F429307

General Info

Members Datasets Scaffolds Average Seq Length
382 275 764 268

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10019856|Ga0316579_100198562
Length 332
Sequence MPVIGHELRSCTKCIHAKHRLLRRKPRAARSNLPFRSEEVPGEGNGEKSPGDVIVPTSKLQQRTLTALLIAPIGIAAVLLLPTPDLALCLGLVLMLAAWEWAALAGVASPAGRLAYAALVALCLFLLWQPALRQWFAYLTAAVVIFWCGVAVFLLRLRTIERKSGPDPAMALTGLVVLIGPWIAIAQLHADSPEGPYLVLFLLLLVWVADILAYVTGRRWGRAKLAPLLSPGKTRAGVYGALAGAALCGGLLALSMGLASRFVPLLILLCTLVVLVSVIGDLFESLVKRSRNLKDSGSLLPGHGGVLDRIDSLTAAAPMFALGILWLKVLSG

Samples

Sample ID Description Type Environment
1 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
57 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
97 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
112 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
113 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
114 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
126 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
127 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
128 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
129 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
130 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
131 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
132 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
133 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
136 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
137 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
143 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
144 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
145 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
146 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
147 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
148 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
152 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
153 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
156 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 2511231015 Pseudomonas sp. GM49 Isolate Nodule
195 2511231017 Pseudomonas sp. GM55 Isolate Nodule
196 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
197 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
198 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
199 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
200 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
201 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
202 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
203 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
204 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
205 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
206 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
207 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
208 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
209 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
210 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
211 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
212 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
213 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
214 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
215 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
216 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
217 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
218 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
219 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
220 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
221 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
222 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
223 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
224 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
225 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
226 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
227 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
228 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
229 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
230 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
231 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
232 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
233 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
