195
85 Ga0105240_10101426 3300009093 Bacteria 3500
86 Ga0105240_10106211 3300009093 Bacteria 3406
87 Ga0105240_10197715 3300009093 Bacteria 2358
88 Ga0105240_10390783 3300009093 Bacteria 1569
89 Ga0105247_10056721 3300009101 Bacteria 2420
90 Ga0105247_10257377 3300009101 Bacteria 1195
91 Ga0105241_10095752 3300009174 Bacteria 2350
92 Ga0105248_10011950 3300009177 Bacteria 9575
93 Ga0105248_10015687 3300009177 Bacteria 8350
94 Ga0105248_10176093 3300009177 Bacteria 2411
95 Ga0105248_10203894 3300009177 Bacteria 2228
96 Ga0105248_10691160 3300009177 Bacteria 1151
97 Ga0105237_10188029 3300009545 Bacteria 2065
98 Ga0105238_10007168 3300009551 Bacteria 11151
99 Ga0105238_10023599 3300009551 Bacteria 6267
100 Ga0105238_10035692 3300009551 Bacteria 5054
101 Ga0105238_10314670 3300009551 Bacteria 1551
102 Ga0105249_10070289 3300009553 Bacteria 3231
103 Ga0105239_10035071 3300010375 Bacteria 5510
104 Ga0105239_10258149 3300010375 Bacteria 1958
105 Ga0157373_10002685 3300013100 Bacteria 13481
106 Ga0157373_10046517 3300013100 Bacteria 3096
107 Ga0157373_10142082 3300013100 Bacteria 1688
108 Ga0157370_10084284 3300013104 Bacteria 2988
109 Ga0157370_10332945 3300013104 Bacteria 1400
110 Ga0163162_10244989 3300013306 Bacteria 1924
111 Ga0163162_10518187 3300013306 Bacteria 1322
112 Ga0163163_10004871 3300014325 Bacteria 11539
113 Ga0163163_10056539 3300014325 Bacteria 3878
114 Ga0163163_10098171 3300014325 Bacteria 2950
115 Ga0157380_10267877 3300014326 Bacteria 1555
116 Ga0157379_10006524 3300014968 Bacteria 10059
117 Ga0157379_10021924 3300014968 Bacteria 5660
118 Ga0157379_10035138 3300014968 Bacteria 4469
119 Ga0209026_1004312 3300025250 Bacteria 4273
120 Ga0209565_1000647 3300025263 Bacteria 22498
121 Ga0209455_1019266 3300025272 Bacteria 1383
122 Ga0209673_1002051 3300025273 Bacteria 15253
123 Ga0209676_1000067 3300025292 Bacteria 315576
124 Ga0209676_1000134 3300025292 Bacteria 183222
125 Ga0209564_1016831 3300025295 Bacteria 2886
126 Ga0209758_1001348 3300025297 Bacteria 29636
127 Ga0209758_1001910 3300025297 Bacteria 22687
128 Ga0209050_1000121 3300025298 Bacteria 196019
129 Ga0209050_1000348 3300025298 Bacteria 90399
130 Ga0209050_1001544 3300025298 Bacteria 24132
131 Ga0209256_1011399 3300025299 Bacteria 3561
132 Ga0209256_1014702 3300025299 Bacteria 2793
133 Ga0209257_1000125 3300025304 Bacteria 218126
134 Ga0209257_1000424 3300025304 Bacteria 81333
135 Ga0209257_1000447 3300025304 Bacteria 77552
136 Ga0209257_1002108 3300025304 Bacteria 20806
137 Ga0207710_10052770 3300025900 Bacteria 1828
138 Ga0207705_10001282 3300025909 Bacteria 20161
139 Ga0207707_10030056 3300025912 Bacteria 4750
140 Ga0207695_10000850 3300025913 Bacteria 56087
141 Ga0207695_10015479 3300025913 Bacteria 8976
142 Ga0207695_10061722 3300025913 Bacteria 3873
143 Ga0207695_10075820 3300025913 Bacteria 3420
144 Ga0207695_10149484 3300025913 Bacteria 2276
145 Ga0207660_10005126 3300025917 Bacteria 8525
146 Ga0207657_10015696 3300025919 Bacteria 7325
147 Ga0207652_10012769 3300025921 Bacteria 6790
