F429346

General Info

Members Datasets Scaffolds Average Seq Length
382 256 380 314

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0848360|Ga0436361_0848360_35898_36956
Length 352
Sequence VHAAHRFANDIAELVLERYHLAGIRVQPEPAFRRSKRNAMERLIIIGSGPAGLTAAIYAARANLKPLVLAGGLYGGQLMLTTEVENYPGFPEGIMGPDLMMKFREQAERFGAQIENVDVTEVDFSKQPLVVRTADDEYRAKTVIVATGASARWLQIPGEEKLRGRGVSTCATCDGAFFRNKHIVVVGGGDSAMEEALFLTRFGHKVTVVHRRNHLRASKIMADRAHAHEKIDFIWDTVVDGVLGDTHMTGLRLRNIEDGSAFDFDADALFIAIGHDPNTSVFKGQLELDEAGYIVSPDGTMTNIEGVFVAGDVNDLRYKQAITAAGAGCKAAMDAERYLEALEFSMPEIIAS

Samples

Sample ID Description Type Environment
1 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
2 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
127 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
255 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0.79
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 3.93
Rhizosphere 90.58
Stem 0
Stem Tuber 0
Unclassified 4.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10014134 3300005328 Bacteria 4383
2 Ga0070683_100058530 3300005329 Bacteria 3580
3 Ga0070690_100125211 3300005330 Bacteria 1729
4 Ga0070670_100203798 3300005331 Bacteria 1719
5 Ga0070680_100125386 3300005336 Bacteria 2145
6 Ga0068868_100009562 3300005338 Bacteria 6990
7 Ga0070691_10048746 3300005341 Bacteria 2016
8 Ga0070661_100039822 3300005344 Bacteria 3425
9 Ga0070668_100046757 3300005347 Bacteria 3325
10 Ga0070675_100160567 3300005354 Bacteria 1932
11 Ga0070671_100060888 3300005355 Bacteria 3143
12 Ga0070674_100049253 3300005356 Bacteria 2896
13 Ga0070673_100451695 3300005364 Bacteria 1156
14 Ga0070688_100090603 3300005365 Bacteria 1997
15 Ga0070659_100109547 3300005366 Bacteria 2229
16 Ga0070703_10000003 3300005406 Bacteria 157383
17 Ga0070713_100040075 3300005436 Bacteria 3806
18 Ga0070711_100001496 3300005439 Bacteria 12838
19 Ga0070700_100224917 3300005441 Bacteria 1332
20 Ga0070694_100009992 3300005444 Bacteria 5834
21 Ga0070708_100023464 3300005445 Bacteria 5247
22 Ga0070663_100043870 3300005455 Bacteria 3149
23 Ga0070681_10028551 3300005458 Bacteria 5610
24 Ga0068867_100011247 3300005459 Bacteria 6311
25 Ga0068867_100037323 3300005459 Bacteria 3532
26 Ga0070706_100000344 3300005467 Bacteria 56040
27 Ga0070707_100005694 3300005468 Bacteria 11630
28 Ga0070707_100040346 3300005468 Bacteria 4466
29 Ga0070698_100030268 3300005471 Bacteria 5614
30 Ga0070679_100027943 3300005530 Bacteria 5558
31 Ga0070679_100089692 3300005530 Bacteria 3061
32 Ga0070679_100349612 3300005530 Bacteria 1426
33 Ga0070684_100304389 3300005535 Bacteria 1463
34 Ga0068853_100069116 3300005539 Bacteria 3072
35 Ga0070686_100003014 3300005544 Bacteria 9232
36 Ga0070695_100000066 3300005545 Bacteria 41937
37 Ga0070695_100180862 3300005545 Bacteria 1494
38 Ga0070693_100063860 3300005547 Bacteria 2147
39 Ga0070704_100036835 3300005549 Bacteria 3336
40 Ga0070704_100098441 3300005549 Bacteria 2197
41 Ga0068855_100000391 3300005563 Bacteria 53996
42 Ga0068855_100140643 3300005563 Bacteria 2752
43 Ga0068854_100000141 3300005578 Bacteria 49930
44 Ga0068854_100097295 3300005578 Bacteria 2200
45 Ga0070702_100025249 3300005615 Bacteria 3182
46 Ga0070702_100030947 3300005615 Bacteria 2923
47 Ga0068852_100159122 3300005616 Bacteria 2107
48 Ga0068864_100039613 3300005618 Bacteria 4028
49 Ga0068866_10007553 3300005718 Bacteria 4556
50 Ga0068866_10017800 3300005718 Bacteria 3202
51 Ga0068866_10056375 3300005718 Bacteria 2021
52 Ga0068870_10087585 3300005840 Bacteria 1734
53 Ga0068870_10313531 3300005840 Bacteria 994
54 Ga0068862_100135036 3300005844 Bacteria 2186
55 Ga0081455_10116939 3300005937 Bacteria 2108
56 Ga0081538_10109641 3300005981 Bacteria 1359
57 Ga0081539_10017008 3300005985 Bacteria 5145
58 Ga0070717_10010902 3300006028 Bacteria 6881
59 Ga0070717_10281521 3300006028 Bacteria 1475
60 Ga0070715_10000802 3300006163 Bacteria 8560
61 Ga0070715_10023310 3300006163 Bacteria 2424
62 Ga0070715_10126656 3300006163 Bacteria 1224
63 Ga0070716_100001002 3300006173 Bacteria 12341
64 Ga0070716_100075302 3300006173 Bacteria 1997
65 Ga0070712_100019509 3300006175 Bacteria 4423
66 Ga0070712_100119387 3300006175 Bacteria 1981
67 Ga0068871_100333520 3300006358 Bacteria 1338
68 Ga0075428_100004216 3300006844 Bacteria 15841
69 Ga0075428_100028951 3300006844 Bacteria 6130
70 Ga0075428_100056465 3300006844 Bacteria 4300
71 Ga0075428_100127030 3300006844 Unclassified 2774
72 Ga0075430_100012036 3300006846 Bacteria 7363
73 Ga0075431_100006034 3300006847 Bacteria 12013
74 Ga0075431_100115884 3300006847 Bacteria 2766
75 Ga0075429_100008175 3300006880 Bacteria 9093
76 Ga0075429_100045889 3300006880 Bacteria 3802
77 Ga0075429_100080831 3300006880 Bacteria 2834
78 Ga0068865_100234378 3300006881 Bacteria 1442
79 Ga0075436_100073454 3300006914 Bacteria 2367
80 Ga0105240_10003994 3300009093 Bacteria 22725
81 Ga0111539_10007857 3300009094 Bacteria 13619
82 Ga0111539_10064149 3300009094 Bacteria 4347
83 Ga0105245_10035012 3300009098 Bacteria 4455
84 Ga0105245_10530579 3300009098 Bacteria 1197
85 Ga0105247_10035752 3300009101 Bacteria 3029
86 Ga0114129_10007952 3300009147 Bacteria 15092
87 Ga0114129_10225127 3300009147 Bacteria 2528
88 Ga0105243_10002210 3300009148 Bacteria 16390
89 Ga0105243_10013120 3300009148 Bacteria 6263
90 Ga0105243_10087723 3300009148 Bacteria 2555
91 Ga0105242_10002443 3300009176 Bacteria 14584
92 Ga0105242_10004350 3300009176 Bacteria 11029
93 Ga0105248_10007846 3300009177 Bacteria 11722
94 Ga0105237_10004747 3300009545 Bacteria 15627
95 Ga0105238_10115096 3300009551 Bacteria 2668
96 Ga0105239_10328319 3300010375 Bacteria 1725
97 Ga0157369_10303560 3300013105 Bacteria 1660
98 Ga0157374_10171789 3300013296 Bacteria 2115
99 Ga0157374_10179198 3300013296 Bacteria 2069
100 Ga0157378_10008777 3300013297 Bacteria 8799
101 Ga0157378_10017146 3300013297 Bacteria 6349
102 Ga0163162_10117216 3300013306 Bacteria 2764
103 Ga0163162_10494094 3300013306 Bacteria 1354
104 Ga0157372_10015220 3300013307 Bacteria 8239
105 Ga0157372_10390510 3300013307 Bacteria 1622
106 Ga0157375_10022031 3300013308 Bacteria 5860
107 Ga0163163_10007957 3300014325 Bacteria 9375
108 Ga0163163_10315888 3300014325 Bacteria 1616
109 Ga0157380_10234663 3300014326 Bacteria 1650
110 Ga0157380_10499543 3300014326 Bacteria 1181
111 Ga0157379_10089194 3300014968 Bacteria 2766
112 Ga0206356_10861532 3300020070 Bacteria 18904
113 Ga0213872_10003057 3300021361 Bacteria 9434
