F429357

General Info

Members Datasets Scaffolds Average Seq Length
382 208 369 340

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0008633|Ga0451577_0008633_5633_6775
Length 380
Sequence VAGPDDRPAPPPAASSLNADAGSTVASRAPLALLVTVAVALLGATLAVWGHLPLPWFTGPLLAIAAVNIAGAHLPAVPYARDAGQWVIGTALGLYFTPEVIREVLRLAPWVLGATAFMMVLGLAGALVLRRLTGESGTTAFFACAIGGASEMAAQAERHGARVDRVAAAHSLRIMLVALIVPFTLQWAGVHGADPYEPAARVFHWAGFAVLVAVTGGGAIVLLRLNAPNVFMIGPLLVAAALTGSGVTLSSLPTPVLNAGQLLIGIALGTRFSPEFFRAAPRYLAAVALVTLGYLVVAALFGWAMSALAGISVATAVLATTPGGIGEMALTAKLLKLGAPIVTAYHSIRMSLVVLTIGPLYRLVRALAGKATKASKGVSS

Samples

Sample ID Description Type Environment
1 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
2 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
3 2643221569 Achromobacter sp. Root565 Isolate Unclassified
4 2643221594 Achromobacter sp. Root170 Isolate Unclassified
5 2643221621 Achromobacter sp. Root83 Isolate Unclassified
6 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
7 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
8 2858950400 Achromobacter sp. K91 Isolate Unclassified
9 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
10 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
11 2941479691
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
206 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
208 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.6
Metatranscriptomes 0
Isolates 3.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.71
Nodule 0.52
Rhizoplane 2.62
Rhizosphere 85.86
Stem 0
Stem Tuber 0
Unclassified 6.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10159110 3300005293 Bacteria 1647
2 Ga0070658_10047651 3300005327 Bacteria 3468
3 Ga0070676_10008812 3300005328 Bacteria 5445
4 Ga0070690_100000082 3300005330 Bacteria 46700
5 Ga0070690_100087997 3300005330 Bacteria 2041
6 Ga0070670_100010680 3300005331 Bacteria 7845
7 Ga0070670_100028388 3300005331 Bacteria 4816
8 Ga0070670_100099174 3300005331 Bacteria 2507
9 Ga0068869_100000267 3300005334 Bacteria 27307
10 Ga0068869_100061251 3300005334 Bacteria 2760
11 Ga0068869_100273267 3300005334 Bacteria 1356
12 Ga0070666_10004321 3300005335 Bacteria 8646
13 Ga0070666_10052552 3300005335 Bacteria 2746
14 Ga0070666_10053869 3300005335 Bacteria 2714
15 Ga0070680_100000771 3300005336 Bacteria 22468
16 Ga0068868_100069404 3300005338 Bacteria 2808
17 Ga0068868_100109632 3300005338 Bacteria 2242
18 Ga0068868_100218845 3300005338 Bacteria 1593
19 Ga0070668_100002967 3300005347 Bacteria 12545
20 Ga0070668_100004242 3300005347 Bacteria 10636
21 Ga0070668_100010606 3300005347 Bacteria 6853
22 Ga0070668_100045494 3300005347 Bacteria 3367
23 Ga0070669_100013145 3300005353 Bacteria 5884
24 Ga0070675_100002591 3300005354 Bacteria 13557
25 Ga0070675_100053012 3300005354 Bacteria 3335
26 Ga0070675_100100030 3300005354 Bacteria 2441
27 Ga0070675_100186265 3300005354 Bacteria 1796