148 Ga0207652_10202605 3300025921 Bacteria 1786
149 Ga0207681_10234922 3300025923 Bacteria 1424
150 Ga0207694_10017555 3300025924 Bacteria 5410
151 Ga0207694_10036856 3300025924 Bacteria 3753
152 Ga0207650_10000237 3300025925 Bacteria 61073
153 Ga0207650_10034164 3300025925 Bacteria 3687
154 Ga0207650_10062789 3300025925 Bacteria 2776
155 Ga0207644_10056973 3300025931 Bacteria 2821
156 Ga0207644_10068605 3300025931 Bacteria 2587
157 Ga0207690_10000092 3300025932 Bacteria 74832
158 Ga0207690_10007083 3300025932 Bacteria 6660
159 Ga0207704_10003504 3300025938 Bacteria 7140
160 Ga0207711_10000424 3300025941 Bacteria 44295
161 Ga0207711_10003762 3300025941 Bacteria 13062
162 Ga0207711_10045803 3300025941 Bacteria 3737
163 Ga0207679_10032639 3300025945 Bacteria 3658
164 Ga0207667_10011032 3300025949 Bacteria 10527
165 Ga0207667_10024283 3300025949 Bacteria 6657
166 Ga0207651_10370866 3300025960 Bacteria 1211
167 Ga0207712_10000741 3300025961 Bacteria 24714
168 Ga0207668_10000033 3300025972 Bacteria 121080
169 Ga0207668_10001199 3300025972 Bacteria 15387
170 Ga0207668_10001395 3300025972 Bacteria 14242
171 Ga0207668_10005899 3300025972 Bacteria 7217
172 Ga0207658_10014577 3300025986 Bacteria 5382
173 Ga0207658_10123206 3300025986 Bacteria 2070
174 Ga0207703_10000079 3300026035 Bacteria 112451
175 Ga0207703_10003463 3300026035 Bacteria 13214
176 Ga0207639_10047570 3300026041 Bacteria 3243
177 Ga0207639_10259753 3300026041 Bacteria 1518
178 Ga0207678_10029259 3300026067 Bacteria 4806
179 Ga0207641_10000034 3300026088 Bacteria 217752
180 Ga0207641_10002623 3300026088 Bacteria 16485
181 Ga0207641_10088794 3300026088 Bacteria 2700
182 Ga0207676_10000103 3300026095 Bacteria 76865
183 Ga0207676_10000251 3300026095 Bacteria 46615
184 Ga0207676_10007624 3300026095 Bacteria 7684
185 Ga0207676_10017894 3300026095 Bacteria 5143
186 Ga0207676_10245613 3300026095 Bacteria 1608
187 Ga0268266_10000005 3300028379 Bacteria 1448194
188 Ga0268266_10002134 3300028379 Bacteria 21798
189 Ga0268266_10056512 3300028379 Bacteria 3376
190 Ga0268266_10201083 3300028379 Bacteria 1823
191 Ga0268265_10077210 3300028380 Bacteria 2615
192 Ga0268265_10097462 3300028380 Bacteria 2366
193 Ga0268265_10164844 3300028380 Bacteria 1887
194 Ga0268264_10000045 3300028381 Bacteria 364764
195 Ga0268264_10000124 3300028381 Bacteria 187493
196 Ga0268264_10000170 3300028381 Bacteria 144898
197 Ga0268264_10139731 3300028381 Bacteria 2158
198 Ga0307517_10019323 3300028786 Bacteria 8753
199 Ga0307517_10056171 3300028786 Bacteria 3847
200 Ga0307515_10108036 3300028794 Bacteria 3282
201 Ga0307511_10006899 3300030521 Bacteria 11449
202 Ga0265327_10001405 3300031251 Bacteria 30666
203 Ga0307513_10000699 3300031456 Bacteria 48154
204 Ga0307513_10003841 3300031456 Bacteria 20222
205 Ga0307513_10013182 3300031456 Bacteria 10155
206 Ga0307513_10021434 3300031456 Bacteria 7628
207 Ga0307414_10038389 3300032004 Bacteria 3216
208 Ga0307510_10005545 3300033180 Bacteria 15040
209 Ga0307510_10019291 3300033180 Bacteria 8001
210 Ga0373944_0002487 3300035089 Bacteria 4686