114 Ga0213872_10021704 3300021361 Bacteria 2958
115 Ga0213872_10042465 3300021361 Bacteria 2073
116 Ga0213874_10000011 3300021377 Bacteria 23616
117 Ga0213876_10003274 3300021384 Bacteria 9298
118 Ga0213875_10000001 3300021388 Bacteria 2793540
119 Ga0213875_10025042 3300021388 Bacteria 2844
120 Ga0213875_10055600 3300021388 Bacteria 1854
121 Ga0207653_10000001 3300025885 Bacteria 287007
122 Ga0207642_10059981 3300025899 Bacteria 1762
123 Ga0207688_10015870 3300025901 Bacteria 4086
124 Ga0207685_10046922 3300025905 Bacteria 1646
125 Ga0207685_10059863 3300025905 Bacteria 1504
126 Ga0207645_10010173 3300025907 Bacteria 6467
127 Ga0207645_10020766 3300025907 Bacteria 4294
128 Ga0207707_10065858 3300025912 Bacteria 3155
129 Ga0207695_10115488 3300025913 Bacteria 2659
130 Ga0207671_10133229 3300025914 Bacteria 1909
131 Ga0207693_10000737 3300025915 Bacteria 29451
132 Ga0207693_10052678 3300025915 Bacteria 3192
133 Ga0207693_10090654 3300025915 Bacteria 2396
134 Ga0207663_10009307 3300025916 Bacteria 5184
135 Ga0207660_10039920 3300025917 Bacteria 3283
136 Ga0207649_10178451 3300025920 Bacteria 1485
137 Ga0207652_10010821 3300025921 Bacteria 7350
138 Ga0207652_10080137 3300025921 Bacteria 2854
139 Ga0207652_10262108 3300025921 Bacteria 1559
140 Ga0207646_10033011 3300025922 Bacteria 4683
141 Ga0207694_10298917 3300025924 Bacteria 1325
142 Ga0207659_10122681 3300025926 Bacteria 1993
143 Ga0207687_10004187 3300025927 Bacteria 9662
144 Ga0207700_10195961 3300025928 Bacteria 1700
145 Ga0207664_10001635 3300025929 Bacteria 14763
146 Ga0207644_10034929 3300025931 Bacteria 3520
147 Ga0207690_10268905 3300025932 Bacteria 1323
148 Ga0207686_10006626 3300025934 Bacteria 6244
149 Ga0207709_10019109 3300025935 Bacteria 3846
150 Ga0207709_10028417 3300025935 Bacteria 3233
151 Ga0207709_10052325 3300025935 Bacteria 2507
152 Ga0207669_10003844 3300025937 Bacteria 6545
153 Ga0207704_10019632 3300025938 Bacteria 3554
154 Ga0207704_10037812 3300025938 Bacteria 2792
155 Ga0207704_10110448 3300025938 Bacteria 1857
156 Ga0207665_10001081 3300025939 Bacteria 18360
157 Ga0207665_10084200 3300025939 Bacteria 2194
158 Ga0207661_10011442 3300025944 Bacteria 6430
159 Ga0207667_10000103 3300025949 Bacteria 135265
160 Ga0207667_10005010 3300025949 Bacteria 16188
161 Ga0207640_10000004 3300025981 Bacteria 489403
162 Ga0207677_10032384 3300026023 Bacteria 3360
163 Ga0207677_10373273 3300026023 Bacteria 1202
164 Ga0207703_10131745 3300026035 Bacteria 2160
165 Ga0207678_10025540 3300026067 Bacteria 5155
166 Ga0207708_10053097 3300026075 Bacteria 3087
167 Ga0207702_10012785 3300026078 Bacteria 6985
168 Ga0207702_10277654 3300026078 Bacteria 1583
169 Ga0207702_10357107 3300026078 Bacteria 1400
170 Ga0207648_10005510 3300026089 Bacteria 12761
171 Ga0207648_10007678 3300026089 Bacteria 10555
172 Ga0207676_10018551 3300026095 Bacteria 5060
173 Ga0207676_10295561 3300026095 Bacteria 1477
174 Ga0207675_100033111 3300026118 Bacteria 4815
175 Ga0207675_100045576 3300026118 Bacteria 4097
176 Ga0207675_100311315 3300026118 Bacteria 1536
177 Ga0207683_10027002 3300026121 Bacteria 4961
178 Ga0207698_10184229 3300026142 Bacteria 1853
179 Ga0207428_10224024 3300027907 Unclassified 1408
180 Ga0265356_1000481 3300028017 Bacteria 7199
181 Ga0268264_10244528 3300028381 Bacteria 1664
182 Ga0265323_10001489 3300028653 Archaea 11476
183 Ga0265322_10001474 3300028654 Archaea 7664
184 Ga0265338_10010611 3300028800 Bacteria 10770
185 Ga0265338_10026323 3300028800 Bacteria 5870
186 Ga0265324_10040872 3300029957 Bacteria 1606
187 Ga0265762_1010427 3300030760 Bacteria 1661
188 Ga0265760_10004432 3300031090 Bacteria 4033
189 Ga0265332_10006978 3300031238 Bacteria 5117
190 Ga0265325_10000556 3300031241 Bacteria 27056
191 Ga0265325_10001236 3300031241 Bacteria 18229
192 Ga0265339_10015390 3300031249 Bacteria 4585
193 Ga0265327_10036398 3300031251 Bacteria 2706
194 Ga0265316_10005771 3300031344 Archaea 11949
195 Ga0265316_10009448 3300031344 Bacteria 8981
196 Ga0307408_100088984 3300031548 Bacteria 2327
197 Ga0265313_10000001 3300031595 Bacteria 313647
198 Ga0265313_10005494 3300031595 Bacteria 9300
199 Ga0265342_10047585 3300031712 Bacteria 2573
200 Ga0265342_10181924 3300031712 Bacteria 1151
201 Ga0307410_10005300 3300031852 Bacteria 6808
202 Ga0307407_10003818 3300031903 Bacteria 6274
203 Ga0307409_100070250 3300031995 Bacteria 2779
204 Ga0373926_0000915 3300035083 Bacteria 8498
205 Ga0373944_0000592 3300035089 Bacteria 8604
206 Ga0373936_0002040 3300035113 Bacteria 7477
207 Ga0373936_0009761 3300035113 Bacteria 3622
208 Ga0373945_0001097 3300035116 Bacteria 8153
209 Ga0373945_0032647 3300035116 Bacteria 1846
210 Ga0373943_0012385 3300035170 Bacteria 3838
211 Ga0373943_0041239 3300035170 Bacteria 2231
212 Ga0373946_0003211 3300035171 Bacteria 5801
213 Ga0373961_0027495 3300035241 Bacteria 1562
214 Ga0373962_0031559 3300035242 Bacteria 1454
215 Ga0373924_0001936 3300035410 Bacteria 6882
216 Ga0373935_0006349 3300035692 Bacteria 7051
217 Ga0373935_0277165 3300035692 Bacteria 1180
218 Ga0373927_0004966 3300035695 Bacteria 9221
219 Ga0373927_0068638 3300035695 Bacteria 2294
220 Ga0373947_0003261 3300035725 Bacteria 9619
221 Ga0373947_0258443 3300035725 Bacteria 1153
222 Ga0373925_0023197 3300037068 Bacteria 4528
223 Ga0373925_0137258 3300037068 Bacteria 1912
224 Ga0373925_0150782 3300037068 Bacteria 1825
225 Ga0395899_0001433 3300037312 Bacteria 20397
226 Ga0395899_0048927 3300037312 Bacteria 3144
227 Ga0395900_0002948 3300037418 Bacteria 18534
228 Ga0395900_0159062 3300037418 Bacteria 2305
229 Ga0395900_0336860 3300037418 Bacteria 1485
230 Ga0395898_0034444 3300037466 Bacteria 5047
231 Ga0395898_0113799 3300037466 Bacteria 2593
232 Ga0395905_0026945 3300037471 Bacteria 5420
233 Ga0436364_0002727 3300037853 Bacteria 26959
234 Ga0436364_0273345 3300037853 Bacteria 2794207
235 Ga0436364_0333384 3300037853 Bacteria 1297
236 Ga0436364_0439129 3300037853 Bacteria 19631
237 Ga0436364_0543995 3300037853 Bacteria 1878
238 Ga0436364_1088159 3300037853 Bacteria 1787
239 Ga0436364_1228659 3300037853 Bacteria 11475
240 Ga0395901_0017020 3300038443 Bacteria 7409
241 Ga0395901_0077491 3300038443 Bacteria 3469
242 Ga0395901_0264684 3300038443 Bacteria 1789
243 Ga0436365_0504377 3300039437 Bacteria 87269
244 Ga0436365_1303266 3300039437 Bacteria 1110
245 Ga0436360_0184357 3300039438 Bacteria 1615
246 Ga0436360_1210070 3300039438 Bacteria 2066
