F429291

General Info

Members Datasets Scaffolds Average Seq Length
382 190 764 174

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10045055|Ga0207691_100450553
Length 209
Sequence LLRDGFFMEGSVNILNDSLHTTPNSQPPTVNQLSVIFVIITMSDTIINKVAESGLITIDLESFFPADEIVGFDLKDFLFMGLILKEKDFREALTAFDWENMRSKKVAIYCSADAIIPLWAYMLVSSYLQPVAKLVFSGTPEELKKQEFIKNIQQLDATTFEDKRVVVKGCGDMEIGEYAFVEITNKLRPVVKSLMYGEPCSTVPVYKKR

Samples

Sample ID Description Type Environment
1 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
159 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
190 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0
Rhizoplane 0.52
Rhizosphere 93.72
Stem 0
Stem Tuber 0
Unclassified 31.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207691_10045055 3300025940 Unclassified 4057
2 rootH1_10155573 3300003316 Bacteria 1374
3 rootL2_10143996 3300003322 Bacteria 4621
4 rootL2_10235023 3300003322 Unclassified 1601
5 rootH1_10099088 3300003323 Bacteria 5161
6 rootH1_10341299 3300003323 Unclassified 3061
7 JGI25160J50197_1000375 3300003354 Bacteria 29260
8 Ga0065704_10129942 3300005289 Bacteria 1642
9 Ga0065704_10148615 3300005289 Unclassified 1449
10 Ga0065712_10005258 3300005290 Unclassified 2935
11 Ga0065715_10009378 3300005293 Bacteria 4944
12 Ga0070658_10044331 3300005327 Unclassified 3595
13 Ga0070658_10500852 3300005327 Bacteria 1049
14 Ga0070683_100225861 3300005329 Unclassified 1779
15 Ga0070670_100235985 3300005331 Bacteria 1592
16 Ga0070670_100399113 3300005331 Bacteria 1214
17 Ga0070670_101096938 3300005331 Bacteria 726
18 Ga0070677_10073470 3300005333 Unclassified 1445
19 Ga0070677_10473170 3300005333 Bacteria 674
20 Ga0068869_100008852 3300005334 Bacteria 6513
21 Ga0068869_100028501 3300005334 Bacteria 3902
22 Ga0070666_10000030 3300005335 Bacteria 137543
23 Ga0070666_10038104 3300005335 Bacteria 3198
24 Ga0070680_100072919 3300005336 Bacteria 2823
25 Ga0070682_100458933 3300005337 Unclassified 978
26 Ga0068868_100785993 3300005338 Bacteria 858
27 Ga0068868_101171457 3300005338 Unclassified 710
28 Ga0068868_101416108 3300005338 Bacteria 649
29 Ga0070660_100044144 3300005339 Bacteria 3408
30 Ga0070689_100025280 3300005340 Bacteria 4460
31 Ga0070689_100838092 3300005340 Unclassified 810
32 Ga0070691_10386405 3300005341 Unclassified 785
33 Ga0070687_100651226 3300005343 Bacteria 730
34 Ga0070668_100624483 3300005347 Unclassified 945
35 Ga0070668_100702210 3300005347 Unclassified 892
36 Ga0070669_100045943 3300005353 Bacteria 3183
37 Ga0070675_100049305 3300005354 Bacteria 3456
38 Ga0070675_100286458 3300005354 Bacteria 1449
39 Ga0070675_100357209 3300005354 Bacteria 1297
40 Ga0070675_100969928 3300005354 Unclassified 780
41 Ga0070671_100011034 3300005355 Bacteria 7251
42 Ga0070671_100053047 3300005355 Bacteria 3371
43 Ga0070671_100270163 3300005355 Bacteria 1445
44 Ga0070671_100432406 3300005355 Bacteria 1128
45 Ga0070674_100031069 3300005356 Bacteria 3535
46 Ga0070674_100176947 3300005356 Unclassified 1631
47 Ga0070674_100350752 3300005356 Bacteria 1192
48 Ga0070673_100257055 3300005364 Unclassified 1524
49 Ga0070673_100353600 3300005364 Unclassified 1304
50 Ga0070673_101753857 3300005364 Unclassified 588
51 Ga0070688_100100349 3300005365 Bacteria 1907
52 Ga0070688_100287045 3300005365 Bacteria 1184
53 Ga0070688_100585145 3300005365 Unclassified 852
54 Ga0070659_100019085 3300005366 Bacteria 5186
55 Ga0070667_100079582 3300005367 Unclassified 2802
56 Ga0070667_100139426 3300005367 Bacteria 2122
57 Ga0070667_100218207 3300005367 Bacteria 1697
58 Ga0070667_100348944 3300005367 Bacteria 1339
59 Ga0070667_100970260 3300005367 Bacteria 792
60 Ga0070701_10082585 3300005438 Unclassified 1743
61 Ga0070700_100080218 3300005441 Bacteria 2105
62 Ga0070700_100135710 3300005441 Bacteria 1666