211 Ga0373936_0004493 3300035113 Bacteria 5277
212 Ga0373927_0002736 3300035695 Bacteria 12857
213 Ga0373937_0270180 3300036401 Bacteria 1605
214 Ga0373925_0007060 3300037068 Bacteria 8207
215 Ga0395899_0001662 3300037312 Bacteria 18535
216 Ga0395900_0000052 3300037418 Bacteria 223910
217 Ga0395900_0044573 3300037418 Bacteria 4569
218 Ga0395898_0009494 3300037466 Bacteria 10215
219 Ga0395898_0040284 3300037466 Bacteria 4620
220 Ga0395905_0005915 3300037471 Bacteria 12402
221 Ga0395905_0050482 3300037471 Bacteria 3897
222 Ga0395905_0073046 3300037471 Bacteria 3215
223 Ga0395905_0122656 3300037471 Bacteria 2443
224 Ga0395905_0364994 3300037471 Bacteria 1337
225 Ga0395901_0000001 3300038443 Bacteria 800383
226 Ga0395901_0115734 3300038443 Bacteria 2816
227 Ga0395901_0231469 3300038443 Bacteria 1929
228 Ga0439446_0009280 3300042156 Bacteria 2630
229 Ga0466965_0134906 3300044683 Bacteria 1282
230 Ga0495627_003129 3300046453 Bacteria 7494
231 Ga0495590_0000642 3300046457 Bacteria 16196
232 Ga0495629_0080306 3300046459 Bacteria 2277
233 Ga0495638_0000368 3300046460 Bacteria 55878
234 Ga0495638_0003440 3300046460 Bacteria 12466
235 Ga0495638_0008219 3300046460 Bacteria 7416
236 Ga0495638_0141222 3300046460 Bacteria 1405
237 Ga0495650_0000030 3300046471 Bacteria 436318
238 Ga0495650_0037572 3300046471 Bacteria 2106
239 Ga0495583_0000002 3300046506 Bacteria 782521
240 Ga0495583_0011645 3300046506 Bacteria 5038
241 Ga0495606_0003638 3300046507 Bacteria 16183
242 Ga0495606_0106460 3300046507 Bacteria 1698
243 Ga0495610_0000650 3300046512 Bacteria 33980
244 Ga0495610_0002727 3300046512 Bacteria 14516
245 Ga0495610_0012712 3300046512 Bacteria 5044
246 Ga0495610_0031039 3300046512 Bacteria 2792
247 Ga0495616_0002374 3300046513 Bacteria 12542
248 Ga0495620_0040881 3300046515 Bacteria 2037
249 Ga0495631_0020059 3300046518 Bacteria 3127
250 Ga0495631_0059957 3300046518 Bacteria 1652
251 Ga0495648_0000354 3300046524 Bacteria 50633
252 Ga0495663_0014504 3300046525 Bacteria 2210
253 Ga0495654_0000129 3300046530 Bacteria 81860
254 Ga0495654_0055586 3300046530 Bacteria 1916
255 Ga0495609_0014892 3300046538 Bacteria 3649
256 Ga0495609_0063349 3300046538 Bacteria 1632
257 Ga0495597_0001366 3300046542 Bacteria 17637
258 Ga0495645_0097274 3300046543 Bacteria 2096
259 Ga0495668_0001033 3300046616 Bacteria 29504
260 Ga0495668_0001897 3300046616 Bacteria 18714
261 Ga0495668_0005197 3300046616 Bacteria 8934
262 Ga0495668_0033394 3300046616 Bacteria 2891
263 Ga0495668_0077953 3300046616 Bacteria 1819
264 Ga0495625_0001064 3300046660 Bacteria 35917
265 Ga0495625_0015271 3300046660 Bacteria 6089
266 Ga0495669_0132158 3300046684 Bacteria 1175
267 Ga0495671_0132597 3300046692 Bacteria 1215
268 Ga0495589_0002380 3300046794 Bacteria 10564
269 Ga0495660_0030437 3300046810 Bacteria 3040
270 Ga0495672_0004180 3300047320 Bacteria 11965
271 Ga0495672_0016621 3300047320 Bacteria 4950
272 Ga0495679_007092 3300047446 Bacteria 4726
273 Ga0495673_0000200 3300047469 Bacteria 93318
274 Ga0495673_0001272 3300047469 Bacteria 20776