247 Ga0436360_1220888 3300039438 Bacteria 1461
248 Ga0436361_0594478 3300039447 Bacteria 2398
249 Ga0436361_0738714 3300039447 Bacteria 102195
250 Ga0436361_0746194 3300039447 Bacteria 1127
251 Ga0436361_0848360 3300039447 Bacteria 59191
252 Ga0436361_0864338 3300039447 Bacteria 13180
253 Ga0436363_0398882 3300039450 Bacteria 3255
254 Ga0436363_0686363 3300039450 Bacteria 29005
255 Ga0436363_0771313 3300039450 Bacteria 1393
256 Ga0436363_1698845 3300039450 Bacteria 1837
257 Ga0436362_0082306 3300039453 Bacteria 8751
258 Ga0436362_0444421 3300039453 Bacteria 2459
259 Ga0436362_0661119 3300039453 Bacteria 1012
260 Ga0436362_0976537 3300039453 Bacteria 1114
261 Ga0466972_0176130 3300044658 Bacteria 1003
262 Ga0466966_0009763 3300044684 Bacteria 6360
263 Ga0466961_0011754 3300044693 Bacteria 5594
264 Ga0466963_0076663 3300044694 Bacteria 2258
265 Ga0453684_0093434 3300044712 Bacteria 3705
266 Ga0466971_0005098 3300044719 Bacteria 5689
267 Ga0466968_0012918 3300044735 Bacteria 3276
268 Ga0466970_0038497 3300044765 Bacteria 2537
269 Ga0466959_0018411 3300045049 Bacteria 5126
270 Ga0466958_0102664 3300045836 Bacteria 1779
271 Ga0466958_0158836 3300045836 Bacteria 1427
272 Ga0466967_0013063 3300045976 Bacteria 6394
273 Ga0495603_0006005 3300046455 Bacteria 7260
274 Ga0495603_0020169 3300046455 Bacteria 4040
275 Ga0495603_0210707 3300046455 Bacteria 1122
276 Ga0495629_0004389 3300046459 Bacteria 10566
277 Ga0495641_0012908 3300046461 Bacteria 4633
278 Ga0495653_0289040 3300046463 Bacteria 1073
279 Ga0495580_0004140 3300046472 Bacteria 12217
280 Ga0495580_0073819 3300046472 Bacteria 2381
281 Ga0495582_0007401 3300046473 Bacteria 6080
282 Ga0495582_0011074 3300046473 Bacteria 4965
283 Ga0495605_0044583 3300046474 Bacteria 2192
284 Ga0495639_0002738 3300046475 Bacteria 7654
285 Ga0495639_0040722 3300046475 Bacteria 2091
286 Ga0495662_0001263 3300046476 Bacteria 12497
287 Ga0495662_0090744 3300046476 Bacteria 1490
288 Ga0495584_0037612 3300046491 Bacteria 2447
289 Ga0495585_0007430 3300046492 Bacteria 6710
290 Ga0495594_0053342 3300046499 Bacteria 2227
291 Ga0495594_0097021 3300046499 Bacteria 1656
292 Ga0495607_0084254 3300046501 Bacteria 1740
293 Ga0495630_0009654 3300046517 Bacteria 6940
294 Ga0495630_0112954 3300046517 Bacteria 2058
295 Ga0495644_0005753 3300046523 Bacteria 4841
296 Ga0495663_0006529 3300046525 Bacteria 3219
297 Ga0495666_0007382 3300046526 Bacteria 5509
298 Ga0495666_0032527 3300046526 Bacteria 2552
299 Ga0495642_0010205 3300046528 Bacteria 3598
300 Ga0495665_0001766 3300046531 Bacteria 11643
301 Ga0495665_0004231 3300046531 Bacteria 7747
302 Ga0495665_0072237 3300046531 Bacteria 1817
303 Ga0495640_0007434 3300046533 Bacteria 8610
304 Ga0495586_0002992 3300046535 Bacteria 9116
305 Ga0495598_0000503 3300046537 Bacteria 7227
306 Ga0495609_0004949 3300046538 Bacteria 7149
307 Ga0495621_0039900 3300046539 Bacteria 1643
308 Ga0495656_0000985 3300046615 Bacteria 9209
309 Ga0495656_0023724 3300046615 Bacteria 2416
310 Ga0495656_0174571 3300046615 Bacteria 1053
311 Ga0495634_0003271 3300046642 Bacteria 13071
312 Ga0495634_0233878 3300046642 Bacteria 1130
313 Ga0495635_0002006 3300046663 Bacteria 13826
314 Ga0495659_0013175 3300046664 Bacteria 2689
315 Ga0495588_0004099 3300046674 Bacteria 6412
316 Ga0495647_0030669 3300046681 Bacteria 1996
317 Ga0495658_0028262 3300046683 Bacteria 3025
318 Ga0495658_0073074 3300046683 Bacteria 1996
319 Ga0495669_0089245 3300046684 Bacteria 1422
320 Ga0495613_0033174 3300046689 Bacteria 3836
321 Ga0495613_0107757 3300046689 Bacteria 2010
322 Ga0495613_0111905 3300046689 Bacteria 1967
323 Ga0495624_0085091 3300046690 Bacteria 1953
324 Ga0495624_0208400 3300046690 Bacteria 1186
325 Ga0495670_0032145 3300046691 Bacteria 2609
326 Ga0495589_0050342 3300046794 Bacteria 2060
327 Ga0495581_0002418 3300047315 Bacteria 10544
328 Ga0495581_0003395 3300047315 Bacteria 9147
329 Ga0495581_0185890 3300047315 Bacteria 1215
330 Ga0495604_0116609 3300047317 Bacteria 1938
331 Ga0495636_0006294 3300047318 Bacteria 4661
332 Ga0495674_0026996 3300047319 Bacteria 5251
333 Ga0495676_0199346 3300047321 Bacteria 1391
334 Ga0495680_0002324 3300047322 Bacteria 19496
335 Ga0495593_0011663 3300047673 Bacteria 5044
336 Ga0495614_0009464 3300048089 Bacteria 4306
337 Ga0496100_0008452 3300048903 Bacteria 5740
338 Ga0496102_0091136 3300048905 Bacteria 2821
339 Ga0496102_0234401 3300048905 Bacteria 1730
340 Ga0496103_0046983 3300048906 Bacteria 2666
341 Ga0496105_0242095 3300048908 Bacteria 1464
342 Ga0496106_0003924 3300048909 Bacteria 11108
343 Ga0496106_0044110 3300048909 Bacteria 3346
344 Ga0496107_0007061 3300048910 Bacteria 7736
345 Ga0496108_0008577 3300048911 Bacteria 8288
346 Ga0496109_0010839 3300048912 Bacteria 7803
347 Ga0496110_0076732 3300048913 Bacteria 2971
348 Ga0496112_0032418 3300048915 Bacteria 5073
349 Ga0496113_0055322 3300048916 Bacteria 2974
350 Ga0496114_0012276 3300048917 Bacteria 6854
351 Ga0496115_0227073 3300048918 Bacteria 1540
352 Ga0501032_0004257 3300049569 Bacteria 10811
353 Ga0501034_0004204 3300049571 Bacteria 16074
354 Ga0501037_0115222 3300049573 Bacteria 1934
355 Ga0501043_0035399 3300049579 Bacteria 3927
356 Ga0501047_0021116 3300049581 Bacteria 6252
357 Ga0501067_0116570 3300049583 Bacteria 1485
358 Ga0501068_0001135 3300049584 Bacteria 14099
359 Ga0501069_0001925 3300049585 Bacteria 10370
360 Ga0501069_0349602 3300049585 Bacteria 871
361 Ga0501070_0002476 3300049586 Bacteria 16188
362 Ga0501070_0412845 3300049586 Bacteria 1091
363 Ga0501072_0053092 3300049588 Bacteria 3191
364 Ga0501074_0009981 3300049590 Bacteria 6894
365 Ga0501076_0074903 3300049592 Bacteria 2712
366 Ga0501044_0044060 3300049823 Bacteria 4633
367 nmdc:mga05p37_401_c1 3300050507 Bacteria 39417
368 nmdc:mga09592_185246_c1 3300050508 Bacteria 1801
369 nmdc:mga09592_7269_c1 3300050508 Bacteria 9000
370 nmdc:mga0qj67_4372_c1 3300050509 Bacteria 10237
371 nmdc:mga0qj67_79694_c1 3300050509 Bacteria 2623
372 nmdc:mga06r32_115789_c1 3300050510 Unclassified 2640
373 nmdc:mga06r32_45897_c1 3300050510 Bacteria 4167
374 nmdc:mga06r32_84551_c1 3300050510 Unclassified 3093
375 nmdc:mga08y16_2504_c1 3300050511 Bacteria 18894
376 nmdc:mga08y16_419575_c1 3300050511 Bacteria 1368
377 Ga0495619_0002420 3300053085 Bacteria 12248
378 Ga0500590_003672 3300053148 Bacteria 7125
379 Ga0500637_0012448 3300053178 Bacteria 4434
380 Ga0466962_0089687 3300061719 Bacteria 1472