28 Ga0070671_100013678 3300005355 Bacteria 6545
29 Ga0070671_100013907 3300005355 Bacteria 6493
30 Ga0070674_100000372 3300005356 Bacteria 22494
31 Ga0070674_100012275 3300005356 Bacteria 5258
32 Ga0070674_100020026 3300005356 Bacteria 4264
33 Ga0070673_100000878 3300005364 Bacteria 16947
34 Ga0070673_100009498 3300005364 Bacteria 6531
35 Ga0070673_100027816 3300005364 Bacteria 4196
36 Ga0070667_100001389 3300005367 Bacteria 21680
37 Ga0070667_100014325 3300005367 Bacteria 6554
38 Ga0070667_100107500 3300005367 Bacteria 2416
39 Ga0070705_100000030 3300005440 Bacteria 71489
40 Ga0070705_100030253 3300005440 Bacteria 2987
41 Ga0070694_100004053 3300005444 Bacteria 8778
42 Ga0070708_100000702 3300005445 Bacteria 25520
43 Ga0070663_100096832 3300005455 Bacteria 2195
44 Ga0070678_100000157 3300005456 Bacteria 28388
45 Ga0070678_100003653 3300005456 Bacteria 8588
46 Ga0070678_100014666 3300005456 Bacteria 4954
47 Ga0070678_100137514 3300005456 Bacteria 1950
48 Ga0070678_100269915 3300005456 Bacteria 1434
49 Ga0070662_100189926 3300005457 Bacteria 1624
50 Ga0068867_100001231 3300005459 Bacteria 17629
51 Ga0068867_100001367 3300005459 Bacteria 16842
52 Ga0068867_100013617 3300005459 Bacteria 5760
53 Ga0068867_100038149 3300005459 Bacteria 3497
54 Ga0068867_100063553 3300005459 Bacteria 2743
55 Ga0068867_100074843 3300005459 Bacteria 2539
56 Ga0070706_100133953 3300005467 Bacteria 2313
57 Ga0070707_100191680 3300005468 Bacteria 1993
58 Ga0070698_100033857 3300005471 Bacteria 5293
59 Ga0070699_100127591 3300005518 Unclassified 2241
60 Ga0068853_100004908 3300005539 Bacteria 10409
61 Ga0068853_100187172 3300005539 Bacteria 1880
62 Ga0070672_100011382 3300005543 Bacteria 6204
63 Ga0070672_100019165 3300005543 Bacteria 4962
64 Ga0070672_100058119 3300005543 Bacteria 3038
65 Ga0070672_100242456 3300005543 Bacteria 1516
66 Ga0070686_100125254 3300005544 Bacteria 1769
67 Ga0070695_100209052 3300005545 Bacteria 1399
68 Ga0070696_100000344 3300005546 Bacteria 28208
69 Ga0070693_100002446 3300005547 Bacteria 8556
70 Ga0070665_100007095 3300005548 Bacteria 11383
71 Ga0070665_100027406 3300005548 Bacteria 5739
72 Ga0070665_100056016 3300005548 Bacteria 3953
73 Ga0070665_100167325 3300005548 Bacteria 2200
74 Ga0070704_100000159 3300005549 Bacteria 26321
75 Ga0068855_100136356 3300005563 Bacteria 2800
76 Ga0068857_100005520 3300005577 Bacteria 10789
77 Ga0068854_100027815 3300005578 Bacteria 3901
78 Ga0068856_100056437 3300005614 Bacteria 3874
79 Ga0068852_100001558 3300005616 Bacteria 15581
80 Ga0068859_100005297 3300005617 Bacteria 13116
81 Ga0068859_100057691 3300005617 Bacteria 3911
82 Ga0068859_100062018 3300005617 Bacteria 3768
83 Ga0068859_100094231 3300005617 Bacteria 3046
84 Ga0068859_100231843 3300005617 Bacteria 1935
85 Ga0068864_100000567 3300005618 Bacteria 31430
86 Ga0068864_100060175 3300005618 Bacteria 3288
87 Ga0068864_100088141 3300005618 Bacteria 2733