234 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
235 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
236 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
237 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
238 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
239 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
240 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
241 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
242 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
243 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
244 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
245 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
246 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
247 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
248 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
249 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
250 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
251 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
252 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
253 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
254 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
255 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
256 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
257 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
258 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
259 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
260 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
261 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
262 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
263 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
264 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
265 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
266 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
267 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
268 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
269 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
270 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
271 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
272 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
273 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
274 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
275 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.08
Metatranscriptomes 4.45
Isolates 21.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.45
Nodule 1.05
Rhizoplane 5.76
Rhizosphere 70.68
Stem 0
Stem Tuber 1.57
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316579_10019856 3300031691 Bacteria 2973
2 rootL2_10006032 3300003322 Bacteria 1393
3 rootH1_10145870 3300003323 Bacteria 1390
4 Ga0055538_1000096 3300003751 Bacteria 73286
5 Ga0055539_1000142 3300003752 Bacteria 73286
6 Ga0055533_1000146 3300003756 Bacteria 73286
7 Ga0055532_1000132 3300003758 Bacteria 73282
8 Ga0055525_1000226 3300003759 Bacteria 61151
9 Ga0055535_1011034 3300003761 Bacteria 1450
10 Ga0055536_1009352 3300003781 Bacteria 4063
11 Ga0055541_1000096 3300003841 Bacteria 73286
12 Ga0058692_1006245 3300003856 Bacteria 3294
13 Ga0065714_10073956 3300005288 Bacteria 3105
14 Ga0065714_10123664 3300005288 Bacteria 1305
15 Ga0065704_10081950 3300005289 Bacteria 3670
16 Ga0065712_10067894 3300005290 Bacteria 22238
17 Ga0070676_10001863 3300005328 Bacteria 10736
18 Ga0070677_10017098 3300005333 Bacteria 2591
19 Ga0070680_100057901 3300005336 Bacteria 3169
20 Ga0070691_10035612 3300005341 Bacteria 2344
21 Ga0070661_100000618 3300005344 Bacteria 26428
22 Ga0070668_100022073 3300005347 Bacteria 4811
23 Ga0070669_100010367 3300005353 Bacteria 6619
24 Ga0070669_100015481 3300005353 Bacteria 5435
25 Ga0070674_100000687 3300005356 Bacteria 17126
26 Ga0070714_100110702 3300005435 Bacteria 2431
27 Ga0070662_100002548 3300005457 Bacteria 11222
28 Ga0070662_100014403 3300005457 Bacteria 5283
29 Ga0068867_100063428 3300005459 Bacteria 2746
30 Ga0070672_100001677 3300005543 Bacteria 13800
31 Ga0070664_100000130 3300005564 Bacteria 50283
32 Ga0068857_100207094 3300005577 Bacteria 1789
33 Ga0068861_100003473 3300005719 Bacteria 10458
34 Ga0068851_10000019 3300005834 Bacteria 135877
