F429301

General Info

Members Datasets Scaffolds Average Seq Length
382 225 765 132

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10334810|Ga0265338_103348102
Length 150
Sequence MRLHDLKPRPGAKHRRKRLGQGESFEGGQMPLIRRMPKRGFNNANFTIRYLPVNLESLNRFDDGATVDIKALRDLGLAKGPGNAQRIKILGNGELKKKLVVNAHAFSASAKSKIEGLGGTCTVLVIPGPAPKIPASEKAKKAAAKTPEVK

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
112 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 2.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.57
Rhizosphere 97.12
Stem 0
Stem Tuber 0
Unclassified 13.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10334810 3300028800 Bacteria 1092
2 JGI24740J21852_10128513 3300001979 Unclassified 633
3 JGI24743J22301_10000748 3300001991 Bacteria 4062
4 rootH1_10007007 3300003316 Bacteria 7034
5 rootH1_10007007 3300003323 Bacteria 6457
6 Ga0007409J51694_1182499 3300003575 Bacteria 714
7 Ga0058863_11864930 3300004799 Bacteria 2105
8 Ga0058861_11687878 3300004800 Bacteria 1011
9 Ga0065707_10257723 3300005295 Bacteria 1106
10 Ga0070658_10095577 3300005327 Bacteria 2453
11 Ga0070658_10210604 3300005327 Unclassified 1642
12 Ga0070676_10728661 3300005328 Unclassified 726
13 Ga0070683_100598936 3300005329 Bacteria 1055
14 Ga0070683_101421045 3300005329 Bacteria 667
15 Ga0070690_100136559 3300005330 Bacteria 1661
16 Ga0068869_100621696 3300005334 Bacteria 914
17 Ga0070666_10015396 3300005335 Bacteria 4878
18 Ga0070666_10123770 3300005335 Bacteria 1794
19 Ga0068868_100059106 3300005338 Bacteria 3032
20 Ga0070689_100001047 3300005340 Bacteria 17395
21 Ga0070689_100824514 3300005340 Unclassified 817
22 Ga0070689_101910587 3300005340 Bacteria 542
23 Ga0070691_10118192 3300005341 Bacteria 1332
24 Ga0070687_100100390 3300005343 Bacteria 1619
25 Ga0070668_100620871 3300005347 Bacteria 947
26 Ga0070675_100087513 3300005354 Bacteria 2605
27 Ga0070671_100297462 3300005355 Bacteria 1374
28 Ga0070674_100445735 3300005356 Bacteria 1067
29 Ga0070673_100084154 3300005364 Bacteria 2586
30 Ga0070673_101349037 3300005364 Bacteria 670
31 Ga0070688_100200380 3300005365 Bacteria 1396
32 Ga0070688_100374652 3300005365 Bacteria 1048
33 Ga0070667_100219477 3300005367 Bacteria 1692
34 Ga0070714_100004475 3300005435 Bacteria 10531
35 Ga0070714_100428533 3300005435 Bacteria 1254
36 Ga0070713_101806556 3300005436 Unclassified 593
37 Ga0070711_100794500 3300005439 Unclassified 802
38 Ga0070705_100022698 3300005440 Bacteria 3357
39 Ga0070700_100505664 3300005441 Unclassified 930
40 Ga0070678_100181546 3300005456 Bacteria 1723
41 Ga0070681_10035935 3300005458 Bacteria 4977
42 Ga0070681_10818120 3300005458 Unclassified 849
43 Ga0070685_10359027 3300005466 Bacteria 998
44 Ga0070679_100407706 3300005530 Unclassified 1305
45 Ga0070686_100010098 3300005544 Bacteria 5313
46 Ga0070686_100020934 3300005544 Bacteria 3879
47 Ga0070686_100232529 3300005544 Bacteria 1338
48 Ga0070704_100261119 3300005549 Bacteria 1427
49 Ga0070704_100520608 3300005549 Bacteria 1035
50 Ga0068855_100069868 3300005563 Bacteria 4086
51 Ga0068856_100004352 3300005614 Bacteria 14113
52 Ga0068856_100006825 3300005614 Bacteria 11171
53 Ga0070702_100292498 3300005615 Bacteria 1123
54 Ga0068859_100246035 3300005617 Bacteria 1878
55 Ga0068859_100404555 3300005617 Bacteria 1461
56 Ga0068864_102194094 3300005618 Bacteria 559
57 Ga0068870_10085626 3300005840 Unclassified 1752
58 Ga0068863_100189864 3300005841 Bacteria 1974
59 Ga0068863_100935371 3300005841 Unclassified 868
60 Ga0068858_100377931 3300005842 Bacteria 1359
61 Ga0068858_100444196 3300005842 Unclassified 1249
62 Ga0068860_100049052 3300005843 Bacteria 4024
63 Ga0068862_100404625 3300005844 Bacteria 1277
64 Ga0070712_100370403 3300006175 Bacteria 1177