63 Ga0070700_100143991 3300005441 Unclassified 1623
64 Ga0070663_100770927 3300005455 Bacteria 823
65 Ga0070678_100035313 3300005456 Bacteria 3489
66 Ga0070678_100129425 3300005456 Bacteria 2003
67 Ga0070678_100258667 3300005456 Bacteria 1463
68 Ga0070678_100350833 3300005456 Bacteria 1269
69 Ga0068867_100126477 3300005459 Bacteria 1981
70 Ga0068867_100993120 3300005459 Bacteria 761
71 Ga0068867_101237904 3300005459 Bacteria 687
72 Ga0070685_10034877 3300005466 Bacteria 2836
73 Ga0070706_101214017 3300005467 Unclassified 693
74 Ga0070707_100351288 3300005468 Bacteria 1432
75 Ga0070698_100001103 3300005471 Bacteria 29751
76 Ga0070698_100021829 3300005471 Bacteria 6705
77 Ga0070698_100026571 3300005471 Bacteria 6026
78 Ga0070699_100108261 3300005518 Unclassified 2439
79 Ga0070679_100219445 3300005530 Bacteria 1863
80 Ga0068853_101116427 3300005539 Unclassified 760
81 Ga0070672_100106896 3300005543 Unclassified 2277
82 Ga0070672_100366086 3300005543 Bacteria 1231
83 Ga0070686_100003077 3300005544 Bacteria 9137
84 Ga0070665_100076488 3300005548 Unclassified 3354
85 Ga0068855_100000795 3300005563 Bacteria 39086
86 Ga0070664_100012885 3300005564 Bacteria 6804
87 Ga0068857_100039491 3300005577 Bacteria 4181
88 Ga0068857_100281752 3300005577 Bacteria 1529
89 Ga0068852_100038137 3300005616 Bacteria 4036
90 Ga0068852_100105668 3300005616 Unclassified 2551
91 Ga0068852_101420752 3300005616 Unclassified 716
92 Ga0068859_100000003 3300005617 Bacteria 479218
93 Ga0068859_100197215 3300005617 Bacteria 2098
94 Ga0068859_100207189 3300005617 Unclassified 2046
95 Ga0068859_100260373 3300005617 Unclassified 1826
96 Ga0068859_100296013 3300005617 Unclassified 1711
97 Ga0068864_100020481 3300005618 Bacteria 5534
98 Ga0068864_100082551 3300005618 Unclassified 2820
99 Ga0068864_100390300 3300005618 Bacteria 1321
100 Ga0068866_10049163 3300005718 Bacteria 2135
101 Ga0068866_10106289 3300005718 Unclassified 1558
102 Ga0068866_10198682 3300005718 Bacteria 1197
103 Ga0068866_10578021 3300005718 Bacteria 755
104 Ga0068861_100003315 3300005719 Bacteria 10661
105 Ga0068861_100027557 3300005719 Bacteria 4140
106 Ga0068861_100424027 3300005719 Bacteria 1186
107 Ga0068861_101021232 3300005719 Unclassified 790
108 Ga0068851_10007506 3300005834 Bacteria 5011
109 Ga0068851_10249387 3300005834 Unclassified 1007
110 Ga0068851_10551927 3300005834 Unclassified 696
111 Ga0068870_10013805 3300005840 Unclassified 3804
112 Ga0068870_10243604 3300005840 Unclassified 1111
113 Ga0068863_100004042 3300005841 Bacteria 14481
114 Ga0068863_100049408 3300005841 Unclassified 3989
115 Ga0068863_100062650 3300005841 Bacteria 3517
116 Ga0068863_100137939 3300005841 Bacteria 2330
117 Ga0068858_100012504 3300005842 Bacteria 8006
118 Ga0068858_100425104 3300005842 Unclassified 1278
119 Ga0068860_100004265 3300005843 Bacteria 14642
120 Ga0068860_100237123 3300005843 Unclassified 1774
121 Ga0068860_100506399 3300005843 Unclassified 1206
122 Ga0068862_100595538 3300005844 Unclassified 1061
123 Ga0081455_10255763 3300005937 Bacteria 1278
124 Ga0075366_10019670 3300006195 Bacteria 3911
125 Ga0075366_10299129 3300006195 Bacteria 984
126 Ga0097621_100000352 3300006237 Bacteria 31757
127 Ga0097621_100195915 3300006237 Bacteria 1752
128 Ga0068871_100073855 3300006358 Bacteria 2812
129 Ga0068871_100253215 3300006358 Bacteria 1534
130 Ga0075428_100023526 3300006844 Bacteria 6820
131 Ga0075428_100093656 3300006844 Bacteria 3275
132 Ga0075431_100153606 3300006847 Unclassified 2369
133 Ga0075429_100015805 3300006880 Bacteria 6536
134 Ga0075429_100046759 3300006880 Bacteria 3765
135 Ga0097620_100000003 3300006931 Bacteria 479218
136 Ga0097620_100197203 3300006931 Bacteria 2098
137 Ga0097620_100207189 3300006931 Unclassified 2046