88 Ga0068861_100009628 3300005719 Bacteria 6674
89 Ga0068861_100154249 3300005719 Bacteria 1887
90 Ga0068851_10001185 3300005834 Bacteria 11334
91 Ga0068870_10002513 3300005840 Bacteria 7658
92 Ga0068863_100001637 3300005841 Bacteria 22158
93 Ga0068863_100009606 3300005841 Bacteria 9435
94 Ga0068863_100047146 3300005841 Bacteria 4089
95 Ga0068863_100154396 3300005841 Bacteria 2197
96 Ga0068858_100005417 3300005842 Bacteria 12500
97 Ga0068858_100028067 3300005842 Bacteria 5230
98 Ga0068858_100073107 3300005842 Bacteria 3183
99 Ga0068860_100015997 3300005843 Bacteria 7319
100 Ga0068860_100020575 3300005843 Bacteria 6392
101 Ga0068860_100032148 3300005843 Bacteria 5044
102 Ga0068860_100231542 3300005843 Bacteria 1795
103 Ga0068860_100282448 3300005843 Bacteria 1623
104 Ga0068862_100000583 3300005844 Bacteria 37988
105 Ga0068862_100014024 3300005844 Bacteria 6647
106 Ga0081539_10006646 3300005985 Bacteria 10963
107 Ga0075368_10018966 3300006042 Bacteria 2592
108 Ga0075363_100020735 3300006048 Bacteria 3300
109 Ga0075364_10152467 3300006051 Bacteria 1558
110 Ga0070712_100030448 3300006175 Bacteria 3626
111 Ga0075362_10033127 3300006177 Bacteria 2246
112 Ga0075367_10079047 3300006178 Bacteria 1987
113 Ga0075369_10018024 3300006186 Bacteria 2870
114 Ga0075366_10024051 3300006195 Unclassified 3552
115 Ga0097621_100000927 3300006237 Bacteria 20534
116 Ga0097621_100017191 3300006237 Bacteria 5489
117 Ga0097621_100033092 3300006237 Bacteria 4114
118 Ga0097621_100065735 3300006237 Bacteria 2986
119 Ga0068871_100000246 3300006358 Bacteria 37632
120 Ga0068871_100011398 3300006358 Bacteria 6518
121 Ga0068871_100046383 3300006358 Bacteria 3500
122 Ga0068871_100236745 3300006358 Unclassified 1586
123 Ga0075430_100010493 3300006846 Bacteria 7844
124 Ga0075431_100204034 3300006847 Bacteria 2022
125 Ga0068865_100018522 3300006881 Bacteria 4494
126 Ga0068865_100048893 3300006881 Bacteria 2913
127 Ga0097620_100005297 3300006931 Bacteria 13116
128 Ga0097620_100057690 3300006931 Bacteria 3911
129 Ga0097620_100062020 3300006931 Bacteria 3768
130 Ga0097620_100094233 3300006931 Bacteria 3046
131 Ga0097620_100231849 3300006931 Bacteria 1935
132 Ga0105240_10107030 3300009093 Bacteria 3391
133 Ga0105245_10529009 3300009098 Bacteria 1198
134 Ga0105247_10019313 3300009101 Bacteria 4090
135 Ga0114129_10047389 3300009147 Bacteria 6039
136 Ga0105243_10033530 3300009148 Bacteria 3971
137 Ga0105241_10608881 3300009174 Unclassified 988
138 Ga0105242_10000359 3300009176 Bacteria 36471
139 Ga0105248_10005407 3300009177 Bacteria 14042
140 Ga0105248_10007212 3300009177 Bacteria 12195
141 Ga0105249_10003756 3300009553 Bacteria 13103
142 Ga0105249_10066955 3300009553 Bacteria 3308
143 Ga0105249_10171641 3300009553 Bacteria 2103
144 Ga0157374_10041515 3300013296 Bacteria 4240
145 Ga0157374_10045391 3300013296 Bacteria 4067
146 Ga0157378_10160031 3300013297 Bacteria 2105