275 Ga0495673_0002827 3300047469 Bacteria 11826
276 Ga0495681_0055205 3300047470 Bacteria 1853
277 Ga0495686_0001312 3300047472 Bacteria 27900
278 Ga0495686_0003450 3300047472 Bacteria 13697
279 Ga0496100_0307353 3300048903 Bacteria 1188
280 Ga0496101_0031897 3300048904 Bacteria 3706
281 Ga0496102_0420554 3300048905 Bacteria 1255
282 Ga0496104_0161572 3300048907 Bacteria 2149
283 Ga0496107_0092711 3300048910 Bacteria 2209
284 Ga0496109_0046053 3300048912 Bacteria 3960
285 Ga0496112_0146993 3300048915 Bacteria 2325
286 Ga0496112_0180470 3300048915 Bacteria 2075
287 Ga0496115_0003244 3300048918 Bacteria 11675
288 Ga0496115_0015352 3300048918 Bacteria 5808
289 Ga0496115_0016490 3300048918 Bacteria 5627
290 Ga0496115_0017219 3300048918 Bacteria 5518
291 Ga0496118_0019370 3300048921 Bacteria 6084
292 Ga0496119_0024601 3300048922 Bacteria 4231
293 Ga0496121_0000067 3300048924 Bacteria 261543
294 Ga0496121_0000552 3300048924 Bacteria 70734
295 Ga0496121_0246027 3300048924 Bacteria 1243
296 Ga0496124_0001814 3300048927 Bacteria 29544
297 Ga0496124_0051625 3300048927 Bacteria 3498
298 Ga0495678_000498 3300049459 Bacteria 38832
299 Ga0495678_078145 3300049459 Bacteria 1195
300 Ga0501034_0177895 3300049571 Bacteria 2093
301 Ga0501037_0054142 3300049573 Bacteria 2935
302 Ga0501047_0014822 3300049581 Bacteria 7421
303 Ga0501047_0254616 3300049581 Bacteria 1604
304 Ga0501047_0429884 3300049581 Bacteria 1151
305 Ga0501238_000221 3300049671 Bacteria 8173
306 Ga0501044_0012011 3300049823 Bacteria 9381
307 Ga0501044_0197446 3300049823 Bacteria 1971
308 nmdc:mga0k408_21073_c2 3300050493 Bacteria 2705
309 nmdc:mga0k408_7913_c1 3300050493 Bacteria 5692
310 nmdc:mga0k408_98025_c1 3300050493 Bacteria 1727
311 nmdc:mga04h51_3213_c1 3300050495 Bacteria 3948
312 nmdc:mga07m45_134030_c1 3300050496 Bacteria 1434
313 nmdc:mga07m45_91988_c1 3300050496 Bacteria 1738
314 nmdc:mga0sz30_16270_c1 3300050516 Bacteria 2951
315 Ga0500635_0000043 3300053080 Bacteria 87854
316 Ga0500578_0000004 3300053086 Bacteria 260037
317 Ga0500643_009205 3300053087 Bacteria 3793
318 Ga0500643_024107 3300053087 Bacteria 1936
319 Ga0500644_0000293 3300053088 Bacteria 26877
320 Ga0500644_0043806 3300053088 Bacteria 1499
321 Ga0500647_0083595 3300053091 Bacteria 1531
322 Ga0500651_0038898 3300053093 Bacteria 2996
323 Ga0500566_0053098 3300053094 Bacteria 2314
324 Ga0500641_0002378 3300053096 Bacteria 6666
325 Ga0500555_071684 3300053103 Bacteria 914
326 Ga0500556_0000999 3300053104 Bacteria 14924
327 Ga0500556_0038324 3300053104 Bacteria 1673
328 Ga0500562_000168 3300053108 Bacteria 18165
329 Ga0500562_000456 3300053108 Bacteria 9908
330 Ga0500562_001852 3300053108 Bacteria 5308
331 Ga0500562_033680 3300053108 Bacteria 1354
332 Ga0500593_107198 3300053117 Bacteria 1155
333 Ga0500595_009839 3300053119 Bacteria 3837
334 Ga0500595_040557 3300053119 Bacteria 1501
335 Ga0500607_082638 3300053121 Bacteria 1634
336 Ga0500608_000010 3300053122 Bacteria 94344
337 Ga0500618_000156 3300053125 Bacteria 56344
338 Ga0500658_0003996 3300053134 Bacteria 5537