138 Ga0097620_100260388 3300006931 Unclassified 1826
139 Ga0097620_100296012 3300006931 Unclassified 1711
140 Ga0111539_10054803 3300009094 Bacteria 4742
141 Ga0111539_11113384 3300009094 Bacteria 917
142 Ga0111539_11786489 3300009094 Bacteria 713
143 Ga0105245_10651770 3300009098 Bacteria 1083
144 Ga0105247_10088179 3300009101 Bacteria 1966
145 Ga0105247_10122219 3300009101 Unclassified 1688
146 Ga0114129_10204970 3300009147 Bacteria 2669
147 Ga0105241_10000831 3300009174 Bacteria 23378
148 Ga0105241_10900763 3300009174 Bacteria 821
149 Ga0105242_10019535 3300009176 Bacteria 5311
150 Ga0105242_10165544 3300009176 Unclassified 1939
151 Ga0105242_10197886 3300009176 Bacteria 1783
152 Ga0105242_10301866 3300009176 Bacteria 1462
153 Ga0105242_10858929 3300009176 Bacteria 904
154 Ga0105248_10081795 3300009177 Unclassified 3631
155 Ga0105248_10297966 3300009177 Unclassified 1816
156 Ga0105237_10110501 3300009545 Bacteria 2741
157 Ga0105249_10002081 3300009553 Bacteria 17352
158 Ga0105249_10006036 3300009553 Bacteria 10499
159 Ga0105249_10260583 3300009553 Bacteria 1723
160 Ga0105249_10357206 3300009553 Unclassified 1482
161 Ga0105239_10121267 3300010375 Unclassified 2904
162 Ga0105246_10035861 3300011119 Bacteria 3318
163 Ga0105246_10080104 3300011119 Unclassified 2324
164 Ga0105246_10551842 3300011119 Unclassified 988
165 Ga0157373_10142702 3300013100 Bacteria 1684
166 Ga0157371_10000668 3300013102 Bacteria 40664
167 Ga0157371_10026811 3300013102 Bacteria 4185
168 Ga0157370_10026304 3300013104 Bacteria 5746
169 Ga0157370_10034600 3300013104 Bacteria 4917
170 Ga0157370_10281116 3300013104 Bacteria 1538
171 Ga0157374_10154610 3300013296 Bacteria 2232
172 Ga0157374_11210502 3300013296 Unclassified 777
173 Ga0157378_10024140 3300013297 Bacteria 5349
174 Ga0157378_10087806 3300013297 Unclassified 2821
175 Ga0157378_10109434 3300013297 Bacteria 2531
176 Ga0157378_10470642 3300013297 Bacteria 1250
177 Ga0157378_11770002 3300013297 Bacteria 666
178 Ga0163162_10000237 3300013306 Bacteria 50279
179 Ga0163162_10000824 3300013306 Bacteria 28851
180 Ga0163162_10618258 3300013306 Unclassified 1209
181 Ga0163162_11955486 3300013306 Bacteria 672
182 Ga0157372_10031301 3300013307 Bacteria 5826
183 Ga0157372_10035710 3300013307 Bacteria 5473
184 Ga0157372_10164190 3300013307 Bacteria 2568
185 Ga0157372_10200983 3300013307 Unclassified 2308
186 Ga0157372_10305261 3300013307 Unclassified 1852
187 Ga0157372_10662078 3300013307 Bacteria 1216
188 Ga0157375_10000599 3300013308 Bacteria 31988
189 Ga0157375_10032249 3300013308 Bacteria 4967
190 Ga0157375_10152426 3300013308 Bacteria 2448
191 Ga0157375_11458587 3300013308 Unclassified 807
192 Ga0163163_10001228 3300014325 Bacteria 21670
193 Ga0163163_10071388 3300014325 Bacteria 3460
194 Ga0163163_10611061 3300014325 Unclassified 1153
195 Ga0163163_11348649 3300014325 Unclassified 775
196 Ga0163163_11934140 3300014325 Unclassified 650
197 Ga0157380_10146760 3300014326 Unclassified 2034
198 Ga0157380_10233164 3300014326 Unclassified 1654
199 Ga0157380_10775248 3300014326 Unclassified 973
200 Ga0157380_10835483 3300014326 Bacteria 941
201 Ga0157380_11290491 3300014326 Bacteria 777
202 Ga0157377_10008371 3300014745 Bacteria 5043
203 Ga0157377_10098627 3300014745 Bacteria 1737
204 Ga0157377_10239656 3300014745 Unclassified 1170
205 Ga0157377_10406739 3300014745 Unclassified 928
206 Ga0157377_10506919 3300014745 Bacteria 844
207 Ga0157379_10002064 3300014968 Bacteria 16687
208 Ga0157379_10270584 3300014968 Unclassified 1545
209 Ga0157376_10000971 3300014969 Bacteria 18693
210 Ga0157376_10093677 3300014969 Bacteria 2608
211 Ga0157376_10239270 3300014969 Unclassified 1691
212 Ga0163161_10006338 3300017792 Bacteria 8189
213 Ga0163161_10428261 3300017792 Bacteria 1066