35 Ga0068870_10265512 3300005840 Bacteria 1070
36 Ga0068862_100005043 3300005844 Bacteria 11108
37 Ga0075428_100226197 3300006844 Bacteria 2019
38 Ga0075430_100051045 3300006846 Bacteria 3486
39 Ga0075431_100024574 3300006847 Bacteria 6176
40 Ga0075431_100138436 3300006847 Bacteria 2509
41 Ga0075431_100143843 3300006847 Bacteria 2457
42 Ga0075429_100118958 3300006880 Bacteria 2308
43 Ga0075429_100563480 3300006880 Bacteria 998
44 Ga0079104_1004839 3300006946 Bacteria 5592
45 Ga0105251_10001380 3300009011 Bacteria 21018
46 Ga0105251_10009734 3300009011 Bacteria 5644
47 Ga0105251_10010853 3300009011 Bacteria 5247
48 Ga0105251_10016253 3300009011 Bacteria 4029
49 Ga0105244_10013217 3300009036 Bacteria 4834
50 Ga0105244_10013228 3300009036 Bacteria 4833
51 Ga0105244_10016274 3300009036 Bacteria 4241
52 Ga0105244_10023224 3300009036 Bacteria 3402
53 Ga0111539_10026477 3300009094 Bacteria 7090
54 Ga0105243_10011792 3300009148 Bacteria 6610
55 Ga0105243_10097004 3300009148 Bacteria 2440
56 Ga0105243_10185472 3300009148 Bacteria 1813
57 Ga0105242_10017212 3300009176 Bacteria 5628
58 Ga0105248_10044252 3300009177 Bacteria 4993
59 Ga0105237_10005225 3300009545 Bacteria 14688
60 Ga0105246_10011006 3300011119 Bacteria 5606
61 Ga0105246_10015375 3300011119 Bacteria 4833
62 Ga0105246_10019786 3300011119 Bacteria 4310
63 Ga0157373_10040308 3300013100 Bacteria 3342
64 Ga0157373_10056733 3300013100 Bacteria 2780
65 Ga0157373_10537944 3300013100 Bacteria 846
66 Ga0157371_10001913 3300013102 Bacteria 20803
67 Ga0157371_10100086 3300013102 Bacteria 2056
68 Ga0157370_10116086 3300013104 Bacteria 2500
69 Ga0157370_10149906 3300013104 Bacteria 2170
70 Ga0157370_10319624 3300013104 Bacteria 1432
71 Ga0157369_10085066 3300013105 Bacteria 3379
72 Ga0157369_10093558 3300013105 Bacteria 3208
73 Ga0157375_10378936 3300013308 Bacteria 1581
74 Ga0182008_10012023 3300014497 Bacteria 4583
75 Ga0182006_1023394 3300015261 Bacteria 2559
76 Ga0182006_1101107 3300015261 Bacteria 1023
77 Ga0182007_10016643 3300015262 Bacteria 2707
78 Ga0163161_10098838 3300017792 Bacteria 2170
79 Ga0163161_10100917 3300017792 Bacteria 2148
80 Ga0209435_100185 3300025206 Bacteria 18690
81 Ga0209784_100015 3300025224 Bacteria 482117
82 Ga0209566_100012 3300025225 Bacteria 482281
83 Ga0209674_100027 3300025226 Bacteria 482281
84 Ga0209147_100019 3300025229 Bacteria 482139
85 Ga0209563_100031 3300025230 Bacteria 482281
86 Ga0209437_107334 3300025233 Bacteria 1798
87 Ga0209258_100367 3300025242 Bacteria 59742
88 Ga0209646_1000447 3300025246 Bacteria 21890
89 Ga0209677_100016 3300025253 Bacteria 482117
90 Ga0209759_1005552 3300025256 Bacteria 4390
91 Ga0209256_1037681 3300025299 Bacteria 1258
92 Ga0207656_10000249 3300025321 Bacteria 18814
93 Ga0207696_1041851 3300025711 Bacteria 1337
94 Ga0207655_1000005 3300025728 Bacteria 917277
95 Ga0207655_1000015 3300025728 Bacteria 600662
96 Ga0207655_1000385 3300025728 Bacteria 61817
97 Ga0207713_1010740 3300025735 Bacteria 5044
98 Ga0207682_10022957 3300025893 Bacteria 2461
99 Ga0207645_10000328 3300025907 Bacteria 39622
100 Ga0207671_10000019 3300025914 Bacteria 317781
101 Ga0207660_10047506 3300025917 Bacteria 3035
102 Ga0207649_10000002 3300025920 Bacteria 498633
103 Ga0207681_10006407 3300025923 Bacteria 7226
104 Ga0207681_10011754 3300025923 Bacteria 5383
105 Ga0207650_10014814 3300025925 Bacteria 5423
106 Ga0207664_10032053 3300025929 Bacteria 4026
107 Ga0207706_10000476 3300025933 Bacteria 42949
108 Ga0207706_10023236 3300025933 Bacteria 5569
109 Ga0207686_10003688 3300025934 Bacteria 8207
110 Ga0207709_10000134 3300025935 Bacteria 108529
111 Ga0207709_10043771 3300025935 Bacteria 2701
112 Ga0207709_10238796 3300025935 Bacteria 1321
113 Ga0207704_10019354 3300025938 Bacteria 3573
114 Ga0207691_10013230 3300025940 Bacteria 7903
115 Ga0207679_10000006 3300025945 Bacteria 498868
116 Ga0207668_10060871 3300025972 Bacteria 2652
117 Ga0207708_10018944 3300026075 Bacteria 5183
118 Ga0207648_10000334 3300026089 Bacteria 51629
119 Ga0207674_10493289 3300026116 Bacteria 1183
120 Ga0207675_100000130 3300026118 Bacteria 63098
121 Ga0209371_1002706 3300027312 Bacteria 9571
122 Ga0209966_1007224 3300027695 Bacteria 1942
123 Ga0209998_10000403 3300027717 Bacteria 12312
124 Ga0268265_10052790 3300028380 Bacteria 3076
125 Ga0265338_10008550 3300028800 Bacteria 12393