339 Ga0500559_0000003 3300053136 Bacteria 252693
340 Ga0500559_0003095 3300053136 Bacteria 8284
341 Ga0500564_000201 3300053138 Bacteria 16270
342 Ga0500577_0128502 3300053142 Bacteria 1060
343 Ga0500590_030994 3300053148 Bacteria 2772
344 Ga0500616_0018951 3300053153 Bacteria 3887
345 Ga0500622_0001708 3300053156 Bacteria 17030
346 Ga0500622_0062583 3300053156 Bacteria 1895
347 Ga0500638_084588 3300053162 Bacteria 1502
348 Ga0500636_0008151 3300053177 Bacteria 6070
349 Ga0500637_0016026 3300053178 Bacteria 3987
350 Ga0500637_0039495 3300053178 Bacteria 2662
351 Ga0500645_001263 3300053730 Bacteria 13272
352 Ga0500645_001513 3300053730 Bacteria 11644
353 Ga0500645_003217 3300053730 Bacteria 6763
354 Ga0500609_001638 3300053731 Bacteria 3264
355 Ga0500596_002834 3300053735 Bacteria 3378
356 2511123950 2510917020 Bacteria 5657507
357 2585146134 2582581279 Bacteria 4980720
358 2585152173 2582581280 Bacteria 5994497
359 2585194343 2582581293 Bacteria 5907401
360 2587917246 2585428106 Bacteria 5179711
361 2643749804 2643221545 Bacteria 5083237
362 2643783367 2643221552 Bacteria 5708754
363 2643925271 2643221583 Bacteria 5218014
364 2643931847 2643221584 Bacteria 5511711
365 2643998571 2643221598 Bacteria 4578346
366 2644086925 2643221614 Bacteria 4260023
367 2644227266 2643221640 Bacteria 5258820
368 2644233266 2643221642 Bacteria 5357871
369 2644341879 2643221661 Bacteria 4267604
370 2644368166 2643221666 Bacteria 4265935
371 2644508760 2643221691 Bacteria 5093099
372 2792462694 2791355048 Bacteria 5832535
373 2819536879 2818991435 Bacteria 5433759
374 2819645127 2818991454 Bacteria 5563326
375 2843749578 2843744320 Bacteria 5659202
376 2849562541 2849560528 Bacteria 5393480
377 2849575004 2849573788 Bacteria 5421256
378 2851155789 2851153111 Bacteria 5542585
379 2857505011 2857504554 Bacteria 5369913
380 2884962672 2884960567 Bacteria 5437054
381 2898332340 2898329390 Bacteria 5168154
382 2928534201 2928531327 Bacteria 5101314
383 Ga0207687_10122116
384 rootH1_10017946
385 Ga0055526_1010742
386 Ga0055537_1004942
387 Ga0055524_1001880
388 Ga0055524_1018935
389 Ga0055536_1005457
390 Ga0055536_1006698
391 Ga0055528_1008529
392 Ga0055530_10002041
393 Ga0055530_10005272
394 Ga0055531_10001208
395 Ga0055531_10001366
396 Ga0055531_10002112
397 Ga0065165_1000741
398 Ga0065165_1003166
399 Ga0065165_1010836
400 Ga0070658_10038866
401 Ga0070658_10068062
402 Ga0070670_100000009
403 Ga0070670_100127777
404 Ga0070666_10040669
405 Ga0070680_100007533
406 Ga0070680_100057512
407 Ga0070680_100401693
408 Ga0070660_100135455
409 Ga0070691_10039436
410 Ga0070668_100001021
411 Ga0070668_100011884
412 Ga0070668_100065142
413 Ga0070671_100000360
414 Ga0070671_100120421
415 Ga0070671_100123631
416 Ga0070659_100002612
417 Ga0070659_100030084
418 Ga0070667_100000218
419 Ga0070667_100002974
420 Ga0070663_100068967
421 Ga0070681_10006947
422 Ga0070681_10007323
423 Ga0070679_100003986
424 Ga0070679_100035838
425 Ga0068853_100014165
426 Ga0068853_100022620
427 Ga0068853_100149939