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0176130 Ga0466972_0176130_100_990 280
2 3300049585 Ga0501069_0349602 Ga0501069_0349602_18_860 280
3 3300046455 Ga0495603_0210707 Ga0495603_0210707_115_1062 283
4 3300046528 Ga0495642_0010205 Ga0495642_0010205_2713_3579 288
5 3300046475 Ga0495639_0040722 Ga0495639_0040722_1081_2028 289
6 3300046476 Ga0495662_0090744 Ga0495662_0090744_79_1017 289
7 3300031238 Ga0265332_10006978 Ga0265332_100069784 294
8 3300031241 Ga0265325_10000556 Ga0265325_100005563 294
9 3300031249 Ga0265339_10015390 Ga0265339_100153903 294
10 3300031344 Ga0265316_10009448 Ga0265316_100094489 294
11 3300031712 Ga0265342_10047585 Ga0265342_100475853 294
12 3300039453 Ga0436362_0661119 Ga0436362_0661119_13_915 294
13 3300050510 nmdc:mga06r32_115789_c1 nmdc:mga06r32_115789_c1_866_1801 294
14 3300025944 Ga0207661_10011442 Ga0207661_100114427 295
15 3300005616 Ga0068852_100159122 Ga0068852_1001591222 296
16 3300013296 Ga0157374_10171789 Ga0157374_101717893 296
17 3300026078 Ga0207702_10277654 Ga0207702_102776542 296
18 3300039438 Ga0436360_0184357 Ga0436360_0184357_310_1254 296
19 3300039453 Ga0436362_0444421 Ga0436362_0444421_867_1811 296
20 3300053148 Ga0500590_003672 Ga0500590_003672_567_1481 296
21 3300046690 Ga0495624_0208400 Ga0495624_0208400_208_1155 297
22 3300031595 Ga0265313_10000001 Ga0265313_10000001147 298
23 3300028653 Ga0265323_10001489 Ga0265323_1000148914 299
24 3300028654 Ga0265322_10001474 Ga0265322_100014742 299
25 3300031344 Ga0265316_10005771 Ga0265316_100057715 299
26 3300046689 Ga0495613_0107757 Ga0495613_0107757_1000_1935 299
27 3300044735 Ga0466968_0012918 Ga0466968_0012918_1943_2926 300
28 3300006844 Ga0075428_100004216 Ga0075428_10000421615 301
29 3300006880 Ga0075429_100080831 Ga0075429_1000808313 301
30 3300025907 Ga0207645_10010173 Ga0207645_100101733 301
31 3300050508 nmdc:mga09592_185246_c1 nmdc:mga09592_185246_c1_392_1594 301
32 3300006163 Ga0070715_10023310 Ga0070715_100233102 303
33 3300025905 Ga0207685_10046922 Ga0207685_100469221 303
34 3300048908 Ga0496105_0242095 Ga0496105_0242095_486_1424 303
35 3300005981 Ga0081538_10109641 Ga0081538_101096412 304
36 3300005445 Ga0070708_100023464 Ga0070708_1000234645 305
37 3300005549 Ga0070704_100098441 Ga0070704_1000984411 305
38 3300009148 Ga0105243_10002210 Ga0105243_100022107 305
39 3300009176 Ga0105242_10002443 Ga0105242_100024433 305
40 3300013297 Ga0157378_10008777 Ga0157378_100087775 305
41 3300013306 Ga0163162_10117216 Ga0163162_101172163 305
42 3300049590 Ga0501074_0009981 Ga0501074_0009981_4092_5030 305
43 iso_pu_bacteria 2881633906 2881634615 305
44 3300005436 Ga0070713_100040075 Ga0070713_1000400753 306
45 3300005985 Ga0081539_10017008 Ga0081539_100170082 306
46 3300006028 Ga0070717_10010902 Ga0070717_100109021 306
47 3300006163 Ga0070715_10126656 Ga0070715_101266561 306
48 3300006173 Ga0070716_100001002 Ga0070716_1000010022 306
49 3300006175 Ga0070712_100019509 Ga0070712_1000195092 306
50 3300006914 Ga0075436_100073454 Ga0075436_1000734542 306
51 3300025915 Ga0207693_10052678 Ga0207693_100526782 306
52 3300025928 Ga0207700_10195961 Ga0207700_101959611 306
53 3300025939 Ga0207665_10001081 Ga0207665_100010819 306
54 3300035113 Ga0373936_0009761 Ga0373936_0009761_2514_3446 306
55 3300035116 Ga0373945_0032647 Ga0373945_0032647_193_1125 306
56 3300035170 Ga0373943_0041239 Ga0373943_0041239_809_1741 306
57 3300035692 Ga0373935_0006349 Ga0373935_0006349_4760_5692 306
58 3300035695 Ga0373927_0068638 Ga0373927_0068638_712_1644 306
59 3300037068 Ga0373925_0023197 Ga0373925_0023197_2691_3623 306
60 3300039450 Ga0436363_1698845 Ga0436363_1698845_783_1715 306
61 3300046472 Ga0495580_0004140 Ga0495580_0004140_2938_3870 306
62 3300046473 Ga0495582_0011074 Ga0495582_0011074_2575_3507 306
63 3300046526 Ga0495666_0032527 Ga0495666_0032527_1587_2519 306
64 3300046531 Ga0495665_0004231 Ga0495665_0004231_6637_7569 306
65 3300046683 Ga0495658_0073074 Ga0495658_0073074_599_1531 306
66 3300047315 Ga0495581_0185890 Ga0495581_0185890_164_1096 306
67 3300047317 Ga0495604_0116609 Ga0495604_0116609_673_1593 306
68 3300005344 Ga0070661_100039822 Ga0070661_1000398221 307
69 3300005455 Ga0070663_100043870 Ga0070663_1000438703 307
70 3300005468 Ga0070707_100040346 Ga0070707_1000403463 307
71 3300005530 Ga0070679_100349612 Ga0070679_1003496122 307
72 3300005539 Ga0068853_100069116 Ga0068853_1000691163 307
73 3300005563 Ga0068855_100000391 Ga0068855_10000039121 307
74 3300005563 Ga0068855_100140643 Ga0068855_1001406433 307
75 3300005578 Ga0068854_100000141 Ga0068854_10000014129 307
76 3300006028 Ga0070717_10281521 Ga0070717_102815212 307
77 3300013105 Ga0157369_10303560 Ga0157369_103035602 307
78 3300013307 Ga0157372_10390510 Ga0157372_103905102 307
79 3300020070 Ga0206356_10861532 Ga0206356_1086153210 307
80 3300021361 Ga0213872_10003057 Ga0213872_100030574 307
81 3300021361 Ga0213872_10021704 Ga0213872_100217043 307
82 3300021361 Ga0213872_10042465 Ga0213872_100424652 307
83 3300025920 Ga0207649_10178451 Ga0207649_101784512 307
84 3300025921 Ga0207652_10262108 Ga0207652_102621082 307
85 3300025929 Ga0207664_10001635 Ga0207664_1000163514 307
86 3300025949 Ga0207667_10000103 Ga0207667_10000103117 307
87 3300025949 Ga0207667_10005010 Ga0207667_100050109 307
88 3300025981 Ga0207640_10000004 Ga0207640_10000004239 307
89 3300026035 Ga0207703_10131745 Ga0207703_101317452 307
90 3300026067 Ga0207678_10025540 Ga0207678_100255407 307
91 3300026078 Ga0207702_10012785 Ga0207702_100127852 307
92 3300028017 Ga0265356_1000481 Ga0265356_10004814 307
93 3300030760 Ga0265762_1010427 Ga0265762_10104272 307
94 3300031241 Ga0265325_10001236 Ga0265325_100012363 307
95 3300037312 Ga0395899_0001433 Ga0395899_0001433_14386_15324 307
96 3300037418 Ga0395900_0002948 Ga0395900_0002948_15860_16798 307
97 3300037466 Ga0395898_0034444 Ga0395898_0034444_2740_3678 307
98 3300037853 Ga0436364_0543995 Ga0436364_0543995_325_1266 307