147 Ga0157378_10232877 3300013297 Bacteria 1756
148 Ga0163162_10041166 3300013306 Bacteria 4622
149 Ga0163162_10056529 3300013306 Bacteria 3952
150 Ga0163162_10084780 3300013306 Bacteria 3245
151 Ga0163162_10221246 3300013306 Bacteria 2023
152 Ga0163162_10360077 3300013306 Bacteria 1588
153 Ga0157375_10005432 3300013308 Bacteria 11079
154 Ga0157375_10107160 3300013308 Bacteria 2888
155 Ga0157375_10157899 3300013308 Bacteria 2408
156 Ga0157375_10288485 3300013308 Bacteria 1804
157 Ga0163163_10004935 3300014325 Bacteria 11478
158 Ga0157380_10192141 3300014326 Bacteria 1803
159 Ga0157379_10000556 3300014968 Bacteria 30113
160 Ga0157379_10021484 3300014968 Bacteria 5714
161 Ga0157376_10005251 3300014969 Bacteria 9045
162 Ga0157376_10079069 3300014969 Bacteria 2818
163 Ga0157376_10082361 3300014969 Bacteria 2765
164 Ga0163161_10016256 3300017792 Bacteria 5193
165 Ga0163161_10035077 3300017792 Bacteria 3589
166 Ga0209025_1000110 3300025294 Bacteria 220002
167 Ga0209050_1002188 3300025298 Bacteria 17631
168 Ga0209051_1018777 3300025303 Bacteria 3045
169 Ga0207697_10006185 3300025315 Bacteria 5456
170 Ga0207656_10030685 3300025321 Bacteria 2222
171 Ga0207710_10028967 3300025900 Bacteria 2406
172 Ga0207680_10147964 3300025903 Bacteria 1563
173 Ga0207645_10000709 3300025907 Bacteria 27766
174 Ga0207645_10003948 3300025907 Bacteria 11071
175 Ga0207645_10009762 3300025907 Bacteria 6623
176 Ga0207643_10006329 3300025908 Bacteria 6339
177 Ga0207693_10039115 3300025915 Bacteria 3735
178 Ga0207660_10001306 3300025917 Bacteria 16642
179 Ga0207662_10000537 3300025918 Bacteria 16818
180 Ga0207681_10003509 3300025923 Bacteria 9767
181 Ga0207681_10085577 3300025923 Bacteria 2238
182 Ga0207650_10034055 3300025925 Bacteria 3692
183 Ga0207650_10139588 3300025925 Bacteria 1904
184 Ga0207650_10165516 3300025925 Bacteria 1755
185 Ga0207659_10004007 3300025926 Bacteria 8886
186 Ga0207659_10010573 3300025926 Bacteria 5804
187 Ga0207687_10071177 3300025927 Bacteria 2484
188 Ga0207644_10003047 3300025931 Bacteria 10774
189 Ga0207706_10077968 3300025933 Bacteria 2914
190 Ga0207686_10003829 3300025934 Bacteria 8067
191 Ga0207709_10116966 3300025935 Bacteria 1793
192 Ga0207669_10007751 3300025937 Bacteria 4995
193 Ga0207669_10129671 3300025937 Bacteria 1730
194 Ga0207704_10001397 3300025938 Bacteria 10790
195 Ga0207704_10007877 3300025938 Bacteria 5059
196 Ga0207704_10031887 3300025938 Bacteria 2975
197 Ga0207704_10087067 3300025938 Bacteria 2039
198 Ga0207704_10109424 3300025938 Bacteria 1864
199 Ga0207691_10000328 3300025940 Bacteria 47302
200 Ga0207691_10000441 3300025940 Bacteria 41237
201 Ga0207691_10018872 3300025940 Bacteria 6531
202 Ga0207691_10030185 3300025940 Bacteria 5067
203 Ga0207691_10098979 3300025940 Bacteria 2604
204 Ga0207691_10190837 3300025940 Bacteria 1787
205 Ga0207711_10014199 3300025941 Bacteria 6615
206 Ga0207689_10000007 3300025942 Bacteria 132362