428 Ga0070665_100000200
429 Ga0070665_100007613
430 Ga0070665_100007934
431 Ga0068855_100029956
432 Ga0068855_100040244
433 Ga0068855_100058752
434 Ga0068855_100064580
435 Ga0070664_100161254
436 Ga0068859_100000093
437 Ga0068859_100210056
438 Ga0068864_100000200
439 Ga0068864_100002565
440 Ga0068864_100022889
441 Ga0068864_100024367
442 Ga0068863_100000470
443 Ga0068863_100002382
444 Ga0068863_100003281
445 Ga0068863_100025375
446 Ga0068858_100000240
447 Ga0068858_100001215
448 Ga0068858_100155890
449 Ga0068860_100000032
450 Ga0068860_100004381
451 Ga0068860_100025562
452 Ga0068862_100000564
453 Ga0068862_100012724
454 Ga0068862_100186916
455 Ga0070717_10073171
456 Ga0075368_10010380
457 Ga0075363_100056633
458 Ga0075363_100061140
459 Ga0075367_10000801
460 Ga0075369_10010913
461 Ga0075366_10007967
462 Ga0068865_100004841
463 Ga0097620_100000093
464 Ga0097620_100210050
465 Ga0105240_10009827
466 Ga0105240_10037852
467 Ga0105240_10101426
468 Ga0105240_10106211
469 Ga0105240_10197715
470 Ga0105240_10390783
471 Ga0105247_10056721
472 Ga0105247_10257377
473 Ga0105241_10095752
474 Ga0105248_10011950
475 Ga0105248_10015687
476 Ga0105248_10176093
477 Ga0105248_10203894
478 Ga0105248_10691160
479 Ga0105237_10188029
480 Ga0105238_10007168
481 Ga0105238_10023599
482 Ga0105238_10035692
483 Ga0105238_10314670
484 Ga0105249_10070289
485 Ga0105239_10035071
486 Ga0105239_10258149
487 Ga0157373_10002685
488 Ga0157373_10046517
489 Ga0157373_10142082
490 Ga0157370_10084284
491 Ga0157370_10332945
492 Ga0163162_10244989
493 Ga0163162_10518187
494 Ga0163163_10004871
495 Ga0163163_10056539
496 Ga0163163_10098171
497 Ga0157380_10267877
498 Ga0157379_10006524
499 Ga0157379_10021924
500 Ga0157379_10035138
501 Ga0209026_1004312
502 Ga0209565_1000647
503 Ga0209455_1019266
504 Ga0209673_1002051
505 Ga0209676_1000067
506 Ga0209676_1000134
507 Ga0209564_1016831
508 Ga0209758_1001348
509 Ga0209758_1001910
510 Ga0209050_1000121
511 Ga0209050_1000348
512 Ga0209050_1001544
513 Ga0209256_1011399
514 Ga0209256_1014702
515 Ga0209257_1000125
516 Ga0209257_1000424
517 Ga0209257_1000447
518 Ga0209257_1002108
519 Ga0207710_10052770
520 Ga0207705_10001282
521 Ga0207707_10030056
522 Ga0207695_10000850
523 Ga0207695_10015479
524 Ga0207695_10061722
525 Ga0207695_10075820
526 Ga0207695_10149484
527 Ga0207660_10005126
528 Ga0207657_10015696
529 Ga0207652_10012769
530 Ga0207652_10202605
531 Ga0207681_10234922
532 Ga0207694_10017555
533 Ga0207694_10036856
534 Ga0207650_10000237
535 Ga0207650_10034164
536 Ga0207650_10062789
537 Ga0207644_10056973
538 Ga0207644_10068605
539 Ga0207690_10000092
540 Ga0207690_10007083
541 Ga0207704_10003504
542 Ga0207711_10000424
543 Ga0207711_10003762
544 Ga0207711_10045803
545 Ga0207679_10032639
546 Ga0207667_10011032
547 Ga0207667_10024283
548 Ga0207651_10370866
549 Ga0207712_10000741
550 Ga0207668_10000033
551 Ga0207668_10001199
552 Ga0207668_10001395
553 Ga0207668_10005899
554 Ga0207658_10014577
555 Ga0207658_10123206
556 Ga0207703_10000079
557 Ga0207703_10003463
558 Ga0207639_10047570
559 Ga0207639_10259753