99 3300038443 Ga0395901_0017020 Ga0395901_0017020_3776_4714 307
100 3300039438 Ga0436360_1210070 Ga0436360_1210070_721_1662 307
101 3300039438 Ga0436360_1220888 Ga0436360_1220888_476_1417 307
102 3300039447 Ga0436361_0594478 Ga0436361_0594478_171_1112 307
103 3300039447 Ga0436361_0738714 Ga0436361_0738714_84721_85662 307
104 3300039447 Ga0436361_0746194 Ga0436361_0746194_136_1071 307
105 3300039447 Ga0436361_0864338 Ga0436361_0864338_4325_5266 307
106 3300039450 Ga0436363_0398882 Ga0436363_0398882_2184_3131 307
107 3300039453 Ga0436362_0082306 Ga0436362_0082306_2702_3643 307
108 3300044684 Ga0466966_0009763 Ga0466966_0009763_1954_2892 307
109 3300044712 Ga0453684_0093434 Ga0453684_0093434_2460_3419 307
110 3300045836 Ga0466958_0158836 Ga0466958_0158836_269_1210 307
111 3300045976 Ga0466967_0013063 Ga0466967_0013063_3030_3968 307
112 3300046517 Ga0495630_0112954 Ga0495630_0112954_175_1125 307
113 3300053178 Ga0500637_0012448 Ga0500637_0012448_3323_4249 307
114 iso_pu_bacteria 2928519762 2928520219 307
115 3300021388 Ga0213875_10025042 Ga0213875_100250423 308
116 3300021388 Ga0213875_10055600 Ga0213875_100556002 308
117 3300031090 Ga0265760_10004432 Ga0265760_100044323 308
118 3300037853 Ga0436364_0002727 Ga0436364_0002727_20051_21007 308
119 3300037853 Ga0436364_0333384 Ga0436364_0333384_175_1128 308
120 3300037853 Ga0436364_1228659 Ga0436364_1228659_6677_7633 308
121 3300039437 Ga0436365_1303266 Ga0436365_1303266_58_1014 308
122 3300039450 Ga0436363_0771313 Ga0436363_0771313_18_974 308
123 3300039453 Ga0436362_0976537 Ga0436362_0976537_13_969 308
124 3300005329 Ga0070683_100058530 Ga0070683_1000585303 309
125 3300005458 Ga0070681_10028551 Ga0070681_100285514 309
126 3300005530 Ga0070679_100027943 Ga0070679_1000279434 309
127 3300005530 Ga0070679_100089692 Ga0070679_1000896922 309
128 3300005535 Ga0070684_100304389 Ga0070684_1003043892 309
129 3300005545 Ga0070695_100000066 Ga0070695_10000006641 309
130 3300009093 Ga0105240_10003994 Ga0105240_100039949 309
131 3300009545 Ga0105237_10004747 Ga0105237_100047472 309
132 3300013307 Ga0157372_10015220 Ga0157372_100152203 309
133 3300025912 Ga0207707_10065858 Ga0207707_100658584 309
134 3300025913 Ga0207695_10115488 Ga0207695_101154882 309
135 3300025914 Ga0207671_10133229 Ga0207671_101332292 309
136 3300025917 Ga0207660_10039920 Ga0207660_100399204 309
137 3300025921 Ga0207652_10010821 Ga0207652_100108213 309
138 3300025921 Ga0207652_10080137 Ga0207652_100801372 309
139 3300028800 Ga0265338_10010611 Ga0265338_100106112 309
140 3300028800 Ga0265338_10026323 Ga0265338_100263236 309
141 3300029957 Ga0265324_10040872 Ga0265324_100408722 309
142 3300031251 Ga0265327_10036398 Ga0265327_100363983 309
143 3300031595 Ga0265313_10005494 Ga0265313_100054948 309
144 3300031712 Ga0265342_10181924 Ga0265342_101819241 309
145 3300044693 Ga0466961_0011754 Ga0466961_0011754_392_1375 309
146 3300044694 Ga0466963_0076663 Ga0466963_0076663_577_1560 309
147 3300044719 Ga0466971_0005098 Ga0466971_0005098_2688_3671 309
148 3300044765 Ga0466970_0038497 Ga0466970_0038497_158_1141 309
149 3300045049 Ga0466959_0018411 Ga0466959_0018411_2644_3627 309
150 3300045836 Ga0466958_0102664 Ga0466958_0102664_294_1277 309
151 3300046474 Ga0495605_0044583 Ga0495605_0044583_463_1392 309
152 3300046491 Ga0495584_0037612 Ga0495584_0037612_361_1290 309
153 3300046492 Ga0495585_0007430 Ga0495585_0007430_1321_2250 309
154 3300046523 Ga0495644_0005753 Ga0495644_0005753_2357_3286 309
155 3300046525 Ga0495663_0006529 Ga0495663_0006529_630_1559 309
156 3300046537 Ga0495598_0000503 Ga0495598_0000503_6085_7014 309
157 3300046538 Ga0495609_0004949 Ga0495609_0004949_86_1015 309
158 3300046539 Ga0495621_0039900 Ga0495621_0039900_560_1489 309
159 3300046615 Ga0495656_0000985 Ga0495656_0000985_999_1928 309
160 3300046664 Ga0495659_0013175 Ga0495659_0013175_1667_2596 309
161 3300046689 Ga0495613_0111905 Ga0495613_0111905_828_1781 309
162 3300046691 Ga0495670_0032145 Ga0495670_0032145_1029_1958 309
163 3300046794 Ga0495589_0050342 Ga0495589_0050342_551_1480 309
164 3300047318 Ga0495636_0006294 Ga0495636_0006294_487_1416 309
165 3300048905 Ga0496102_0091136 Ga0496102_0091136_1016_1999 309
166 3300049586 Ga0501070_0412845 Ga0501070_0412845_85_1068 309
167 3300061719 Ga0466962_0089687 Ga0466962_0089687_226_1209 309
168 3300005347 Ga0070668_100046757 Ga0070668_1000467574 310
169 3300005364 Ga0070673_100451695 Ga0070673_1004516951 310
170 3300005439 Ga0070711_100001496 Ga0070711_1000014966 310
171 3300005441 Ga0070700_100224917 Ga0070700_1002249172 310
172 3300006163 Ga0070715_10000802 Ga0070715_100008026 310
173 3300006173 Ga0070716_100075302 Ga0070716_1000753022 310
174 3300006844 Ga0075428_100127030 Ga0075428_1001270302 310
175 3300006846 Ga0075430_100012036 Ga0075430_1000120364 310
176 3300006847 Ga0075431_100006034 Ga0075431_10000603413 310
177 3300006880 Ga0075429_100008175 Ga0075429_1000081758 310
178 3300009094 Ga0111539_10007857 Ga0111539_1000785710 310
179 3300014326 Ga0157380_10234663 Ga0157380_102346632 310
180 3300014326 Ga0157380_10499543 Ga0157380_104995431 310
181 3300021377 Ga0213874_10000011 Ga0213874_1000001124 310
182 3300021384 Ga0213876_10003274 Ga0213876_100032747 310
183 3300025905 Ga0207685_10059863 Ga0207685_100598632 310
184 3300025915 Ga0207693_10000737 Ga0207693_1000073721 310
185 3300025916 Ga0207663_10009307 Ga0207663_100093077 310
186 3300025938 Ga0207704_10110448 Ga0207704_101104483 310
187 3300025939 Ga0207665_10084200 Ga0207665_100842003 310
188 3300026075 Ga0207708_10053097 Ga0207708_100530973 310
189 3300026095 Ga0207676_10295561 Ga0207676_102955612 310
190 3300026118 Ga0207675_100311315 Ga0207675_1003113152 310
191 3300027907 Ga0207428_10224024 Ga0207428_102240242 310
192 3300031548 Ga0307408_100088984 Ga0307408_1000889842 310
193 3300031852 Ga0307410_10005300 Ga0307410_100053002 310
194 3300031903 Ga0307407_10003818 Ga0307407_100038182 310