65 Ga0097621_100008773 3300006237 Bacteria 7304
66 Ga0097621_100957898 3300006237 Unclassified 799
67 Ga0068871_100391710 3300006358 Bacteria 1236
68 Ga0068871_100682155 3300006358 Bacteria 940
69 Ga0075428_100001579 3300006844 Bacteria 24421
70 Ga0075428_100393275 3300006844 Bacteria 1486
71 Ga0075428_100890473 3300006844 Unclassified 944
72 Ga0075430_100377056 3300006846 Bacteria 1171
73 Ga0075430_100399337 3300006846 Bacteria 1135
74 Ga0075430_101021182 3300006846 Bacteria 681
75 Ga0075431_100080459 3300006847 Bacteria 3364
76 Ga0075431_100701985 3300006847 Unclassified 989
77 Ga0075431_101320090 3300006847 Unclassified 682
78 Ga0075429_100072679 3300006880 Bacteria 2995
79 Ga0075429_100113811 3300006880 Bacteria 2365
80 Ga0068865_100507637 3300006881 Bacteria 1006
81 Ga0097620_100246054 3300006931 Bacteria 1878
82 Ga0097620_100404600 3300006931 Bacteria 1461
83 Ga0075435_100290019 3300007076 Bacteria 1398
84 Ga0099795_10471660 3300007788 Bacteria 581
85 Ga0105240_10002989 3300009093 Bacteria 26600
86 Ga0105240_10063083 3300009093 Bacteria 4611
87 Ga0111539_10009658 3300009094 Bacteria 12178
88 Ga0111539_10083379 3300009094 Bacteria 3759
89 Ga0111539_10654806 3300009094 Bacteria 1223
90 Ga0105241_10456917 3300009174 Bacteria 1131
91 Ga0105242_10130315 3300009176 Bacteria 2170
92 Ga0105242_10151642 3300009176 Bacteria 2021
93 Ga0105248_10468696 3300009177 Bacteria 1420
94 Ga0105248_10652845 3300009177 Bacteria 1187
95 Ga0105248_11375302 3300009177 Unclassified 799
96 Ga0105238_10068554 3300009551 Bacteria 3548
97 Ga0105249_10234861 3300009553 Bacteria 1810
98 Ga0105249_11479733 3300009553 Bacteria 751
99 Ga0157370_10119745 3300013104 Bacteria 2458
100 Ga0157370_10994623 3300013104 Bacteria 759
101 Ga0157369_10307894 3300013105 Unclassified 1647
102 Ga0157374_10071814 3300013296 Bacteria 3265
103 Ga0157374_10433969 3300013296 Unclassified 1313
104 Ga0157374_11386287 3300013296 Bacteria 726
105 Ga0157378_10203573 3300013297 Unclassified 1873
106 Ga0157378_10390045 3300013297 Bacteria 1369
107 Ga0157378_11195345 3300013297 Bacteria 800
108 Ga0163162_10267201 3300013306 Bacteria 1842
109 Ga0163162_10396067 3300013306 Bacteria 1513
110 Ga0163162_10640653 3300013306 Bacteria 1187
111 Ga0157372_10240224 3300013307 Bacteria 2102
112 Ga0157375_10000037 3300013308 Bacteria 176523
113 Ga0157375_10236177 3300013308 Bacteria 1987
114 Ga0157375_10378263 3300013308 Bacteria 1583
115 Ga0157375_10652996 3300013308 Unclassified 1208
116 Ga0163163_10000212 3300014325 Bacteria 60199
117 Ga0163163_10028664 3300014325 Bacteria 5350
118 Ga0163163_11908838 3300014325 Bacteria 654
119 Ga0157379_10519342 3300014968 Unclassified 1105
120 Ga0157376_10305189 3300014969 Bacteria 1508
121 Ga0157376_10736359 3300014969 Bacteria 994
122 Ga0213876_10000361 3300021384 Bacteria 38897
123 Ga0207697_10031631 3300025315 Bacteria 2165
124 Ga0207688_10042403 3300025901 Bacteria 2533
125 Ga0207680_10010521 3300025903 Bacteria 4631
126 Ga0207680_10150458 3300025903 Bacteria 1551
127 Ga0207705_10086158 3300025909 Bacteria 2295
128 Ga0207707_10051751 3300025912 Bacteria 3576
129 Ga0207695_10029957 3300025913 Bacteria 6001
130 Ga0207695_10037437 3300025913 Bacteria 5234
131 Ga0207695_10927087 3300025913 Bacteria 750
132 Ga0207693_10456821 3300025915 Unclassified 998
133 Ga0207657_11134874 3300025919 Unclassified 596
134 Ga0207652_10544536 3300025921 Unclassified 1043
135 Ga0207694_10043537 3300025924 Bacteria 3465
136 Ga0207687_10716282 3300025927 Bacteria 850
137 Ga0207700_10969757 3300025928 Unclassified 761
138 Ga0207664_10001982 3300025929 Bacteria 13482
139 Ga0207664_10322643 3300025929 Bacteria 1363
140 Ga0207644_10347232 3300025931 Bacteria 1204