560 Ga0207678_10029259
561 Ga0207641_10000034
562 Ga0207641_10002623
563 Ga0207641_10088794
564 Ga0207676_10000103
565 Ga0207676_10000251
566 Ga0207676_10007624
567 Ga0207676_10017894
568 Ga0207676_10245613
569 Ga0268266_10000005
570 Ga0268266_10002134
571 Ga0268266_10056512
572 Ga0268266_10201083
573 Ga0268265_10077210
574 Ga0268265_10097462
575 Ga0268265_10164844
576 Ga0268264_10000045
577 Ga0268264_10000124
578 Ga0268264_10000170
579 Ga0268264_10139731
580 Ga0307517_10019323
581 Ga0307517_10056171
582 Ga0307515_10108036
583 Ga0307511_10006899
584 Ga0265327_10001405
585 Ga0307513_10000699
586 Ga0307513_10003841
587 Ga0307513_10013182
588 Ga0307513_10021434
589 Ga0307414_10038389
590 Ga0307510_10005545
591 Ga0307510_10019291
592 Ga0373944_0002487
593 Ga0373936_0004493
594 Ga0373927_0002736
595 Ga0373937_0270180
596 Ga0373925_0007060
597 Ga0395899_0001662
598 Ga0395900_0000052
599 Ga0395900_0044573
600 Ga0395898_0009494
601 Ga0395898_0040284
602 Ga0395905_0005915
603 Ga0395905_0050482
604 Ga0395905_0073046
605 Ga0395905_0122656
606 Ga0395905_0364994
607 Ga0395901_0000001
608 Ga0395901_0115734
609 Ga0395901_0231469
610 Ga0439446_0009280
611 Ga0466965_0134906
612 Ga0495627_003129
613 Ga0495590_0000642
614 Ga0495629_0080306
615 Ga0495638_0000368
616 Ga0495638_0003440
617 Ga0495638_0008219
618 Ga0495638_0141222
619 Ga0495650_0000030
620 Ga0495650_0037572
621 Ga0495583_0000002
622 Ga0495583_0011645
623 Ga0495606_0003638
624 Ga0495606_0106460
625 Ga0495610_0000650
626 Ga0495610_0002727
627 Ga0495610_0012712
628 Ga0495610_0031039
629 Ga0495616_0002374
630 Ga0495620_0040881
631 Ga0495631_0020059
632 Ga0495631_0059957
633 Ga0495648_0000354
634 Ga0495663_0014504
635 Ga0495654_0000129
636 Ga0495654_0055586
637 Ga0495609_0014892
638 Ga0495609_0063349
639 Ga0495597_0001366
640 Ga0495645_0097274
641 Ga0495668_0001033
642 Ga0495668_0001897
643 Ga0495668_0005197
644 Ga0495668_0033394
645 Ga0495668_0077953
646 Ga0495625_0001064
647 Ga0495625_0015271
648 Ga0495669_0132158
649 Ga0495671_0132597
650 Ga0495589_0002380
651 Ga0495660_0030437
652 Ga0495672_0004180
653 Ga0495672_0016621
654 Ga0495679_007092
655 Ga0495673_0000200
656 Ga0495673_0001272
657 Ga0495673_0002827
658 Ga0495681_0055205
659 Ga0495686_0001312
660 Ga0495686_0003450
661 Ga0496100_0307353
662 Ga0496101_0031897
663 Ga0496102_0420554
664 Ga0496104_0161572
665 Ga0496107_0092711
666 Ga0496109_0046053
667 Ga0496112_0146993
668 Ga0496112_0180470
669 Ga0496115_0003244
670 Ga0496115_0015352
671 Ga0496115_0016490
672 Ga0496115_0017219
673 Ga0496118_0019370
674 Ga0496119_0024601
675 Ga0496121_0000067
676 Ga0496121_0000552
677 Ga0496121_0246027
678 Ga0496124_0001814
679 Ga0496124_0051625
680 Ga0495678_000498
681 Ga0495678_078145
682 Ga0501034_0177895
683 Ga0501037_0054142
684 Ga0501047_0014822
685 Ga0501047_0254616
686 Ga0501047_0429884
687 Ga0501238_000221
688 Ga0501044_0012011
689 Ga0501044_0197446
690 nmdc:mga0k408_21073_c2
691 nmdc:mga0k408_7913_c1
692 nmdc:mga0k408_98025_c1
693 nmdc:mga04h51_3213_c1
694 nmdc:mga07m45_134030_c1