195 3300031995 Ga0307409_100070250 Ga0307409_1000702501 310
196 3300035083 Ga0373926_0000915 Ga0373926_0000915_5641_6582 310
197 3300035089 Ga0373944_0000592 Ga0373944_0000592_5646_6587 310
198 3300035113 Ga0373936_0002040 Ga0373936_0002040_5641_6582 310
199 3300035116 Ga0373945_0001097 Ga0373945_0001097_5306_6247 310
200 3300035170 Ga0373943_0012385 Ga0373943_0012385_1123_2064 310
201 3300035171 Ga0373946_0003211 Ga0373946_0003211_3297_4238 310
202 3300035410 Ga0373924_0001936 Ga0373924_0001936_2920_3861 310
203 3300035695 Ga0373927_0004966 Ga0373927_0004966_1979_2920 310
204 3300035725 Ga0373947_0003261 Ga0373947_0003261_6308_7249 310
205 3300035725 Ga0373947_0258443 Ga0373947_0258443_86_1027 310
206 3300037068 Ga0373925_0150782 Ga0373925_0150782_176_1117 310
207 3300037312 Ga0395899_0048927 Ga0395899_0048927_1364_2296 310
208 3300037418 Ga0395900_0159062 Ga0395900_0159062_67_999 310
209 3300037466 Ga0395898_0113799 Ga0395898_0113799_315_1247 310
210 3300037471 Ga0395905_0026945 Ga0395905_0026945_3334_4266 310
211 3300038443 Ga0395901_0077491 Ga0395901_0077491_1123_2055 310
212 3300039437 Ga0436365_0504377 Ga0436365_0504377_37785_38747 310
213 3300039450 Ga0436363_0686363 Ga0436363_0686363_26895_27857 310
214 3300046455 Ga0495603_0006005 Ga0495603_0006005_4716_5657 310
215 3300046459 Ga0495629_0004389 Ga0495629_0004389_3137_4078 310
216 3300046461 Ga0495641_0012908 Ga0495641_0012908_1918_2859 310
217 3300046463 Ga0495653_0289040 Ga0495653_0289040_68_1009 310
218 3300046472 Ga0495580_0073819 Ga0495580_0073819_433_1374 310
219 3300046473 Ga0495582_0007401 Ga0495582_0007401_3217_4158 310
220 3300046475 Ga0495639_0002738 Ga0495639_0002738_1123_2064 310
221 3300046476 Ga0495662_0001263 Ga0495662_0001263_5320_6261 310
222 3300046499 Ga0495594_0053342 Ga0495594_0053342_1215_2150 310
223 3300046499 Ga0495594_0097021 Ga0495594_0097021_303_1244 310
224 3300046517 Ga0495630_0009654 Ga0495630_0009654_2247_3188 310
225 3300046526 Ga0495666_0007382 Ga0495666_0007382_597_1538 310
226 3300046531 Ga0495665_0001766 Ga0495665_0001766_6827_7768 310
227 3300046533 Ga0495640_0007434 Ga0495640_0007434_5106_6047 310
228 3300046535 Ga0495586_0002992 Ga0495586_0002992_3753_4694 310
229 3300046615 Ga0495656_0174571 Ga0495656_0174571_72_1004 310
230 3300046642 Ga0495634_0003271 Ga0495634_0003271_5523_6464 310
231 3300046663 Ga0495635_0002006 Ga0495635_0002006_2499_3440 310
232 3300046674 Ga0495588_0004099 Ga0495588_0004099_3908_4849 310
233 3300046681 Ga0495647_0030669 Ga0495647_0030669_176_1117 310
234 3300046683 Ga0495658_0028262 Ga0495658_0028262_303_1244 310
235 3300046684 Ga0495669_0089245 Ga0495669_0089245_245_1177 310
236 3300046689 Ga0495613_0033174 Ga0495613_0033174_2499_3440 310
237 3300046690 Ga0495624_0085091 Ga0495624_0085091_176_1117 310
238 3300047315 Ga0495581_0003395 Ga0495581_0003395_4062_5003 310
239 3300047319 Ga0495674_0026996 Ga0495674_0026996_1812_2753 310
240 3300047321 Ga0495676_0199346 Ga0495676_0199346_69_1010 310
241 3300047322 Ga0495680_0002324 Ga0495680_0002324_14803_15744 310
242 3300047673 Ga0495593_0011663 Ga0495593_0011663_1921_2862 310
243 3300048089 Ga0495614_0009464 Ga0495614_0009464_2371_3312 310
244 3300050508 nmdc:mga09592_7269_c1 nmdc:mga09592_7269_c1_3263_4198 310
245 3300050509 nmdc:mga0qj67_4372_c1 nmdc:mga0qj67_4372_c1_6037_6972 310
246 3300050510 nmdc:mga06r32_84551_c1 nmdc:mga06r32_84551_c1_1656_2591 310
247 3300050511 nmdc:mga08y16_2504_c1 nmdc:mga08y16_2504_c1_9801_10733 310
248 3300053085 Ga0495619_0002420 Ga0495619_0002420_5646_6587 310
249 3300005331 Ga0070670_100203798 Ga0070670_1002037982 311
250 3300005336 Ga0070680_100125386 Ga0070680_1001253862 311
251 3300005356 Ga0070674_100049253 Ga0070674_1000492533 311
252 3300005406 Ga0070703_10000003 Ga0070703_10000003149 311
253 3300005444 Ga0070694_100009992 Ga0070694_1000099923 311
254 3300005459 Ga0068867_100037323 Ga0068867_1000373235 311
255 3300005467 Ga0070706_100000344 Ga0070706_10000034462 311
256 3300005468 Ga0070707_100005694 Ga0070707_1000056946 311
257 3300005549 Ga0070704_100036835 Ga0070704_1000368354 311
258 3300005615 Ga0070702_100025249 Ga0070702_1000252493 311
259 3300005718 Ga0068866_10007553 Ga0068866_100075532 311
260 3300005718 Ga0068866_10056375 Ga0068866_100563753 311
261 3300005840 Ga0068870_10313531 Ga0068870_103135311 311
262 3300006844 Ga0075428_100028951 Ga0075428_1000289513 311
263 3300006847 Ga0075431_100115884 Ga0075431_1001158843 311
264 3300009098 Ga0105245_10035012 Ga0105245_100350122 311
265 3300009148 Ga0105243_10013120 Ga0105243_100131207 311
266 3300014325 Ga0163163_10315888 Ga0163163_103158882 311
267 3300021388 Ga0213875_10000001 Ga0213875_100000012221 311
268 3300025885 Ga0207653_10000001 Ga0207653_1000000180 311
269 3300025899 Ga0207642_10059981 Ga0207642_100599812 311
270 3300025922 Ga0207646_10033011 Ga0207646_100330114 311
271 3300025935 Ga0207709_10019109 Ga0207709_100191093 311
272 3300025935 Ga0207709_10028417 Ga0207709_100284173 311
273 3300025937 Ga0207669_10003844 Ga0207669_100038445 311
274 3300025938 Ga0207704_10037812 Ga0207704_100378124 311
275 3300026023 Ga0207677_10373273 Ga0207677_103732731 311
276 3300026089 Ga0207648_10007678 Ga0207648_100076785 311
277 3300026118 Ga0207675_100045576 Ga0207675_1000455762 311
278 3300037853 Ga0436364_0273345 Ga0436364_0273345_2337449_2338420 311
279 3300037853 Ga0436364_0439129 Ga0436364_0439129_13924_14937 311
280 3300037853 Ga0436364_1088159 Ga0436364_1088159_139_1146 311
281 3300039447 Ga0436361_0848360 Ga0436361_0848360_35898_36956 311
282 3300046455 Ga0495603_0020169 Ga0495603_0020169_2574_3509 311
283 3300046501 Ga0495607_0084254 Ga0495607_0084254_654_1589 311
284 3300048905 Ga0496102_0234401 Ga0496102_0234401_219_1154 311
285 3300048909 Ga0496106_0003924 Ga0496106_0003924_516_1451 311
286 3300048916 Ga0496113_0055322 Ga0496113_0055322_1672_2607 311
287 3300049569 Ga0501032_0004257 Ga0501032_0004257_7185_8123 311