214 Ga0207666_1017641 3300025271 Unclassified 1032
215 Ga0207426_1000026 3300025302 Bacteria 515228
216 Ga0207656_10222273 3300025321 Unclassified 918
217 Ga0207682_10206617 3300025893 Unclassified 904
218 Ga0207642_10027537 3300025899 Bacteria 2327
219 Ga0207642_10028087 3300025899 Unclassified 2312
220 Ga0207710_10015100 3300025900 Bacteria 3261
221 Ga0207710_10301194 3300025900 Unclassified 810
222 Ga0207688_10187056 3300025901 Unclassified 1237
223 Ga0207680_10000014 3300025903 Bacteria 179035
224 Ga0207680_10040002 3300025903 Bacteria 2725
225 Ga0207647_10067188 3300025904 Bacteria 2173
226 Ga0207643_10003843 3300025908 Bacteria 8081
227 Ga0207643_10183097 3300025908 Unclassified 1269
228 Ga0207643_10240752 3300025908 Bacteria 1112
229 Ga0207705_10015886 3300025909 Bacteria 5405
230 Ga0207684_10336485 3300025910 Unclassified 1300
231 Ga0207654_10002088 3300025911 Bacteria 10232
232 Ga0207671_10007006 3300025914 Bacteria 9882
233 Ga0207660_10039630 3300025917 Bacteria 3294
234 Ga0207662_10002816 3300025918 Bacteria 8792
235 Ga0207662_10787152 3300025918 Bacteria 670
236 Ga0207657_10040339 3300025919 Bacteria 4137
237 Ga0207652_10037515 3300025921 Bacteria 4102
238 Ga0207652_10359222 3300025921 Bacteria 1315
239 Ga0207646_10351148 3300025922 Bacteria 1333
240 Ga0207681_10303393 3300025923 Unclassified 1264
241 Ga0207681_10490300 3300025923 Unclassified 1005
242 Ga0207650_10196716 3300025925 Bacteria 1613
243 Ga0207650_10611076 3300025925 Unclassified 917
244 Ga0207659_10743079 3300025926 Bacteria 841
245 Ga0207644_10315327 3300025931 Bacteria 1263
246 Ga0207644_10972538 3300025931 Bacteria 712
247 Ga0207706_10130361 3300025933 Bacteria 2212
248 Ga0207686_10000372 3300025934 Bacteria 31309
249 Ga0207670_10123207 3300025936 Bacteria 1888
250 Ga0207670_10148166 3300025936 Unclassified 1738
251 Ga0207669_10054518 3300025937 Bacteria 2415
252 Ga0207669_10149321 3300025937 Unclassified 1635
253 Ga0207669_10500443 3300025937 Unclassified 972
254 Ga0207704_10378858 3300025938 Bacteria 1110
255 Ga0207691_10021904 3300025940 Bacteria 6031
256 Ga0207691_10192290 3300025940 Bacteria 1779
257 Ga0207711_10181115 3300025941 Bacteria 1916
258 Ga0207689_10003396 3300025942 Bacteria 14542
259 Ga0207689_10027798 3300025942 Bacteria 4733
260 Ga0207689_10098140 3300025942 Bacteria 2406
261 Ga0207689_10169692 3300025942 Bacteria 1798
262 Ga0207661_10627992 3300025944 Bacteria 987
263 Ga0207661_11374901 3300025944 Bacteria 648
264 Ga0207679_10013776 3300025945 Bacteria 5303
265 Ga0207667_10614351 3300025949 Bacteria 1095
266 Ga0207651_10027740 3300025960 Bacteria 3562
267 Ga0207651_10314287 3300025960 Unclassified 1307
268 Ga0207651_11049364 3300025960 Unclassified 729
269 Ga0207651_11207752 3300025960 Bacteria 679
270 Ga0207712_10000874 3300025961 Bacteria 21909
271 Ga0207712_10076595 3300025961 Unclassified 2422
272 Ga0207712_10101541 3300025961 Unclassified 2139
273 Ga0207712_10238134 3300025961 Unclassified 1465
274 Ga0207712_10380291 3300025961 Bacteria 1181
275 Ga0207668_10598353 3300025972 Unclassified 960
276 Ga0207668_10770350 3300025972 Unclassified 850
277 Ga0207658_10298818 3300025986 Bacteria 1386
278 Ga0207658_10357963 3300025986 Bacteria 1272
279 Ga0207677_10767293 3300026023 Bacteria 861
280 Ga0207677_10777438 3300026023 Bacteria 855
281 Ga0207703_10009595 3300026035 Bacteria 7601
282 Ga0207639_11076188 3300026041 Bacteria 754
283 Ga0207708_10121818 3300026075 Unclassified 2032
284 Ga0207708_10192006 3300026075 Bacteria 1626
285 Ga0207708_10208980 3300026075 Unclassified 1559
286 Ga0207641_10000015 3300026088 Bacteria 321332
287 Ga0207641_10000088 3300026088 Bacteria 131959
288 Ga0207641_10021048 3300026088 Bacteria 5360
289 Ga0207641_10346110 3300026088 Bacteria 1416