126 Ga0268256_1002355 3300030500 Bacteria 9735
127 Ga0316183_1146994 3300030742 Bacteria 1110
128 Ga0265332_10026318 3300031238 Bacteria 2552
129 Ga0307408_100000042 3300031548 Bacteria 172505
130 Ga0307408_100029063 3300031548 Bacteria 3826
131 Ga0307408_100130055 3300031548 Bacteria 1962
132 Ga0265313_10011088 3300031595 Bacteria 5622
133 Ga0316575_10035455 3300031665 Bacteria 1962
134 Ga0316579_10004645 3300031691 Bacteria 5467
135 Ga0316579_10010834 3300031691 Bacteria 3862
136 Ga0316579_10052908 3300031691 Bacteria 1901
137 Ga0316579_10138487 3300031691 Bacteria 1173
138 Ga0316576_10104636 3300031727 Bacteria 2118
139 Ga0316576_10171708 3300031727 Bacteria 1636
140 Ga0316578_10002446 3300031728 Bacteria 8151
141 Ga0316578_10017188 3300031728 Bacteria 3932
142 Ga0316578_10049869 3300031728 Bacteria 2448
143 Ga0316578_10108509 3300031728 Bacteria 1666
144 Ga0316578_10176978 3300031728 Bacteria 1286
145 Ga0316578_10239089 3300031728 Bacteria 1090
146 Ga0307405_10022149 3300031731 Bacteria 3587
147 Ga0307405_10162563 3300031731 Bacteria 1583
148 Ga0307413_10076408 3300031824 Bacteria 2128
149 Ga0307406_10025162 3300031901 Bacteria 3561
150 Ga0307412_10154417 3300031911 Bacteria 1697
151 Ga0307416_100264239 3300032002 Bacteria 1684
152 Ga0307414_10068783 3300032004 Bacteria 2542
153 Ga0307411_10023141 3300032005 Bacteria 3673
154 Ga0316583_10007581 3300032133 Bacteria 3908
155 Ga0316585_10021632 3300032137 Bacteria 1976
156 Ga0316585_10059883 3300032137 Bacteria 1229
157 Ga0316580_10020433 3300032139 Bacteria 2040
158 Ga0316593_10000004 3300032168 Bacteria 21105
159 Ga0316593_10000190 3300032168 Bacteria 9414
160 Ga0316593_10000286 3300032168 Bacteria 8533
161 Ga0316593_10001295 3300032168 Bacteria 5440
162 Ga0316593_10001437 3300032168 Bacteria 5250
163 Ga0316593_10002082 3300032168 Bacteria 4642
164 Ga0316593_10008458 3300032168 Bacteria 2871
165 Ga0316593_10034035 3300032168 Bacteria 1670
166 Ga0316593_10073028 3300032168 Bacteria 1189
167 Ga0316592_1000357 3300033524 Bacteria 6031
168 Ga0316592_1000364 3300033524 Bacteria 6002
169 Ga0316586_1002905 3300033527 Bacteria 2192
170 Ga0316588_1000027 3300033528 Bacteria 10874
171 Ga0316588_1000437 3300033528 Bacteria 5572
172 Ga0316596_1000202 3300033541 Bacteria 8784
173 Ga0316596_1000893 3300033541 Bacteria 5629
174 Ga0316596_1013157 3300033541 Bacteria 2041
175 Ga0316574_0024108 3300035398 Bacteria 3638
176 Ga0316574_0062155 3300035398 Bacteria 2346
177 Ga0373927_0000003 3300035695 Bacteria 480348
178 Ga0373937_0729085 3300036401 Bacteria 938
179 Ga0316582_0001475 3300036647 Bacteria 10362
180 Ga0316582_0001889 3300036647 Bacteria 9523
181 Ga0316582_0016405 3300036647 Bacteria 4258
182 Ga0316584_0003199 3300036712 Bacteria 10599
183 Ga0316584_0016533 3300036712 Bacteria 5288
184 Ga0316584_0033884 3300036712 Bacteria 3784
185 Ga0316584_0040902 3300036712 Bacteria 3454
186 Ga0316584_0041973 3300036712 Bacteria 3411
187 Ga0316584_0079344 3300036712 Bacteria 2459
188 Ga0373925_0084347 3300037068 Bacteria 2421
189 Ga0316581_0004748 3300037588 Bacteria 3493
190 Ga0400484_15704 3300038725 Bacteria 3612
191 Ga0400484_31844 3300038725 Bacteria 15274
192 Ga0400490_24671 3300038726 Bacteria 15777
193 Ga0400490_38780 3300038726 Bacteria 7657
194 Ga0400485_06206 3300038735 Bacteria 3445
195 Ga0400488_07727 3300038741 Bacteria 1276
196 Ga0400488_11089 3300038741 Bacteria 3628
197 Ga0400488_57823 3300038741 Bacteria 8428
198 Ga0400486_17191 3300038742 Bacteria 2847
199 Ga0400483_073268 3300039062 Bacteria 11164
200 Ga0400483_083843 3300039062 Bacteria 2038
201 Ga0400483_109070 3300039062 Bacteria 1847
202 Ga0400483_143486 3300039062 Bacteria 2069
203 Ga0400483_156207 3300039062 Bacteria 6820
204 Ga0400483_223374 3300039062 Bacteria 5286
205 Ga0400483_248533 3300039062 Bacteria 4249
206 Ga0400483_288755 3300039062 Unclassified 1161
207 Ga0400489_85216 3300039093 Bacteria 5209
208 Ga0400487_03580 3300039110 Bacteria 4991
209 Ga0400487_38230 3300039110 Bacteria 2889
210 Ga0439436_0003980 3300041404 Bacteria 4530
211 Ga0439438_009140 3300041405 Bacteria 3228
212 Ga0439438_017999 3300041405 Bacteria 2020
213 Ga0439438_020470 3300041405 Bacteria 1856
214 Ga0439438_026809 3300041405 Bacteria 1559
215 Ga0439447_002283 3300041407 Bacteria 7041
216 Ga0439447_010503 3300041407 Bacteria 2743