695 nmdc:mga07m45_91988_c1
696 nmdc:mga0sz30_16270_c1
697 Ga0500635_0000043
698 Ga0500578_0000004
699 Ga0500643_009205
700 Ga0500643_024107
701 Ga0500644_0000293
702 Ga0500644_0043806
703 Ga0500647_0083595
704 Ga0500651_0038898
705 Ga0500566_0053098
706 Ga0500641_0002378
707 Ga0500555_071684
708 Ga0500556_0000999
709 Ga0500556_0038324
710 Ga0500562_000168
711 Ga0500562_000456
712 Ga0500562_001852
713 Ga0500562_033680
714 Ga0500593_107198
715 Ga0500595_009839
716 Ga0500595_040557
717 Ga0500607_082638
718 Ga0500608_000010
719 Ga0500618_000156
720 Ga0500658_0003996
721 Ga0500559_0000003
722 Ga0500559_0003095
723 Ga0500564_000201
724 Ga0500577_0128502
725 Ga0500590_030994
726 Ga0500616_0018951
727 Ga0500622_0001708
728 Ga0500622_0062583
729 Ga0500638_084588
730 Ga0500636_0008151
731 Ga0500637_0016026
732 Ga0500637_0039495
733 Ga0500645_001263
734 Ga0500645_001513
735 Ga0500645_003217
736 Ga0500609_001638
737 Ga0500596_002834
738 2511123950
739 2585146134
740 2585152173
741 2585194343
742 2587917246
743 2643749804
744 2643783367
745 2643925271
746 2643931847
747 2643998571
748 2644086925
749 2644227266
750 2644233266
751 2644341879
752 2644368166
753 2644508760
754 2792462694
755 2819536879
756 2819645127
757 2843749578
758 2849562541
759 2849575004
760 2851155789
761 2857505011
762 2884962672
763 2898332340
764 2928534201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01075

Glyco_transf_9

Glycosyltransferase family 9 (heptosyltransferase)

77

322

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dfe-assembly1.cif.gz_A the structure of a ternary complex of e. coli waac 0.8209 7 319
1psw-assembly1.cif.gz_A structure of e. coli adp-heptose lps heptosyltransferase ii 0.8168 7 320
3tov-assembly2.cif.gz_B the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.8029 1 320
6dfe-assembly1.cif.gz_A the structure of a ternary complex of e. coli waac 0.7972 7 319
3tov-assembly2.cif.gz_B the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.7935 1 320
ID Description Score Start End Superfamily
2h1fB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8838 181 319 3.40.50.2000
af_P25742_154_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8816 178 323 3.40.50.2000
3tovB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8661 180 320 3.40.50.2000
1pswA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8598 173 320 3.40.50.2000
af_I1KVM5_139_276_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8146 20 102 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A836TEK9-F1-model_v4 ADP-heptose--LPS heptosyltransferase 0.9687 179 318 GO:0005829
GO:0008713
GO:0009244
AF-A0A060BVT1-F1-model_v4 CAZy families GT9 protein 0.966 6 148 GO:0005829
GO:0008713
GO:0009244
AF-A0A0K8MDV7-F1-model_v4 ADP-heptose--LPS heptosyltransferase 2 0.9378 7 320 GO:0005829
GO:0008713
GO:0009244
AF-A0A060BVT1-F1-model_v4 CAZy families GT9 protein 0.9274 6 148 GO:0005829
GO:0008713
GO:0009244
AF-A0A2S6TYS2-F1-model_v4 ADP-heptose--LPS heptosyltransferase 2 0.9268 5 320 GO:0005829
GO:0008713
GO:0009244

Map