141 Ga0207686_10423964 3300025934 Bacteria 1018
142 Ga0207670_10026107 3300025936 Bacteria 3678
143 Ga0207670_10291120 3300025936 Bacteria 1276
144 Ga0207670_10791938 3300025936 Bacteria 789
145 Ga0207669_10516235 3300025937 Unclassified 959
146 Ga0207704_10416804 3300025938 Bacteria 1064
147 Ga0207665_10391780 3300025939 Bacteria 1056
148 Ga0207711_10947147 3300025941 Unclassified 800
149 Ga0207661_10051419 3300025944 Bacteria 3288
150 Ga0207667_10100965 3300025949 Bacteria 2976
151 Ga0207651_10276024 3300025960 Bacteria 1387
152 Ga0207658_10137117 3300025986 Bacteria 1975
153 Ga0207677_10458291 3300026023 Bacteria 1094
154 Ga0207703_10321077 3300026035 Unclassified 1418
155 Ga0207703_10952115 3300026035 Unclassified 823
156 Ga0207708_10597765 3300026075 Unclassified 934
157 Ga0207702_10001362 3300026078 Bacteria 24381
158 Ga0207702_10003580 3300026078 Bacteria 14118
159 Ga0207641_10024032 3300026088 Bacteria 5022
160 Ga0207641_10356466 3300026088 Bacteria 1395
161 Ga0207641_11326897 3300026088 Bacteria 720
162 Ga0207676_10278886 3300026095 Bacteria 1517
163 Ga0207674_10179878 3300026116 Bacteria 2066
164 Ga0207675_101085632 3300026118 Unclassified 820
165 Ga0207683_10331125 3300026121 Bacteria 1396
166 Ga0207428_10246419 3300027907 Bacteria 1333
167 Ga0268264_10366418 3300028381 Bacteria 1376
168 Ga0265337_1002415 3300028556 Bacteria 8596
169 Ga0265326_10001638 3300028558 Bacteria 7751
170 Ga0265319_1024377 3300028563 Bacteria 2179
171 Ga0265334_10095986 3300028573 Bacteria 1077
172 Ga0265322_10067793 3300028654 Unclassified 1012
173 Ga0265338_10000105 3300028800 Bacteria 156108
174 Ga0265338_10000135 3300028800 Bacteria 135743
175 Ga0265338_10007414 3300028800 Bacteria 13622
176 Ga0265338_10010461 3300028800 Bacteria 10871
177 Ga0265338_10017285 3300028800 Bacteria 7784
178 Ga0265338_10022741 3300028800 Bacteria 6474
179 Ga0265338_10069919 3300028800 Bacteria 3013
180 Ga0265338_10071479 3300028800 Bacteria 2968
181 Ga0265338_10085242 3300028800 Bacteria 2634
182 Ga0265324_10000614 3300029957 Bacteria 24339
183 Ga0265324_10002113 3300029957 Bacteria 10473
184 Ga0265324_10020426 3300029957 Bacteria 2380
185 Ga0265324_10030895 3300029957 Bacteria 1878
186 Ga0265324_10100369 3300029957 Bacteria 984
187 Ga0265332_10086432 3300031238 Bacteria 1328
188 Ga0265320_10253701 3300031240 Bacteria 780
189 Ga0265325_10104178 3300031241 Bacteria 1386
190 Ga0265340_10007372 3300031247 Bacteria 5973
191 Ga0265339_10011597 3300031249 Bacteria 5416
192 Ga0265331_10104293 3300031250 Bacteria 1303
193 Ga0265331_10121343 3300031250 Bacteria 1195
194 Ga0265327_10002213 3300031251 Bacteria 21222
195 Ga0265327_10004484 3300031251 Bacteria 12338
196 Ga0265327_10019720 3300031251 Bacteria 4135
197 Ga0265316_10644914 3300031344 Bacteria 749
198 Ga0265314_10494537 3300031711 Bacteria 645
199 Ga0265342_10095370 3300031712 Bacteria 1701
200 Ga0307413_10990790 3300031824 Bacteria 720
201 Ga0307416_101420661 3300032002 Bacteria 800
202 Ga0373938_0145535 3300034957 Bacteria 627
203 Ga0373926_0004254 3300035083 Unclassified 4680
204 Ga0373951_0048859 3300035091 Bacteria 1037
205 Ga0373923_0271026 3300035111 Bacteria 798
206 Ga0373945_0029895 3300035116 Bacteria 1917
207 Ga0373954_0359311 3300035118 Unclassified 719
208 Ga0373956_0505918 3300035119 Bacteria 576
209 Ga0373943_0203429 3300035170 Bacteria 1097
210 Ga0373955_0728336 3300035172 Bacteria 609
211 Ga0373931_0381994 3300035691 Bacteria 888
212 Ga0373931_0543283 3300035691 Bacteria 754
213 Ga0373931_0898965 3300035691 Bacteria 595
214 Ga0373935_0032404 3300035692 Bacteria 3248
215 Ga0373927_0001357 3300035695 Bacteria 18448
216 Ga0373947_0134420 3300035725 Bacteria 1581