288 3300049571 Ga0501034_0004204 Ga0501034_0004204_3393_4331 311
289 3300049573 Ga0501037_0115222 Ga0501037_0115222_276_1214 311
290 3300049579 Ga0501043_0035399 Ga0501043_0035399_1125_2063 311
291 3300049581 Ga0501047_0021116 Ga0501047_0021116_2548_3486 311
292 3300049584 Ga0501068_0001135 Ga0501068_0001135_11929_12867 311
293 3300049585 Ga0501069_0001925 Ga0501069_0001925_8506_9444 311
294 3300049586 Ga0501070_0002476 Ga0501070_0002476_11132_12070 311
295 3300049588 Ga0501072_0053092 Ga0501072_0053092_148_1086 311
296 3300049592 Ga0501076_0074903 Ga0501076_0074903_721_1659 311
297 3300049823 Ga0501044_0044060 Ga0501044_0044060_1092_2030 311
298 3300050509 nmdc:mga0qj67_79694_c1 nmdc:mga0qj67_79694_c1_792_1727 311
299 3300050510 nmdc:mga06r32_45897_c1 nmdc:mga06r32_45897_c1_1258_2193 311
300 3300005328 Ga0070676_10014134 Ga0070676_100141343 312
301 3300005330 Ga0070690_100125211 Ga0070690_1001252111 312
302 3300005338 Ga0068868_100009562 Ga0068868_1000095623 312
303 3300005341 Ga0070691_10048746 Ga0070691_100487462 312
304 3300005354 Ga0070675_100160567 Ga0070675_1001605672 312
305 3300005355 Ga0070671_100060888 Ga0070671_1000608883 312
306 3300005365 Ga0070688_100090603 Ga0070688_1000906032 312
307 3300005366 Ga0070659_100109547 Ga0070659_1001095472 312
308 3300005459 Ga0068867_100011247 Ga0068867_1000112474 312
309 3300005471 Ga0070698_100030268 Ga0070698_1000302682 312
310 3300005544 Ga0070686_100003014 Ga0070686_1000030146 312
311 3300005545 Ga0070695_100180862 Ga0070695_1001808622 312
312 3300005547 Ga0070693_100063860 Ga0070693_1000638603 312
313 3300005578 Ga0068854_100097295 Ga0068854_1000972951 312
314 3300005615 Ga0070702_100030947 Ga0070702_1000309472 312
315 3300005618 Ga0068864_100039613 Ga0068864_1000396135 312
316 3300005718 Ga0068866_10017800 Ga0068866_100178002 312
317 3300005840 Ga0068870_10087585 Ga0068870_100875852 312
318 3300005844 Ga0068862_100135036 Ga0068862_1001350362 312
319 3300005937 Ga0081455_10116939 Ga0081455_101169392 312
320 3300006175 Ga0070712_100119387 Ga0070712_1001193872 312
321 3300006358 Ga0068871_100333520 Ga0068871_1003335201 312
322 3300006844 Ga0075428_100056465 Ga0075428_1000564653 312
323 3300006880 Ga0075429_100045889 Ga0075429_1000458892 312
324 3300006881 Ga0068865_100234378 Ga0068865_1002343782 312
325 3300009094 Ga0111539_10064149 Ga0111539_100641492 312
326 3300009098 Ga0105245_10530579 Ga0105245_105305791 312
327 3300009101 Ga0105247_10035752 Ga0105247_100357522 312
328 3300009147 Ga0114129_10007952 Ga0114129_100079525 312
329 3300009147 Ga0114129_10225127 Ga0114129_102251273 312
330 3300009148 Ga0105243_10087723 Ga0105243_100877232 312
331 3300009176 Ga0105242_10004350 Ga0105242_100043509 312
332 3300009177 Ga0105248_10007846 Ga0105248_100078462 312
333 3300009551 Ga0105238_10115096 Ga0105238_101150964 312
334 3300010375 Ga0105239_10328319 Ga0105239_103283191 312
335 3300013296 Ga0157374_10179198 Ga0157374_101791983 312
336 3300013297 Ga0157378_10017146 Ga0157378_100171467 312
337 3300013306 Ga0163162_10494094 Ga0163162_104940942 312
338 3300013308 Ga0157375_10022031 Ga0157375_100220312 312
339 3300014325 Ga0163163_10007957 Ga0163163_100079575 312
340 3300014968 Ga0157379_10089194 Ga0157379_100891942 312
341 3300025901 Ga0207688_10015870 Ga0207688_100158703 312
342 3300025907 Ga0207645_10020766 Ga0207645_100207662 312
343 3300025915 Ga0207693_10090654 Ga0207693_100906542 312
344 3300025924 Ga0207694_10298917 Ga0207694_102989171 312
345 3300025926 Ga0207659_10122681 Ga0207659_101226812 312
346 3300025927 Ga0207687_10004187 Ga0207687_100041872 312
347 3300025931 Ga0207644_10034929 Ga0207644_100349292 312
348 3300025932 Ga0207690_10268905 Ga0207690_102689051 312
349 3300025934 Ga0207686_10006626 Ga0207686_100066267 312
350 3300025935 Ga0207709_10052325 Ga0207709_100523252 312
351 3300025938 Ga0207704_10019632 Ga0207704_100196325 312
352 3300026023 Ga0207677_10032384 Ga0207677_100323844 312
353 3300026078 Ga0207702_10357107 Ga0207702_103571072 312
354 3300026089 Ga0207648_10005510 Ga0207648_1000551013 312
355 3300026095 Ga0207676_10018551 Ga0207676_100185516 312
356 3300026118 Ga0207675_100033111 Ga0207675_1000331116 312
357 3300026121 Ga0207683_10027002 Ga0207683_100270027 312
358 3300026142 Ga0207698_10184229 Ga0207698_101842291 312
359 3300028381 Ga0268264_10244528 Ga0268264_102445282 312
360 3300035241 Ga0373961_0027495 Ga0373961_0027495_238_1185 312
361 3300035242 Ga0373962_0031559 Ga0373962_0031559_217_1164 312
362 3300035692 Ga0373935_0277165 Ga0373935_0277165_176_1114 312
363 3300037068 Ga0373925_0137258 Ga0373925_0137258_619_1557 312
364 3300037418 Ga0395900_0336860 Ga0395900_0336860_309_1262 312
365 3300038443 Ga0395901_0264684 Ga0395901_0264684_86_1039 312
366 3300046531 Ga0495665_0072237 Ga0495665_0072237_761_1708 312
367 3300046615 Ga0495656_0023724 Ga0495656_0023724_608_1555 312
368 3300046642 Ga0495634_0233878 Ga0495634_0233878_108_1046 312
369 3300047315 Ga0495581_0002418 Ga0495581_0002418_6036_6983 312
370 3300048903 Ga0496100_0008452 Ga0496100_0008452_3722_4669 312
371 3300048906 Ga0496103_0046983 Ga0496103_0046983_163_1110 312
372 3300048909 Ga0496106_0044110 Ga0496106_0044110_918_1865 312
373 3300048910 Ga0496107_0007061 Ga0496107_0007061_4296_5243 312
374 3300048911 Ga0496108_0008577 Ga0496108_0008577_928_1875 312
375 3300048912 Ga0496109_0010839 Ga0496109_0010839_1005_1955 312
376 3300048913 Ga0496110_0076732 Ga0496110_0076732_834_1781 312
377 3300048915 Ga0496112_0032418 Ga0496112_0032418_616_1563 312
378 3300048917 Ga0496114_0012276 Ga0496114_0012276_1093_2040 312
379 3300048918 Ga0496115_0227073 Ga0496115_0227073_454_1401 312
380 3300049583 Ga0501067_0116570 Ga0501067_0116570_503_1441 312
381 3300050507 nmdc:mga05p37_401_c1 nmdc:mga05p37_401_c1_37141_38094 312
382 3300050511 nmdc:mga08y16_419575_c1 nmdc:mga08y16_419575_c1_113_1054 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