207 Ga0207689_10000235 3300025942 Bacteria 49336
208 Ga0207689_10007878 3300025942 Bacteria 9306
209 Ga0207667_10096511 3300025949 Bacteria 3051
210 Ga0207651_10014486 3300025960 Bacteria 4556
211 Ga0207651_10026331 3300025960 Bacteria 3630
212 Ga0207651_10283454 3300025960 Bacteria 1370
213 Ga0207712_10011847 3300025961 Bacteria 5559
214 Ga0207668_10007425 3300025972 Bacteria 6516
215 Ga0207668_10105836 3300025972 Bacteria 2100
216 Ga0207668_10112943 3300025972 Bacteria 2042
217 Ga0207668_10218421 3300025972 Bacteria 1529
218 Ga0207668_10300548 3300025972 Bacteria 1324
219 Ga0207658_10003168 3300025986 Bacteria 11745
220 Ga0207658_10011685 3300025986 Bacteria 5978
221 Ga0207658_10018864 3300025986 Bacteria 4770
222 Ga0207658_10140594 3300025986 Bacteria 1953
223 Ga0207658_10229427 3300025986 Bacteria 1566
224 Ga0207677_10018850 3300026023 Bacteria 4152
225 Ga0207677_10027910 3300026023 Bacteria 3563
226 Ga0207677_10194196 3300026023 Bacteria 1608
227 Ga0207703_10000606 3300026035 Bacteria 36379
228 Ga0207703_10001233 3300026035 Bacteria 23948
229 Ga0207703_10031207 3300026035 Bacteria 4212
230 Ga0207703_10037898 3300026035 Bacteria 3843
231 Ga0207703_10330424 3300026035 Unclassified 1398
232 Ga0207639_10024911 3300026041 Bacteria 4335
233 Ga0207639_10053476 3300026041 Bacteria 3081
234 Ga0207639_10288670 3300026041 Bacteria 1446
235 Ga0207678_10006874 3300026067 Bacteria 10090
236 Ga0207708_10000086 3300026075 Bacteria 73314
237 Ga0207641_10009282 3300026088 Bacteria 8112
238 Ga0207641_10012370 3300026088 Bacteria 7001
239 Ga0207641_10090034 3300026088 Bacteria 2682
240 Ga0207648_10000055 3300026089 Bacteria 106101
241 Ga0207648_10001130 3300026089 Bacteria 29970
242 Ga0207648_10001696 3300026089 Bacteria 24102
243 Ga0207648_10007140 3300026089 Bacteria 11016
244 Ga0207648_10023443 3300026089 Bacteria 5528
245 Ga0207648_10051470 3300026089 Bacteria 3600
246 Ga0207648_10109677 3300026089 Bacteria 2423
247 Ga0207676_10006534 3300026095 Bacteria 8242
248 Ga0207676_10024411 3300026095 Bacteria 4473
249 Ga0207676_10037001 3300026095 Bacteria 3716
250 Ga0207674_10004809 3300026116 Bacteria 16173
251 Ga0207675_100000093 3300026118 Bacteria 70343
252 Ga0207675_100017566 3300026118 Bacteria 6675
253 Ga0207675_100057796 3300026118 Bacteria 3619
254 Ga0207675_100109723 3300026118 Bacteria 2603
255 Ga0207675_100447240 3300026118 Bacteria 1280
256 Ga0207683_10000222 3300026121 Bacteria 49960
257 Ga0207683_10003607 3300026121 Bacteria 13487
258 Ga0207683_10004239 3300026121 Bacteria 12379
259 Ga0207683_10018796 3300026121 Bacteria 5896
260 Ga0207683_10132235 3300026121 Bacteria 2245
261 Ga0207698_10008196 3300026142 Bacteria 6590
262 Ga0207698_10225599 3300026142 Bacteria 1697
263 Ga0209813_10004825 3300027866 Bacteria 3239
264 Ga0268266_10026019 3300028379 Bacteria 4977
265 Ga0268266_10029360 3300028379 Bacteria 4675