217 Ga0439466_0002286 3300041411 Bacteria 7519
218 Ga0439466_0016130 3300041411 Bacteria 2704
219 Ga0439466_0028587 3300041411 Bacteria 1924
220 Ga0439431_0007967 3300041997 Bacteria 2371
221 Ga0439432_002084 3300042006 Bacteria 7550
222 Ga0439432_027470 3300042006 Bacteria 1857
223 Ga0439432_029531 3300042006 Bacteria 1781
224 Ga0439452_003829 3300042010 Bacteria 5168
225 Ga0439452_004520 3300042010 Bacteria 4652
226 Ga0439452_005313 3300042010 Bacteria 4159
227 Ga0439452_027840 3300042010 Bacteria 1415
228 Ga0439455_0056702 3300042012 Bacteria 1032
229 Ga0450911_000008 3300042115 Bacteria 168304
230 Ga0450923_003425 3300042125 Bacteria 2392
231 Ga0450902_000471 3300042137 Bacteria 5019
232 Ga0450904_000727 3300042139 Bacteria 5761
233 Ga0450905_000225 3300042142 Bacteria 6448
234 Ga0450907_001431 3300042146 Bacteria 5166
235 Ga0439446_0002144 3300042156 Bacteria 4687
236 Ga0439446_0011068 3300042156 Bacteria 2442
237 Ga0439446_0011198 3300042156 Bacteria 2431
238 Ga0439434_0002824 3300042435 Bacteria 5069
239 Ga0439434_0004422 3300042435 Bacteria 4109
240 Ga0439464_0017966 3300042439 Bacteria 1921
241 Ga0450916_000732 3300042530 Bacteria 3019
242 Ga0450893_0002822 3300042532 Bacteria 2725
243 Ga0450901_002274 3300042533 Bacteria 2099
244 Ga0451577_0045119 3300042876 Bacteria 3946
245 Ga0495617_005173 3300046452 Bacteria 4657
246 Ga0495617_007105 3300046452 Bacteria 3904
247 Ga0495590_0007325 3300046457 Bacteria 4261
248 Ga0495650_0009597 3300046471 Bacteria 5488
249 Ga0495650_0017350 3300046471 Bacteria 3611
250 Ga0495584_0170701 3300046491 Bacteria 1105
251 Ga0495607_0014394 3300046501 Bacteria 5150
252 Ga0495606_0035590 3300046507 Bacteria 3401
253 Ga0495610_0105256 3300046512 Bacteria 1257
254 Ga0495616_0010608 3300046513 Bacteria 5324
255 Ga0495620_0021029 3300046515 Bacteria 3175
256 Ga0495630_0106225 3300046517 Bacteria 2126
257 Ga0495630_0193908 3300046517 Bacteria 1550
258 Ga0495630_0224217 3300046517 Bacteria 1435
259 Ga0495648_0013339 3300046524 Bacteria 6082
260 Ga0495633_0008844 3300046558 Bacteria 5620
261 Ga0495625_0039297 3300046660 Bacteria 3456
262 Ga0495661_0144195 3300046665 Bacteria 1292
263 Ga0495670_0020586 3300046691 Bacteria 3254
264 Ga0495589_0018798 3300046794 Bacteria 3542
265 Ga0495660_0019385 3300046810 Bacteria 3904
266 Ga0495676_0200029 3300047321 Bacteria 1389
267 Ga0495680_0035989 3300047322 Bacteria 3980
268 Ga0495683_0008995 3300047323 Bacteria 5330
269 Ga0495679_007627 3300047446 Bacteria 4493
270 Ga0495681_0011765 3300047470 Bacteria 5182
271 Ga0495593_0086610 3300047673 Bacteria 1615
272 Ga0496116_0000214 3300048919 Bacteria 109085
273 Ga0496121_0224587 3300048924 Bacteria 1320
274 Ga0496124_0041281 3300048927 Bacteria 3982
275 Ga0496124_0042950 3300048927 Bacteria 3889
276 Ga0496124_0046937 3300048927 Bacteria 3697
277 Ga0496124_0161005 3300048927 Bacteria 1749
278 Ga0496125_0040111 3300048928 Bacteria 4020
279 Ga0496125_0128613 3300048928 Bacteria 1788
280 Ga0496125_0153570 3300048928 Bacteria 1577
281 Ga0496126_0109083 3300048929 Bacteria 2412
282 Ga0495682_0000767 3300049460 Bacteria 20562
283 Ga0495682_0011741 3300049460 Bacteria 3366
284 Ga0501032_0000711 3300049569 Bacteria 27090
285 Ga0501032_0024825 3300049569 Bacteria 4135
286 Ga0501034_0150432 3300049571 Bacteria 2304
287 Ga0501034_0254725 3300049571 Bacteria 1699
288 Ga0501037_0045714 3300049573 Bacteria 3213
289 Ga0501038_0038052 3300049574 Bacteria 4214
290 Ga0501044_0183433 3300049823 Bacteria 2059
291 Ga0501226_000005 3300049853 Bacteria 271019
292 nmdc:mga09592_19805_c1 3300050508 Bacteria 5527
293 nmdc:mga09592_199255_c1 3300050508 Bacteria 1734
294 nmdc:mga0qj67_146722_c1 3300050509 Bacteria 1913
295 nmdc:mga0qj67_50380_c1 3300050509 Bacteria 3293
296 nmdc:mga06r32_179392_c1 3300050510 Bacteria 2103
297 nmdc:mga06r32_35930_c1 3300050510 Bacteria 4678
298 nmdc:mga06r32_56504_c1 3300050510 Bacteria 3768
299 nmdc:mga08y16_18052_c1 3300050511 Bacteria 7431
300 nmdc:mga08y16_86737_c1 3300050511 Bacteria 3262
301 2511321164 2511231015 Bacteria 6598026
302 2511333241 2511231017 Bacteria 6503007
303 2538428219 2537561728 Bacteria 5149301
304 2555245884 2554235231 Bacteria 5215788
305 2597862534 2597489888 Bacteria 6179543
306 2597868378 2597489889 Bacteria 6297495
307 2599396874 2599185167 Bacteria 6353609