290 Ga0207641_11027152 3300026088 Bacteria 822
291 Ga0207648_10006875 3300026089 Bacteria 11280
292 Ga0207648_10049475 3300026089 Bacteria 3678
293 Ga0207648_10275840 3300026089 Bacteria 1503
294 Ga0207648_10306410 3300026089 Unclassified 1425
295 Ga0207676_10036336 3300026095 Bacteria 3746
296 Ga0207676_10040224 3300026095 Bacteria 3582
297 Ga0207676_10522001 3300026095 Bacteria 1131
298 Ga0207676_10825868 3300026095 Unclassified 905
299 Ga0207674_10039749 3300026116 Bacteria 4875
300 Ga0207675_100007647 3300026118 Bacteria 10204
301 Ga0207675_100066647 3300026118 Bacteria 3366
302 Ga0207675_100588485 3300026118 Unclassified 1115
303 Ga0207675_100721552 3300026118 Unclassified 1007
304 Ga0207675_100997049 3300026118 Bacteria 856
305 Ga0207675_101147956 3300026118 Unclassified 797
306 Ga0207683_10020009 3300026121 Bacteria 5719
307 Ga0207683_10034547 3300026121 Bacteria 4394
308 Ga0207683_10085565 3300026121 Bacteria 2802
309 Ga0207683_10262968 3300026121 Bacteria 1575
310 Ga0207683_10866887 3300026121 Unclassified 838
311 Ga0207698_10029558 3300026142 Bacteria 3927
312 Ga0207698_10047315 3300026142 Unclassified 3257
313 Ga0207698_10473302 3300026142 Unclassified 1214
314 Ga0207698_10545417 3300026142 Unclassified 1136
315 Ga0268265_10739301 3300028380 Bacteria 954
316 Ga0268265_10806265 3300028380 Unclassified 915
317 Ga0268265_11268831 3300028380 Unclassified 736
318 Ga0268264_10006198 3300028381 Bacteria 10098
319 Ga0268264_10058014 3300028381 Bacteria 3240
320 Ga0268264_10473685 3300028381 Bacteria 1217
321 Ga0265324_10126367 3300029957 Bacteria 868
322 Ga0265328_10028171 3300031239 Bacteria 2103
323 Ga0265320_10065231 3300031240 Bacteria 1728
324 Ga0265331_10015721 3300031250 Bacteria 3989
325 Ga0265316_10247160 3300031344 Unclassified 1311
326 Ga0307509_10035284 3300031507 Bacteria 5491
327 Ga0307508_10000694 3300031616 Bacteria 40289
328 Ga0307508_10105711 3300031616 Unclassified 2413
329 Ga0307507_10327720 3300033179 Bacteria 917
330 Ga0395899_0007117 3300037312 Bacteria 8655
331 Ga0395900_0710536 3300037418 Unclassified 938
332 Ga0395898_0013909 3300037466 Bacteria 8270
333 Ga0395905_0549855 3300037471 Bacteria 1056
334 Ga0395901_0005761 3300038443 Bacteria 12552
335 Ga0436365_0450598 3300039437 Bacteria 38661
336 Ga0436362_0681831 3300039453 Bacteria 676
337 Ga0451791_1093420 3300041451 Bacteria 927
338 Ga0451804_0659079 3300041463 Unclassified 671
339 Ga0451853_1571982 3300041512 Bacteria 738
340 Ga0453684_0008300 3300044712 Bacteria 18697
341 Ga0453684_0712824 3300044712 Bacteria 1089
342 Ga0453684_0730719 3300044712 Bacteria 1073
343 Ga0451576_0160097 3300045051 Bacteria 2349
344 Ga0466967_0229313 3300045976 Bacteria 1768
345 Ga0466967_0684680 3300045976 Bacteria 1015
346 Ga0495594_0193142 3300046499 Unclassified 1160
347 Ga0495598_0050080 3300046537 Unclassified 1254
348 Ga0495621_0045868 3300046539 Bacteria 1549
349 Ga0495633_0396482 3300046558 Bacteria 624
350 Ga0495667_0341848 3300046559 Bacteria 946
351 Ga0495668_0001096 3300046616 Bacteria 28039
352 Ga0495659_0242823 3300046664 Bacteria 749
353 Ga0495588_0429018 3300046674 Bacteria 694
354 Ga0495670_0275201 3300046691 Bacteria 900
355 Ga0495674_0780271 3300047319 Unclassified 745
356 Ga0495686_0008111 3300047472 Bacteria 7767
357 Ga0496124_0039021 3300048927 Bacteria 4119
358 Ga0501034_0007543 3300049571 Bacteria 11573
359 Ga0501034_0055320 3300049571 Unclassified 3993
360 Ga0501034_0340930 3300049571 Bacteria 1429
361 Ga0501034_0412282 3300049571 Unclassified 1273
362 Ga0501070_0490098 3300049586 Bacteria 988
363 Ga0501269_002266 3300049766 Bacteria 2388
364 Ga0501035_0031625 3300049822 Bacteria 4820
365 Ga0501035_0261774 3300049822 Unclassified 1466
366 Ga0501044_0026045 3300049823 Bacteria 6194