217 Ga0373947_0845120 3300035725 Bacteria 625
218 Ga0373937_0052485 3300036401 Bacteria 3738
219 Ga0373937_0287542 3300036401 Bacteria 1553
220 Ga0373937_0331794 3300036401 Unclassified 1440
221 Ga0373937_1904026 3300036401 Unclassified 541
222 Ga0316584_0043257 3300036712 Bacteria 3359
223 Ga0373925_0005962 3300037068 Bacteria 9028
224 Ga0373925_0022607 3300037068 Bacteria 4589
225 Ga0395899_0000039 3300037312 Bacteria 269620
226 Ga0395898_0000226 3300037466 Bacteria 144727
227 Ga0436364_0785290 3300037853 Bacteria 2181
228 Ga0436365_1383407 3300039437 Bacteria 77328
229 Ga0451793_0091554 3300041452 Bacteria 824
230 Ga0451805_068142 3300041461 Unclassified 903
231 Ga0451807_2359324 3300041486 Bacteria 1165
232 Ga0451835_0921120 3300041492 Bacteria 562
233 Ga0451577_0001340 3300042876 Bacteria 33403
234 Ga0451577_0018671 3300042876 Bacteria 6383
235 Ga0451577_0131160 3300042876 Bacteria 2248
236 Ga0451577_0575049 3300042876 Bacteria 1023
237 Ga0451577_1412934 3300042876 Bacteria 617
238 Ga0466964_0005699 3300044706 Bacteria 4634
239 Ga0453684_0000532 3300044712 Bacteria 145255
240 Ga0453684_0008216 3300044712 Bacteria 18819
241 Ga0453684_0017342 3300044712 Bacteria 11158
242 Ga0453684_0023833 3300044712 Bacteria 8984
243 Ga0453684_0054509 3300044712 Bacteria 5208
244 Ga0453684_0180693 3300044712 Bacteria 2477
245 Ga0453684_0269206 3300044712 Bacteria 1948
246 Ga0453684_0892913 3300044712 Bacteria 952
247 Ga0466971_0000005 3300044719 Bacteria 137073
248 Ga0466957_0059454 3300044842 Bacteria 2343
249 Ga0466959_0690388 3300045049 Bacteria 684
250 Ga0451576_0036193 3300045051 Bacteria 5234
251 Ga0451576_0173056 3300045051 Bacteria 2254
252 Ga0451576_0173886 3300045051 Bacteria 2248
253 Ga0451576_0182561 3300045051 Bacteria 2191
254 Ga0451576_0230720 3300045051 Unclassified 1933
255 Ga0451576_0359641 3300045051 Bacteria 1524
256 Ga0451576_0657598 3300045051 Unclassified 1101
257 Ga0451576_0729607 3300045051 Unclassified 1041
258 Ga0451576_1005904 3300045051 Unclassified 874
259 Ga0466967_0088574 3300045976 Bacteria 2809
260 Ga0495592_0000015 3300046454 Bacteria 145683
261 Ga0495592_0525615 3300046454 Unclassified 731
262 Ga0495629_0070936 3300046459 Bacteria 2431
263 Ga0495629_0967503 3300046459 Bacteria 555
264 Ga0495641_0016861 3300046461 Bacteria 3830
265 Ga0495651_0060453 3300046462 Bacteria 2902
266 Ga0495651_0125409 3300046462 Unclassified 1881
267 Ga0495653_0526468 3300046463 Bacteria 734
268 Ga0495582_0006802 3300046473 Bacteria 6363
269 Ga0495582_0211262 3300046473 Bacteria 1109
270 Ga0495662_0236940 3300046476 Bacteria 899
271 Ga0495664_0171619 3300046477 Bacteria 1315
272 Ga0495618_0001289 3300046514 Bacteria 16917
273 Ga0495618_0564722 3300046514 Bacteria 680
274 Ga0495628_0000722 3300046516 Bacteria 30647
275 Ga0495628_0094980 3300046516 Bacteria 2304
276 Ga0495630_0000076 3300046517 Bacteria 77289
277 Ga0495630_0009669 3300046517 Bacteria 6935
278 Ga0495630_0631558 3300046517 Bacteria 820
279 Ga0495666_0005257 3300046526 Bacteria 6529
280 Ga0495666_0069860 3300046526 Bacteria 1670
281 Ga0495652_0019958 3300046529 Bacteria 5960
282 Ga0495665_0044128 3300046531 Bacteria 2370
283 Ga0495640_0005038 3300046533 Bacteria 10496
284 Ga0495640_0080884 3300046533 Bacteria 2160
285 Ga0495640_0103649 3300046533 Bacteria 1865
286 Ga0495586_0000001 3300046535 Bacteria 231314
287 Ga0495586_0000979 3300046535 Bacteria 16168
288 Ga0495586_0087260 3300046535 Bacteria 1720
289 Ga0495586_0151351 3300046535 Archaea 1305
290 Ga0495621_0348459 3300046539 Unclassified 621
291 Ga0495645_0019740 3300046543 Bacteria 4855
292 Ga0495645_0122263 3300046543 Bacteria 1832
293 Ga0495645_0228346 3300046543 Bacteria 1248