308 2599448852 2599185179 Bacteria 6611171
309 2599507825 2599185189 Bacteria 5862825
310 2599511389 2599185190 Bacteria 6285678
311 2599517671 2599185191 Bacteria 6297582
312 2599613808 2599185212 Bacteria 6765997
313 2599890763 2599185290 Bacteria 6289611
314 2599995530 2599185311 Bacteria 6354990
315 2600024863 2599185316 Bacteria 6320029
316 2600029688 2599185317 Bacteria 6435722
317 2600035425 2599185318 Bacteria 6961590
318 2600041272 2599185319 Bacteria 6637840
319 2600058396 2599185322 Bacteria 6763055
320 2600063929 2599185323 Bacteria 6688755
321 2600079447 2599185325 Bacteria 6324919
322 2600358366 2600254930 Bacteria 6431253
323 2600446504 2600254954 Bacteria 5100516
324 2601691122 2600255296 Bacteria 5784754
325 2602010433 2600255389 Bacteria 5275336
326 2621301327 2619619299 Bacteria 6649820
327 2643873247 2643221571 Bacteria 6228673
328 2644624215 2643221713 Bacteria 6554480
329 2671127464 2667528176 Bacteria 6724917
330 2678261661 2675903515 Bacteria 6580491
331 2707100115 2706794495 Bacteria 4536932
332 2723247418 2721755607 Bacteria 5841722
333 2738673902 2738541265 Bacteria 6594665
334 2738752295 2738541282 Bacteria 6593925
335 2738861336 2738541303 Bacteria 6591772
336 2739256733 2738543015 Bacteria 6750701
337 2745008010 2744054620 Bacteria 6551379
338 2794594453 2791355520 Bacteria 5948615
339 2807409824 2806310737 Bacteria 5751088
340 2807458172 2806310745 Bacteria 5742165
341 2808904838 2808606373 Bacteria 4423627
342 2808939464 2808606379 Bacteria 5022697
343 2812371025 2811994881 Bacteria 6298475
344 2817489308 2816332298 Bacteria 6852809
345 2823422978 2823421272 Bacteria 5372474
346 2834029211 2834028612 Bacteria 6354979
347 2842828914 2842826826 Bacteria 5974129
348 2842839825 2842837860 Bacteria 6066181
349 2854605426 2854601825 Bacteria 4797592
350 2855197879 2855195626 Bacteria 4927512
351 2858469808 2858466076 Bacteria 4722413
352 2860869266 2860867994 Bacteria 5645326
353 2871276860 2871272651 Bacteria 5042015
354 2871284038 2871282230 Bacteria 4917173
355 2900054389 2900051742 Bacteria 4985156
356 2913037995 2913036834 Bacteria 6704877
357 2919482905 2919481497 Bacteria 6907839
358 2919496689 2919493220 Bacteria 4598500
359 2919505630 2919501602 Bacteria 5286340
360 2919546848 2919543075 Bacteria 4728703
361 2923525132 2923519811 Bacteria 6298479
362 2923529524 2923525760 Bacteria 4472324
363 2926067307 2926063275 Bacteria 5285848
364 2929145452 2929144301 Bacteria 6622272
365 2929191236 2929189879 Bacteria 5930554
366 2931392225 2931390751 Bacteria 6273349
367 2945929346 2945928738 Bacteria 6053221
368 2946029461 2946027586 Bacteria 6049274
369 2947236049 2947233263 Bacteria 6439278
370 3007420783 3007419365 Bacteria 7026924
371 3007720879 3007718800 Bacteria 5971527
372 3007871346 3007866637 Bacteria 5899198
373 3007874442 3007872151 Bacteria 5268868
374 8034964093 8034962539 Bacteria 4884839
375 8054285540 8054285046 Bacteria 6919322
376 8054348340 8054347763 Bacteria 5901107
377 8055819246 8055817908 Bacteria 6609162
378 8056120161 8056115690 Bacteria 5527654
379 8056121956 8056120720 Bacteria 5758328
380 8056141775 8056137416 Bacteria 6147080
381 8056149410 8056148874 Bacteria 6479865
382 8056164574 8056161164 Bacteria 6106669
383 Ga0316579_10019856
384 rootL2_10006032
385 rootH1_10145870
386 Ga0055538_1000096
387 Ga0055539_1000142
388 Ga0055533_1000146
389 Ga0055532_1000132
390 Ga0055525_1000226
391 Ga0055535_1011034
392 Ga0055536_1009352
393 Ga0055541_1000096
394 Ga0058692_1006245
395 Ga0065714_10073956
396 Ga0065714_10123664
397 Ga0065704_10081950
398 Ga0065712_10067894
399 Ga0070676_10001863
400 Ga0070677_10017098
401 Ga0070680_100057901
402 Ga0070691_10035612
403 Ga0070661_100000618
404 Ga0070668_100022073
405 Ga0070669_100010367
406 Ga0070669_100015481
407 Ga0070674_100000687
408 Ga0070714_100110702
409 Ga0070662_100002548
410 Ga0070662_100014403
411 Ga0068867_100063428
412 Ga0070672_100001677
413 Ga0070664_100000130
414 Ga0068857_100207094
415 Ga0068861_100003473
416 Ga0068851_10000019
417 Ga0068870_10265512
418 Ga0068862_100005043
419 Ga0075428_100226197
420 Ga0075430_100051045
421 Ga0075431_100024574
422 Ga0075431_100138436
423 Ga0075431_100143843
424 Ga0075429_100118958
425 Ga0075429_100563480
426 Ga0079104_1004839
427 Ga0105251_10001380