367 Ga0501044_0609641 3300049823 Bacteria 984
368 nmdc:mga0k408_315174_c1 3300050493 Bacteria 933
369 nmdc:mga0k408_40414_c1 3300050493 Bacteria 2684
370 nmdc:mga05p37_279856_c1 3300050507 Unclassified 1990
371 nmdc:mga09592_397459_c1 3300050508 Bacteria 1191
372 nmdc:mga09592_79056_c1 3300050508 Bacteria 2799
373 nmdc:mga09592_945896_c1 3300050508 Bacteria 722
374 nmdc:mga09592_9597_c1 3300050508 Bacteria 7862
375 nmdc:mga06r32_77047_c1 3300050510 Unclassified 3238
376 nmdc:mga08y16_140864_c1 3300050511 Unclassified 2507
377 nmdc:mga08y16_50064_c1 3300050511 Unclassified 4371
378 Ga0500556_0019116 3300053104 Bacteria 2173
379 Ga0500559_0172154 3300053136 Bacteria 1018
380 Ga0500616_0003979 3300053153 Bacteria 10817
381 Ga0500627_0000843 3300053158 Bacteria 8198
382 2896113025 2896109856 Bacteria 7140722
383 Ga0207691_10045055
384 rootH1_10155573
385 rootL2_10143996
386 rootL2_10235023
387 rootH1_10099088
388 rootH1_10341299
389 JGI25160J50197_1000375
390 Ga0065704_10129942
391 Ga0065704_10148615
392 Ga0065712_10005258
393 Ga0065715_10009378
394 Ga0070658_10044331
395 Ga0070658_10500852
396 Ga0070683_100225861
397 Ga0070670_100235985
398 Ga0070670_100399113
399 Ga0070670_101096938
400 Ga0070677_10073470
401 Ga0070677_10473170
402 Ga0068869_100008852
403 Ga0068869_100028501
404 Ga0070666_10000030
405 Ga0070666_10038104
406 Ga0070680_100072919
407 Ga0070682_100458933
408 Ga0068868_100785993
409 Ga0068868_101171457
410 Ga0068868_101416108
411 Ga0070660_100044144
412 Ga0070689_100025280
413 Ga0070689_100838092
414 Ga0070691_10386405
415 Ga0070687_100651226
416 Ga0070668_100624483
417 Ga0070668_100702210
418 Ga0070669_100045943
419 Ga0070675_100049305
420 Ga0070675_100286458
421 Ga0070675_100357209
422 Ga0070675_100969928
423 Ga0070671_100011034
424 Ga0070671_100053047
425 Ga0070671_100270163
426 Ga0070671_100432406
427 Ga0070674_100031069
428 Ga0070674_100176947
429 Ga0070674_100350752
430 Ga0070673_100257055
431 Ga0070673_100353600
432 Ga0070673_101753857
433 Ga0070688_100100349
434 Ga0070688_100287045
435 Ga0070688_100585145
436 Ga0070659_100019085
437 Ga0070667_100079582
438 Ga0070667_100139426
439 Ga0070667_100218207
440 Ga0070667_100348944
441 Ga0070667_100970260
442 Ga0070701_10082585
443 Ga0070700_100080218
444 Ga0070700_100135710
445 Ga0070700_100143991
446 Ga0070663_100770927
447 Ga0070678_100035313
448 Ga0070678_100129425
449 Ga0070678_100258667
450 Ga0070678_100350833
451 Ga0068867_100126477
452 Ga0068867_100993120
453 Ga0068867_101237904
454 Ga0070685_10034877
455 Ga0070706_101214017
456 Ga0070707_100351288
457 Ga0070698_100001103
458 Ga0070698_100021829
459 Ga0070698_100026571
460 Ga0070699_100108261
461 Ga0070679_100219445
462 Ga0068853_101116427
463 Ga0070672_100106896
464 Ga0070672_100366086
465 Ga0070686_100003077
466 Ga0070665_100076488
467 Ga0068855_100000795
468 Ga0070664_100012885
469 Ga0068857_100039491
470 Ga0068857_100281752
471 Ga0068852_100038137
472 Ga0068852_100105668
473 Ga0068852_101420752
474 Ga0068859_100000003
475 Ga0068859_100197215
476 Ga0068859_100207189
477 Ga0068859_100260373
478 Ga0068859_100296013
479 Ga0068864_100020481
480 Ga0068864_100082551
481 Ga0068864_100390300
482 Ga0068866_10049163
483 Ga0068866_10106289
484 Ga0068866_10198682
485 Ga0068866_10578021
486 Ga0068861_100003315
487 Ga0068861_100027557
488 Ga0068861_100424027
489 Ga0068861_101021232
490 Ga0068851_10007506
491 Ga0068851_10249387
492 Ga0068851_10551927
493 Ga0068870_10013805
494 Ga0068870_10243604
495 Ga0068863_100004042
496 Ga0068863_100049408
497 Ga0068863_100062650
498 Ga0068863_100137939
499 Ga0068858_100012504
500 Ga0068858_100425104
501 Ga0068860_100004265
502 Ga0068860_100237123
503 Ga0068860_100506399
504 Ga0068862_100595538
505 Ga0081455_10255763
506 Ga0075366_10019670