182

259

0.92

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

41

328

0.92

PF00890

FAD_binding_2

FAD binding domain

42

82

0.87

PF13241

NAD_binding_7

Putative NAD(P)-binding

177

332

0.83

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

92

311

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uth-assembly1.cif.gz_A crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad 0.946 3 307
3f8r-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two nadp molecules 0.9432 2 307
2a87-assembly1.cif.gz_B crystal structure of m. tuberculosis thioredoxin reductase 0.942 6 307
3f8r-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two nadp molecules 0.9412 2 307
3f8r-assembly2.cif.gz_C crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two nadp molecules 0.9411 2 307
ID Description Score Start End Superfamily
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9976 117 239 3.50.50.60
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9896 117 239 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9807 117 239 3.50.50.60
4zn0C02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9794 117 239 3.50.50.60
5u63A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9752 117 239 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3C0YJU2-F1-model_v4 deleted 1 135 201
AF-A0A3B9APB7-F1-model_v4 Thioredoxin-disulfide reductase 0.9928 113 274 GO:0016668
AF-A0A6B3EPH4-F1-model_v4 FAD-dependent oxidoreductase 0.9911 112 225 GO:0016668
AF-A0A3D5UWY6-F1-model_v4 Thioredoxin-disulfide reductase 0.9908 142 231 GO:0016491
AF-A0A7H4N4U0-F1-model_v4 Alkyl hydroperoxide reductase protein F (EC 1.8.1.-) 0.9826 119 201 GO:0016668

Feature Viewer

pLDDT pTM Quality
92.41 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map