428 Ga0105251_10009734
429 Ga0105251_10010853
430 Ga0105251_10016253
431 Ga0105244_10013217
432 Ga0105244_10013228
433 Ga0105244_10016274
434 Ga0105244_10023224
435 Ga0111539_10026477
436 Ga0105243_10011792
437 Ga0105243_10097004
438 Ga0105243_10185472
439 Ga0105242_10017212
440 Ga0105248_10044252
441 Ga0105237_10005225
442 Ga0105246_10011006
443 Ga0105246_10015375
444 Ga0105246_10019786
445 Ga0157373_10040308
446 Ga0157373_10056733
447 Ga0157373_10537944
448 Ga0157371_10001913
449 Ga0157371_10100086
450 Ga0157370_10116086
451 Ga0157370_10149906
452 Ga0157370_10319624
453 Ga0157369_10085066
454 Ga0157369_10093558
455 Ga0157375_10378936
456 Ga0182008_10012023
457 Ga0182006_1023394
458 Ga0182006_1101107
459 Ga0182007_10016643
460 Ga0163161_10098838
461 Ga0163161_10100917
462 Ga0209435_100185
463 Ga0209784_100015
464 Ga0209566_100012
465 Ga0209674_100027
466 Ga0209147_100019
467 Ga0209563_100031
468 Ga0209437_107334
469 Ga0209258_100367
470 Ga0209646_1000447
471 Ga0209677_100016
472 Ga0209759_1005552
473 Ga0209256_1037681
474 Ga0207656_10000249
475 Ga0207696_1041851
476 Ga0207655_1000005
477 Ga0207655_1000015
478 Ga0207655_1000385
479 Ga0207713_1010740
480 Ga0207682_10022957
481 Ga0207645_10000328
482 Ga0207671_10000019
483 Ga0207660_10047506
484 Ga0207649_10000002
485 Ga0207681_10006407
486 Ga0207681_10011754
487 Ga0207650_10014814
488 Ga0207664_10032053
489 Ga0207706_10000476
490 Ga0207706_10023236
491 Ga0207686_10003688
492 Ga0207709_10000134
493 Ga0207709_10043771
494 Ga0207709_10238796
495 Ga0207704_10019354
496 Ga0207691_10013230
497 Ga0207679_10000006
498 Ga0207668_10060871
499 Ga0207708_10018944
500 Ga0207648_10000334
501 Ga0207674_10493289
502 Ga0207675_100000130
503 Ga0209371_1002706
504 Ga0209966_1007224
505 Ga0209998_10000403
506 Ga0268265_10052790
507 Ga0265338_10008550
508 Ga0268256_1002355
509 Ga0316183_1146994
510 Ga0265332_10026318
511 Ga0307408_100000042
512 Ga0307408_100029063
513 Ga0307408_100130055
514 Ga0265313_10011088
515 Ga0316575_10035455
516 Ga0316579_10004645
517 Ga0316579_10010834
518 Ga0316579_10052908
519 Ga0316579_10138487
520 Ga0316576_10104636
521 Ga0316576_10171708
522 Ga0316578_10002446
523 Ga0316578_10017188
524 Ga0316578_10049869
525 Ga0316578_10108509
526 Ga0316578_10176978
527 Ga0316578_10239089
528 Ga0307405_10022149
529 Ga0307405_10162563
530 Ga0307413_10076408
531 Ga0307406_10025162
532 Ga0307412_10154417
533 Ga0307416_100264239
534 Ga0307414_10068783
535 Ga0307411_10023141
536 Ga0316583_10007581
537 Ga0316585_10021632
538 Ga0316585_10059883
539 Ga0316580_10020433
540 Ga0316593_10000004
541 Ga0316593_10000190
542 Ga0316593_10000286
543 Ga0316593_10001295
544 Ga0316593_10001437
545 Ga0316593_10002082
546 Ga0316593_10008458
547 Ga0316593_10034035
548 Ga0316593_10073028
549 Ga0316592_1000357
550 Ga0316592_1000364
551 Ga0316586_1002905
552 Ga0316588_1000027
553 Ga0316588_1000437
554 Ga0316596_1000202
555 Ga0316596_1000893
556 Ga0316596_1013157
557 Ga0316574_0024108
558 Ga0316574_0062155
559 Ga0373927_0000003
560 Ga0373937_0729085
561 Ga0316582_0001475
562 Ga0316582_0001889
563 Ga0316582_0016405
564 Ga0316584_0003199
565 Ga0316584_0016533
566 Ga0316584_0033884
567 Ga0316584_0040902
568 Ga0316584_0041973
569 Ga0316584_0079344
570 Ga0373925_0084347
571 Ga0316581_0004748
572 Ga0400484_15704
573 Ga0400484_31844
574 Ga0400490_24671
575 Ga0400490_38780
576 Ga0400485_06206
577 Ga0400488_07727
578 Ga0400488_11089
579 Ga0400488_57823
580 Ga0400486_17191
581 Ga0400483_073268
582 Ga0400483_083843
583 Ga0400483_109070
584 Ga0400483_143486
585 Ga0400483_156207
586 Ga0400483_223374
587 Ga0400483_248533
588 Ga0400483_288755
589 Ga0400489_85216
590 Ga0400487_03580
591 Ga0400487_38230
592 Ga0439436_0003980
593 Ga0439438_009140
594 Ga0439438_017999
595 Ga0439438_020470
596 Ga0439438_026809
597 Ga0439447_002283
598 Ga0439447_010503
599 Ga0439466_0002286
600 Ga0439466_0016130
601 Ga0439466_0028587
602 Ga0439431_0007967
603 Ga0439432_002084
604 Ga0439432_027470
605 Ga0439432_029531
606 Ga0439452_003829
607 Ga0439452_004520
608 Ga0439452_005313
609 Ga0439452_027840
610 Ga0439455_0056702
611 Ga0450911_000008
612 Ga0450923_003425
613 Ga0450902_000471
614 Ga0450904_000727
615 Ga0450905_000225
616 Ga0450907_001431
617 Ga0439446_0002144
618 Ga0439446_0011068
619 Ga0439446_0011198
620 Ga0439434_0002824
621 Ga0439434_0004422