294 Ga0495667_0704399 3300046559 Bacteria 626
295 Ga0495634_0007513 3300046642 Bacteria 8171
296 Ga0495634_0100650 3300046642 Bacteria 1867
297 Ga0495634_0251579 3300046642 Bacteria 1081
298 Ga0495635_0080101 3300046663 Bacteria 2235
299 Ga0495635_0366442 3300046663 Bacteria 960
300 Ga0495599_0002301 3300046678 Bacteria 11109
301 Ga0495599_0498700 3300046678 Bacteria 717
302 Ga0495646_0128418 3300046680 Bacteria 1429
303 Ga0495647_0007682 3300046681 Bacteria 3621
304 Ga0495658_0075050 3300046683 Bacteria 1972
305 Ga0495658_0080901 3300046683 Bacteria 1906
306 Ga0495658_0900739 3300046683 Unclassified 565
307 Ga0495669_0620529 3300046684 Unclassified 526
308 Ga0495613_0134368 3300046689 Bacteria 1770
309 Ga0495613_0225146 3300046689 Bacteria 1315
310 Ga0495624_0052468 3300046690 Bacteria 2577
311 Ga0495581_0314196 3300047315 Bacteria 915
312 Ga0495581_0475221 3300047315 Unclassified 727
313 Ga0495674_0000992 3300047319 Bacteria 27284
314 Ga0495674_0009667 3300047319 Bacteria 9156
315 Ga0495676_0008529 3300047321 Bacteria 9393
316 Ga0495676_0287745 3300047321 Bacteria 1111
317 Ga0495675_0187458 3300047444 Bacteria 1264
318 Ga0495684_0533871 3300047471 Bacteria 801
319 Ga0495684_0822724 3300047471 Bacteria 605
320 Ga0495684_0842262 3300047471 Unclassified 596
321 Ga0495614_0332426 3300048089 Unclassified 706
322 Ga0496106_0096451 3300048909 Bacteria 2288
323 Ga0496107_0029552 3300048910 Bacteria 3900
324 Ga0496115_0002169 3300048918 Bacteria 14046
325 Ga0501312_045279 3300049528 Bacteria 729
326 Ga0501031_0000292 3300049568 Bacteria 28530
327 Ga0501031_0000635 3300049568 Bacteria 20764
328 Ga0501031_0012892 3300049568 Bacteria 5461
329 Ga0501032_0017049 3300049569 Bacteria 5103
330 Ga0501032_0046887 3300049569 Bacteria 2920
331 Ga0501032_0094555 3300049569 Bacteria 1981
332 Ga0501032_0312344 3300049569 Bacteria 1015
333 Ga0501032_0404168 3300049569 Bacteria 877
334 Ga0501033_0000015 3300049570 Bacteria 218502
335 Ga0501033_0009054 3300049570 Bacteria 7681
336 Ga0501033_0029324 3300049570 Bacteria 4135
337 Ga0501033_0042133 3300049570 Bacteria 3404
338 Ga0501034_0146817 3300049571 Bacteria 2335
339 Ga0501034_0700930 3300049571 Bacteria 911
340 Ga0501036_0013849 3300049572 Bacteria 6707
341 Ga0501037_0000295 3300049573 Bacteria 42165
342 Ga0501037_0029331 3300049573 Bacteria 4065
343 Ga0501037_0068544 3300049573 Bacteria 2583
344 Ga0501038_0066434 3300049574 Bacteria 3071
345 Ga0501038_0073690 3300049574 Bacteria 2890
346 Ga0501039_0022279 3300049575 Bacteria 4863
347 Ga0501039_0714426 3300049575 Bacteria 783
348 Ga0501039_1159684 3300049575 Unclassified 598
349 Ga0501043_0069626 3300049579 Bacteria 2763
350 Ga0501046_0210150 3300049580 Bacteria 1445
351 Ga0501046_0682621 3300049580 Bacteria 724
352 Ga0501047_0243754 3300049581 Bacteria 1647
353 Ga0501047_1006068 3300049581 Bacteria 647
354 Ga0501070_0002360 3300049586 Bacteria 16550
355 Ga0501070_0250134 3300049586 Bacteria 1450
356 Ga0501070_1061293 3300049586 Bacteria 626
357 Ga0501073_0374352 3300049589 Bacteria 984
358 Ga0501035_0000004 3300049822 Bacteria 403650
359 Ga0501035_0011308 3300049822 Bacteria 8272
360 Ga0501035_0085393 3300049822 Bacteria 2782
361 Ga0501035_0211676 3300049822 Bacteria 1658
362 Ga0501044_0000427 3300049823 Bacteria 52004
363 Ga0501044_0000740 3300049823 Bacteria 39382
364 Ga0501044_0011226 3300049823 Bacteria 9713
365 Ga0501044_0104812 3300049823 Bacteria 2841
366 nmdc:mga09592_1077206_c1 3300050508 Bacteria 669
367 nmdc:mga0qj67_1149961_c1 3300050509 Bacteria 605
368 nmdc:mga0qj67_914650_c1 3300050509 Bacteria 691
369 nmdc:mga06r32_13339_c1 3300050510 Bacteria 7443
370 nmdc:mga06r32_186518_c1 3300050510 Bacteria 2061