507 Ga0075366_10299129
508 Ga0097621_100000352
509 Ga0097621_100195915
510 Ga0068871_100073855
511 Ga0068871_100253215
512 Ga0075428_100023526
513 Ga0075428_100093656
514 Ga0075431_100153606
515 Ga0075429_100015805
516 Ga0075429_100046759
517 Ga0097620_100000003
518 Ga0097620_100197203
519 Ga0097620_100207189
520 Ga0097620_100260388
521 Ga0097620_100296012
522 Ga0111539_10054803
523 Ga0111539_11113384
524 Ga0111539_11786489
525 Ga0105245_10651770
526 Ga0105247_10088179
527 Ga0105247_10122219
528 Ga0114129_10204970
529 Ga0105241_10000831
530 Ga0105241_10900763
531 Ga0105242_10019535
532 Ga0105242_10165544
533 Ga0105242_10197886
534 Ga0105242_10301866
535 Ga0105242_10858929
536 Ga0105248_10081795
537 Ga0105248_10297966
538 Ga0105237_10110501
539 Ga0105249_10002081
540 Ga0105249_10006036
541 Ga0105249_10260583
542 Ga0105249_10357206
543 Ga0105239_10121267
544 Ga0105246_10035861
545 Ga0105246_10080104
546 Ga0105246_10551842
547 Ga0157373_10142702
548 Ga0157371_10000668
549 Ga0157371_10026811
550 Ga0157370_10026304
551 Ga0157370_10034600
552 Ga0157370_10281116
553 Ga0157374_10154610
554 Ga0157374_11210502
555 Ga0157378_10024140
556 Ga0157378_10087806
557 Ga0157378_10109434
558 Ga0157378_10470642
559 Ga0157378_11770002
560 Ga0163162_10000237
561 Ga0163162_10000824
562 Ga0163162_10618258
563 Ga0163162_11955486
564 Ga0157372_10031301
565 Ga0157372_10035710
566 Ga0157372_10164190
567 Ga0157372_10200983
568 Ga0157372_10305261
569 Ga0157372_10662078
570 Ga0157375_10000599
571 Ga0157375_10032249
572 Ga0157375_10152426
573 Ga0157375_11458587
574 Ga0163163_10001228
575 Ga0163163_10071388
576 Ga0163163_10611061
577 Ga0163163_11348649
578 Ga0163163_11934140
579 Ga0157380_10146760
580 Ga0157380_10233164
581 Ga0157380_10775248
582 Ga0157380_10835483
583 Ga0157380_11290491
584 Ga0157377_10008371
585 Ga0157377_10098627
586 Ga0157377_10239656
587 Ga0157377_10406739
588 Ga0157377_10506919
589 Ga0157379_10002064
590 Ga0157379_10270584
591 Ga0157376_10000971
592 Ga0157376_10093677
593 Ga0157376_10239270
594 Ga0163161_10006338
595 Ga0163161_10428261
596 Ga0207666_1017641
597 Ga0207426_1000026
598 Ga0207656_10222273
599 Ga0207682_10206617
600 Ga0207642_10027537
601 Ga0207642_10028087
602 Ga0207710_10015100
603 Ga0207710_10301194
604 Ga0207688_10187056
605 Ga0207680_10000014
606 Ga0207680_10040002
607 Ga0207647_10067188
608 Ga0207643_10003843
609 Ga0207643_10183097
610 Ga0207643_10240752
611 Ga0207705_10015886
612 Ga0207684_10336485
613 Ga0207654_10002088
614 Ga0207671_10007006
615 Ga0207660_10039630
616 Ga0207662_10002816
617 Ga0207662_10787152
618 Ga0207657_10040339
619 Ga0207652_10037515
620 Ga0207652_10359222
621 Ga0207646_10351148
622 Ga0207681_10303393
623 Ga0207681_10490300
624 Ga0207650_10196716
625 Ga0207650_10611076
626 Ga0207659_10743079
627 Ga0207644_10315327
628 Ga0207644_10972538
629 Ga0207706_10130361
630 Ga0207686_10000372
631 Ga0207670_10123207
632 Ga0207670_10148166
633 Ga0207669_10054518
634 Ga0207669_10149321
635 Ga0207669_10500443
636 Ga0207704_10378858
637 Ga0207691_10021904
638 Ga0207691_10192290
639 Ga0207711_10181115
640 Ga0207689_10003396
641 Ga0207689_10027798
642 Ga0207689_10098140
643 Ga0207689_10169692
644 Ga0207661_10627992
645 Ga0207661_11374901
646 Ga0207679_10013776
647 Ga0207667_10614351
648 Ga0207651_10027740
649 Ga0207651_10314287
650 Ga0207651_11049364
651 Ga0207651_11207752
652 Ga0207712_10000874
653 Ga0207712_10076595
654 Ga0207712_10101541
655 Ga0207712_10238134
656 Ga0207712_10380291
657 Ga0207668_10598353
658 Ga0207668_10770350
659 Ga0207658_10298818
660 Ga0207658_10357963
661 Ga0207677_10767293
662 Ga0207677_10777438
663 Ga0207703_10009595
664 Ga0207639_11076188
665 Ga0207708_10121818
666 Ga0207708_10192006
667 Ga0207708_10208980
668 Ga0207641_10000015