622 Ga0439464_0017966
623 Ga0450916_000732
624 Ga0450893_0002822
625 Ga0450901_002274
626 Ga0451577_0045119
627 Ga0495617_005173
628 Ga0495617_007105
629 Ga0495590_0007325
630 Ga0495650_0009597
631 Ga0495650_0017350
632 Ga0495584_0170701
633 Ga0495607_0014394
634 Ga0495606_0035590
635 Ga0495610_0105256
636 Ga0495616_0010608
637 Ga0495620_0021029
638 Ga0495630_0106225
639 Ga0495630_0193908
640 Ga0495630_0224217
641 Ga0495648_0013339
642 Ga0495633_0008844
643 Ga0495625_0039297
644 Ga0495661_0144195
645 Ga0495670_0020586
646 Ga0495589_0018798
647 Ga0495660_0019385
648 Ga0495676_0200029
649 Ga0495680_0035989
650 Ga0495683_0008995
651 Ga0495679_007627
652 Ga0495681_0011765
653 Ga0495593_0086610
654 Ga0496116_0000214
655 Ga0496121_0224587
656 Ga0496124_0041281
657 Ga0496124_0042950
658 Ga0496124_0046937
659 Ga0496124_0161005
660 Ga0496125_0040111
661 Ga0496125_0128613
662 Ga0496125_0153570
663 Ga0496126_0109083
664 Ga0495682_0000767
665 Ga0495682_0011741
666 Ga0501032_0000711
667 Ga0501032_0024825
668 Ga0501034_0150432
669 Ga0501034_0254725
670 Ga0501037_0045714
671 Ga0501038_0038052
672 Ga0501044_0183433
673 Ga0501226_000005
674 nmdc:mga09592_19805_c1
675 nmdc:mga09592_199255_c1
676 nmdc:mga0qj67_146722_c1
677 nmdc:mga0qj67_50380_c1
678 nmdc:mga06r32_179392_c1
679 nmdc:mga06r32_35930_c1
680 nmdc:mga06r32_56504_c1
681 nmdc:mga08y16_18052_c1
682 nmdc:mga08y16_86737_c1
683 2511321164
684 2511333241
685 2538428219
686 2555245884
687 2597862534
688 2597868378
689 2599396874
690 2599448852
691 2599507825
692 2599511389
693 2599517671
694 2599613808
695 2599890763
696 2599995530
697 2600024863
698 2600029688
699 2600035425
700 2600041272
701 2600058396
702 2600063929
703 2600079447
704 2600358366
705 2600446504
706 2601691122
707 2602010433
708 2621301327
709 2643873247
710 2644624215
711 2671127464
712 2678261661
713 2707100115
714 2723247418
715 2738673902
716 2738752295
717 2738861336
718 2739256733
719 2745008010
720 2794594453
721 2807409824
722 2807458172
723 2808904838
724 2808939464
725 2812371025
726 2817489308
727 2823422978
728 2834029211
729 2842828914
730 2842839825
731 2854605426
732 2855197879
733 2858469808
734 2860869266
735 2871276860
736 2871284038
737 2900054389
738 2913037995
739 2919482905
740 2919496689
741 2919505630
742 2919546848
743 2923525132
744 2923529524
745 2926067307
746 2929145452
747 2929191236
748 2931392225
749 2945929346
750 2946029461
751 2947236049
752 3007420783
753 3007720879
754 3007871346
755 3007874442
756 8034964093
757 8054285540
758 8054348340
759 8055819246
760 8056120161
761 8056121956
762 8056141775
763 8056149410
764 8056164574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01148

CTP_transf_1

Cytidylyltransferase family

61

327

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5guf-assembly1.cif.gz_A-2 structural insight into an intramembrane enzyme for archaeal membrane lipids biosynthesis 0.7678 138 258
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.7609 8 268
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.7586 8 268
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.7556 8 268
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.753 8 268
ID Description Score Start End Superfamily
af_I6Y4V2_90_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4604 126 227 1.10.1760.20
af_I6Y4V2_90_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4194 126 227 1.10.1760.20
af_Q4CWY8_263_433_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3737 48 211 1.20.1250.20
af_A8JV32_493_678_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3622 140 266 1.10.357.20
af_Q4CWY8_263_433_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3611 48 211 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A534BIT1-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.981 84 267 GO:0004605
GO:0005886
GO:0016024
AF-A0A534BIT1-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9706 84 267 GO:0004605
GO:0005886
GO:0016024
AF-A0A534E0D2-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9697 2 267 GO:0004605
GO:0005886
GO:0016024
AF-A0A534CPI8-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9687 2 267 GO:0004605
GO:0005886
GO:0016024
AF-A0A3B0W676-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9673 139 262 GO:0004605
GO:0005886
GO:0016024

Map