371 nmdc:mga08y16_14664_c1 3300050511 Bacteria 8241
372 nmdc:mga08y16_2184937_c1 3300050511 Bacteria 500
373 nmdc:mga08y16_94250_c1 3300050511 Bacteria 3119
374 nmdc:mga0rr50_288868_c1 3300050513 Unclassified 1370
375 nmdc:mga0rr50_83944_c1 3300050513 Bacteria 2464
376 nmdc:mga0a205_673115_c1 3300050515 Bacteria 885
377 nmdc:mga0a205_779753_c1 3300050515 Bacteria 804
378 Ga0495595_0445173 3300053084 Unclassified 658
379 Ga0495619_0347108 3300053085 Bacteria 1027
380 Ga0587073_0156347 3300059492 Bacteria 649
381 Ga0587109_100508 3300059624 Bacteria 664
382 Ga0587076_126487 3300059645 Bacteria 598
383 Ga0466962_0000007 3300061719 Bacteria 157857
384 Ga0265338_10334810
385 JGI24740J21852_10128513
386 JGI24743J22301_10000748
387 rootH1_10007007
388 Ga0007409J51694_1182499
389 Ga0058863_11864930
390 Ga0058861_11687878
391 Ga0065707_10257723
392 Ga0070658_10095577
393 Ga0070658_10210604
394 Ga0070676_10728661
395 Ga0070683_100598936
396 Ga0070683_101421045
397 Ga0070690_100136559
398 Ga0068869_100621696
399 Ga0070666_10015396
400 Ga0070666_10123770
401 Ga0068868_100059106
402 Ga0070689_100001047
403 Ga0070689_100824514
404 Ga0070689_101910587
405 Ga0070691_10118192
406 Ga0070687_100100390
407 Ga0070668_100620871
408 Ga0070675_100087513
409 Ga0070671_100297462
410 Ga0070674_100445735
411 Ga0070673_100084154
412 Ga0070673_101349037
413 Ga0070688_100200380
414 Ga0070688_100374652
415 Ga0070667_100219477
416 Ga0070714_100004475
417 Ga0070714_100428533
418 Ga0070713_101806556
419 Ga0070711_100794500
420 Ga0070705_100022698
421 Ga0070700_100505664
422 Ga0070678_100181546
423 Ga0070681_10035935
424 Ga0070681_10818120
425 Ga0070685_10359027
426 Ga0070679_100407706
427 Ga0070686_100010098
428 Ga0070686_100020934
429 Ga0070686_100232529
430 Ga0070704_100261119
431 Ga0070704_100520608
432 Ga0068855_100069868
433 Ga0068856_100004352
434 Ga0068856_100006825
435 Ga0070702_100292498
436 Ga0068859_100246035
437 Ga0068859_100404555
438 Ga0068864_102194094
439 Ga0068870_10085626
440 Ga0068863_100189864
441 Ga0068863_100935371
442 Ga0068858_100377931
443 Ga0068858_100444196
444 Ga0068860_100049052
445 Ga0068862_100404625
446 Ga0070712_100370403
447 Ga0097621_100008773
448 Ga0097621_100957898
449 Ga0068871_100391710
450 Ga0068871_100682155
451 Ga0075428_100001579
452 Ga0075428_100393275
453 Ga0075428_100890473
454 Ga0075430_100377056
455 Ga0075430_100399337
456 Ga0075430_101021182
457 Ga0075431_100080459
458 Ga0075431_100701985
459 Ga0075431_101320090
460 Ga0075429_100072679
461 Ga0075429_100113811
462 Ga0068865_100507637
463 Ga0097620_100246054
464 Ga0097620_100404600
465 Ga0075435_100290019
466 Ga0099795_10471660
467 Ga0105240_10002989
468 Ga0105240_10063083
469 Ga0111539_10009658
470 Ga0111539_10083379
471 Ga0111539_10654806
472 Ga0105241_10456917
473 Ga0105242_10130315
474 Ga0105242_10151642
475 Ga0105248_10468696
476 Ga0105248_10652845
477 Ga0105248_11375302
478 Ga0105238_10068554
479 Ga0105249_10234861
480 Ga0105249_11479733
481 Ga0157370_10119745
482 Ga0157370_10994623
483 Ga0157369_10307894
484 Ga0157374_10071814
485 Ga0157374_10433969
486 Ga0157374_11386287
487 Ga0157378_10203573
488 Ga0157378_10390045
489 Ga0157378_11195345
490 Ga0163162_10267201
491 Ga0163162_10396067
492 Ga0163162_10640653
493 Ga0157372_10240224
494 Ga0157375_10000037
495 Ga0157375_10236177
496 Ga0157375_10378263
497 Ga0157375_10652996
498 Ga0163163_10000212
499 Ga0163163_10028664
500 Ga0163163_11908838
501 Ga0157379_10519342
502 Ga0157376_10305189
503 Ga0157376_10736359
504 Ga0213876_10000361
505 Ga0207697_10031631
506 Ga0207688_10042403
507 Ga0207680_10010521
508 Ga0207680_10150458
509 Ga0207705_10086158
510 Ga0207707_10051751
511 Ga0207695_10029957
512 Ga0207695_10037437