669 Ga0207641_10000088
670 Ga0207641_10021048
671 Ga0207641_10346110
672 Ga0207641_11027152
673 Ga0207648_10006875
674 Ga0207648_10049475
675 Ga0207648_10275840
676 Ga0207648_10306410
677 Ga0207676_10036336
678 Ga0207676_10040224
679 Ga0207676_10522001
680 Ga0207676_10825868
681 Ga0207674_10039749
682 Ga0207675_100007647
683 Ga0207675_100066647
684 Ga0207675_100588485
685 Ga0207675_100721552
686 Ga0207675_100997049
687 Ga0207675_101147956
688 Ga0207683_10020009
689 Ga0207683_10034547
690 Ga0207683_10085565
691 Ga0207683_10262968
692 Ga0207683_10866887
693 Ga0207698_10029558
694 Ga0207698_10047315
695 Ga0207698_10473302
696 Ga0207698_10545417
697 Ga0268265_10739301
698 Ga0268265_10806265
699 Ga0268265_11268831
700 Ga0268264_10006198
701 Ga0268264_10058014
702 Ga0268264_10473685
703 Ga0265324_10126367
704 Ga0265328_10028171
705 Ga0265320_10065231
706 Ga0265331_10015721
707 Ga0265316_10247160
708 Ga0307509_10035284
709 Ga0307508_10000694
710 Ga0307508_10105711
711 Ga0307507_10327720
712 Ga0395899_0007117
713 Ga0395900_0710536
714 Ga0395898_0013909
715 Ga0395905_0549855
716 Ga0395901_0005761
717 Ga0436365_0450598
718 Ga0436362_0681831
719 Ga0451791_1093420
720 Ga0451804_0659079
721 Ga0451853_1571982
722 Ga0453684_0008300
723 Ga0453684_0712824
724 Ga0453684_0730719
725 Ga0451576_0160097
726 Ga0466967_0229313
727 Ga0466967_0684680
728 Ga0495594_0193142
729 Ga0495598_0050080
730 Ga0495621_0045868
731 Ga0495633_0396482
732 Ga0495667_0341848
733 Ga0495668_0001096
734 Ga0495659_0242823
735 Ga0495588_0429018
736 Ga0495670_0275201
737 Ga0495674_0780271
738 Ga0495686_0008111
739 Ga0496124_0039021
740 Ga0501034_0007543
741 Ga0501034_0055320
742 Ga0501034_0340930
743 Ga0501034_0412282
744 Ga0501070_0490098
745 Ga0501269_002266
746 Ga0501035_0031625
747 Ga0501035_0261774
748 Ga0501044_0026045
749 Ga0501044_0609641
750 nmdc:mga0k408_315174_c1
751 nmdc:mga0k408_40414_c1
752 nmdc:mga05p37_279856_c1
753 nmdc:mga09592_397459_c1
754 nmdc:mga09592_79056_c1
755 nmdc:mga09592_945896_c1
756 nmdc:mga09592_9597_c1
757 nmdc:mga06r32_77047_c1
758 nmdc:mga08y16_140864_c1
759 nmdc:mga08y16_50064_c1
760 Ga0500556_0019116
761 Ga0500559_0172154
762 Ga0500616_0003979
763 Ga0500627_0000843
764 2896113025

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10652

DUF2480

Protein of unknown function (DUF2480)

44

208

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zrz-assembly1.cif.gz_BP4 structure of the human trna splicing endonuclease defines substrate recognition 0.6411 125 168
1rgi-assembly1.cif.gz_A crystal structure of gelsolin domains g1-g3 bound to actin 0.5548 36 97
4lu9-assembly1.cif.gz_C crystal structure of e.coli sbcd at 2.5 angstrom resolution 0.5544 25 96
2q0x-assembly1.cif.gz_B alpha/beta hydrolase fold protein of unknown function 0.5175 49 113
4czh-assembly1.cif.gz_A c. crescentus mreb, single filament, adp, mp265 inhibitor 0.4849 40 100
ID Description Score Start End Superfamily
2gjwB03 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.6013 125 168 3.40.1350.10
af_I1LMG0_20_152_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5517 43 98 3.30.420.40
af_O18391_39_325_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5517 62 97 3.40.50.1820
af_A0A1D8PCJ9_329_593_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5294 46 101 3.30.420.40
af_A0A7I2V3D3_1_121_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5152 36 98 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A358G5C4-F1-model_v4 deleted 0.9816 42 97
AF-A0A520I116-F1-model_v4 DUF2480 family protein 0.9722 33 168
AF-A0A7Y1VN74-F1-model_v4 DUF2480 family protein 0.9649 37 168
AF-A0A520I116-F1-model_v4 DUF2480 family protein 0.9584 33 168
AF-A0A3D6EVN4-F1-model_v4 DUF2480 family protein 0.9564 1 168

Map