513 Ga0207695_10927087
514 Ga0207693_10456821
515 Ga0207657_11134874
516 Ga0207652_10544536
517 Ga0207694_10043537
518 Ga0207687_10716282
519 Ga0207700_10969757
520 Ga0207664_10001982
521 Ga0207664_10322643
522 Ga0207644_10347232
523 Ga0207686_10423964
524 Ga0207670_10026107
525 Ga0207670_10291120
526 Ga0207670_10791938
527 Ga0207669_10516235
528 Ga0207704_10416804
529 Ga0207665_10391780
530 Ga0207711_10947147
531 Ga0207661_10051419
532 Ga0207667_10100965
533 Ga0207651_10276024
534 Ga0207658_10137117
535 Ga0207677_10458291
536 Ga0207703_10321077
537 Ga0207703_10952115
538 Ga0207708_10597765
539 Ga0207702_10001362
540 Ga0207702_10003580
541 Ga0207641_10024032
542 Ga0207641_10356466
543 Ga0207641_11326897
544 Ga0207676_10278886
545 Ga0207674_10179878
546 Ga0207675_101085632
547 Ga0207683_10331125
548 Ga0207428_10246419
549 Ga0268264_10366418
550 Ga0265337_1002415
551 Ga0265326_10001638
552 Ga0265319_1024377
553 Ga0265334_10095986
554 Ga0265322_10067793
555 Ga0265338_10000105
556 Ga0265338_10000135
557 Ga0265338_10007414
558 Ga0265338_10010461
559 Ga0265338_10017285
560 Ga0265338_10022741
561 Ga0265338_10069919
562 Ga0265338_10071479
563 Ga0265338_10085242
564 Ga0265324_10000614
565 Ga0265324_10002113
566 Ga0265324_10020426
567 Ga0265324_10030895
568 Ga0265324_10100369
569 Ga0265332_10086432
570 Ga0265320_10253701
571 Ga0265325_10104178
572 Ga0265340_10007372
573 Ga0265339_10011597
574 Ga0265331_10104293
575 Ga0265331_10121343
576 Ga0265327_10002213
577 Ga0265327_10004484
578 Ga0265327_10019720
579 Ga0265316_10644914
580 Ga0265314_10494537
581 Ga0265342_10095370
582 Ga0307413_10990790
583 Ga0307416_101420661
584 Ga0373938_0145535
585 Ga0373926_0004254
586 Ga0373951_0048859
587 Ga0373923_0271026
588 Ga0373945_0029895
589 Ga0373954_0359311
590 Ga0373956_0505918
591 Ga0373943_0203429
592 Ga0373955_0728336
593 Ga0373931_0381994
594 Ga0373931_0543283
595 Ga0373931_0898965
596 Ga0373935_0032404
597 Ga0373927_0001357
598 Ga0373947_0134420
599 Ga0373947_0845120
600 Ga0373937_0052485
601 Ga0373937_0287542
602 Ga0373937_0331794
603 Ga0373937_1904026
604 Ga0316584_0043257
605 Ga0373925_0005962
606 Ga0373925_0022607
607 Ga0395899_0000039
608 Ga0395898_0000226
609 Ga0436364_0785290
610 Ga0436365_1383407
611 Ga0451793_0091554
612 Ga0451805_068142
613 Ga0451807_2359324
614 Ga0451835_0921120
615 Ga0451577_0001340
616 Ga0451577_0018671
617 Ga0451577_0131160
618 Ga0451577_0575049
619 Ga0451577_1412934
620 Ga0466964_0005699
621 Ga0453684_0000532
622 Ga0453684_0008216
623 Ga0453684_0017342
624 Ga0453684_0023833
625 Ga0453684_0054509
626 Ga0453684_0180693
627 Ga0453684_0269206
628 Ga0453684_0892913
629 Ga0466971_0000005
630 Ga0466957_0059454
631 Ga0466959_0690388
632 Ga0451576_0036193
633 Ga0451576_0173056
634 Ga0451576_0173886
635 Ga0451576_0182561
636 Ga0451576_0230720
637 Ga0451576_0359641
638 Ga0451576_0657598
639 Ga0451576_0729607
640 Ga0451576_1005904
641 Ga0466967_0088574
642 Ga0495592_0000015
643 Ga0495592_0525615
644 Ga0495629_0070936
645 Ga0495629_0967503
646 Ga0495641_0016861
647 Ga0495651_0060453
648 Ga0495651_0125409
649 Ga0495653_0526468
650 Ga0495582_0006802
651 Ga0495582_0211262
652 Ga0495662_0236940
653 Ga0495664_0171619
654 Ga0495618_0001289
655 Ga0495618_0564722
656 Ga0495628_0000722
657 Ga0495628_0094980
658 Ga0495630_0000076
659 Ga0495630_0009669
660 Ga0495630_0631558
661 Ga0495666_0005257
662 Ga0495666_0069860
663 Ga0495652_0019958
664 Ga0495665_0044128
665 Ga0495640_0005038
666 Ga0495640_0080884
667 Ga0495640_0103649
668 Ga0495586_0000001
669 Ga0495586_0000979
670 Ga0495586_0087260
671 Ga0495586_0151351
672 Ga0495621_0348459
673 Ga0495645_0019740
674 Ga0495645_0122263
675 Ga0495645_0228346
676 Ga0495667_0704399
677 Ga0495634_0007513
678 Ga0495634_0100650
679 Ga0495634_0251579
680 Ga0495635_0080101
681 Ga0495635_0366442
682 Ga0495599_0002301
683 Ga0495599_0498700
684 Ga0495646_0128418
685 Ga0495647_0007682
686 Ga0495658_0075050
687 Ga0495658_0080901
688 Ga0495658_0900739
689 Ga0495669_0620529
690 Ga0495613_0134368
691 Ga0495613_0225146
692 Ga0495624_0052468
693 Ga0495581_0314196
694 Ga0495581_0475221
695 Ga0495674_0000992
696 Ga0495674_0009667
697 Ga0495676_0008529
698 Ga0495676_0287745
699 Ga0495675_0187458
700 Ga0495684_0533871
701 Ga0495684_0822724
702 Ga0495684_0842262
703 Ga0495614_0332426
704 Ga0496106_0096451
705 Ga0496107_0029552
706 Ga0496115_0002169
707 Ga0501312_045279
708 Ga0501031_0000292
709 Ga0501031_0000635
710 Ga0501031_0012892
711 Ga0501032_0017049
712 Ga0501032_0046887
713 Ga0501032_0094555
714 Ga0501032_0312344
715 Ga0501032_0404168
716 Ga0501033_0000015
717 Ga0501033_0009054
718 Ga0501033_0029324
719 Ga0501033_0042133
720 Ga0501034_0146817
721 Ga0501034_0700930
722 Ga0501036_0013849
723 Ga0501037_0000295
724 Ga0501037_0029331
725 Ga0501037_0068544
726 Ga0501038_0066434
727 Ga0501038_0073690
728 Ga0501039_0022279
729 Ga0501039_0714426
730 Ga0501039_1159684
731 Ga0501043_0069626
732 Ga0501046_0210150
733 Ga0501046_0682621
734 Ga0501047_0243754
735 Ga0501047_1006068
736 Ga0501070_0002360
737 Ga0501070_0250134
738 Ga0501070_1061293
739 Ga0501073_0374352
740 Ga0501035_0000004
741 Ga0501035_0011308
742 Ga0501035_0085393
743 Ga0501035_0211676
744 Ga0501044_0000427
745 Ga0501044_0000740
746 Ga0501044_0011226
747 Ga0501044_0104812
748 nmdc:mga09592_1077206_c1
749 nmdc:mga0qj67_1149961_c1
750 nmdc:mga0qj67_914650_c1
751 nmdc:mga06r32_13339_c1
752 nmdc:mga06r32_186518_c1
753 nmdc:mga08y16_14664_c1
754 nmdc:mga08y16_2184937_c1
755 nmdc:mga08y16_94250_c1
756 nmdc:mga0rr50_288868_c1
757 nmdc:mga0rr50_83944_c1
758 nmdc:mga0a205_673115_c1
759 nmdc:mga0a205_779753_c1
760 Ga0495595_0445173
761 Ga0495619_0347108
762 Ga0587073_0156347
763 Ga0587109_100508
764 Ga0587076_126487
765 Ga0466962_0000007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

8

122

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p90-assembly1.cif.gz_A the three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution 0.8975 100 123
6th6-assembly1.cif.gz_BR cryo-em structure of t. kodakarensis 70s ribosome 0.8679 53 123
4v6u-assembly1.cif.gz_BP promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes 0.8375 54 123
6hix-assembly1.cif.gz_AP cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit 0.8151 48 121
1w2b-assembly1.cif.gz_N trigger factor ribosome binding domain in complex with 50s 0.8065 53 122
ID Description Score Start End Superfamily
af_P0A0F8_66_146_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9686 48 124 3.100.10.10
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9284 53 121 3.100.10.10
af_Q10PV6_148_224_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9184 53 122 3.100.10.10
af_A0A0R0I064_101_171_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9172 62 123 3.100.10.10
af_A0A0G2K9B4_85_176_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9168 47 124 3.100.10.10
ID Description Score Start End GO Terms
AF-A0A351AEJ9-F1-model_v4 50S ribosomal protein L15 0.9882 48 124 GO:0003735
GO:0006412
GO:0022625
AF-S2TBB5-F1-model_v4 50S ribosomal protein L15 0.9744 51 124 GO:0003735
GO:0006412
GO:0022625
AF-A0A2C9ZT39-F1-model_v4 deleted 0.9727 53 124
AF-A0A4V1QUN6-F1-model_v4 50S ribosomal protein L15 0.969 51 127 GO:0003735
GO:0005840
GO:0006412
GO:0016020
GO:0030313
GO:1990904
AF-A0A0X8B1C0-F1-model_v4 50S ribosomal protein L15 0.9665 55 124 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map