266 Ga0268266_10074695 3300028379 Bacteria 2944
267 Ga0268266_10148626 3300028379 Bacteria 2109
268 Ga0268265_10009339 3300028380 Bacteria 6628
269 Ga0268265_10040642 3300028380 Bacteria 3436
270 Ga0268264_10000636 3300028381 Bacteria 41794
271 Ga0268264_10007097 3300028381 Bacteria 9388
272 Ga0268264_10014206 3300028381 Bacteria 6548
273 Ga0268264_10088331 3300028381 Bacteria 2668
274 Ga0268264_10194521 3300028381 Bacteria 1851
275 Ga0268264_10242448 3300028381 Bacteria 1670
276 Ga0307511_10000056 3300030521 Bacteria 93598
277 Ga0265330_10000506 3300031235 Bacteria 26093
278 Ga0265332_10000218 3300031238 Bacteria 45835
279 Ga0265325_10042798 3300031241 Bacteria 2365
280 Ga0265329_10002379 3300031242 Bacteria 8550
281 Ga0265331_10001881 3300031250 Bacteria 14809
282 Ga0265327_10002939 3300031251 Bacteria 17041
283 Ga0265316_10006026 3300031344 Bacteria 11651
284 Ga0307408_100003370 3300031548 Bacteria 10964
285 Ga0307408_100111165 3300031548 Bacteria 2105
286 Ga0265342_10013929 3300031712 Bacteria 5363
287 Ga0307405_10151912 3300031731 Bacteria 1629
288 Ga0307413_10004960 3300031824 Bacteria 5868
289 Ga0307413_10028274 3300031824 Bacteria 3120
290 Ga0307410_10006379 3300031852 Bacteria 6362
291 Ga0307410_10015718 3300031852 Bacteria 4496
292 Ga0307406_10009646 3300031901 Bacteria 5425
293 Ga0307407_10007683 3300031903 Bacteria 4896
294 Ga0307407_10273910 3300031903 Bacteria 1166
295 Ga0307412_10002367 3300031911 Bacteria 10462
296 Ga0307409_100036269 3300031995 Bacteria 3623
297 Ga0307409_100184981 3300031995 Bacteria 1848
298 Ga0307416_100019312 3300032002 Bacteria 4828
299 Ga0307416_100076529 3300032002 Bacteria 2805
300 Ga0307414_10018604 3300032004 Bacteria 4283
301 Ga0307411_10001644 3300032005 Bacteria 9326
302 Ga0307411_10237978 3300032005 Bacteria 1423
303 Ga0307415_100127226 3300032126 Bacteria 1922
304 Ga0373960_0036130 3300035121 Bacteria 1406
305 Ga0373935_0013337 3300035692 Bacteria 4958
306 Ga0373927_0019208 3300035695 Bacteria 4482
307 Ga0373927_0048117 3300035695 Bacteria 2758
308 Ga0373937_0004294 3300036401 Bacteria 12079
309 Ga0373937_0019605 3300036401 Bacteria 6054
310 Ga0373937_0056967 3300036401 Bacteria 3589
311 Ga0373925_0143630 3300037068 Bacteria 1869
312 Ga0395898_0061961 3300037466 Bacteria 3634
313 Ga0395905_0166216 3300037471 Bacteria 2073
314 Ga0395905_0211481 3300037471 Bacteria 1817
315 Ga0450896_011590 3300042133 Bacteria 1242
316 Ga0439446_0011797 3300042156 Bacteria 2378
317 Ga0451577_0003177 3300042876 Bacteria 18495
318 Ga0451577_0008633 3300042876 Bacteria 9898
319 Ga0453683_0033861 3300044673 Bacteria 3221
320 Ga0453684_0023570 3300044712 Bacteria 9051
321 Ga0453684_0149916 3300044712 Bacteria 2773
322 Ga0451576_0001433 3300045051 Bacteria 40801
323 Ga0451576_0002743 3300045051 Bacteria 25548
324 Ga0451576_0029923 3300045051 Bacteria 5825
325 Ga0451576_0361542 3300045051 Bacteria 1520
326 Ga0495580_0033469 3300046472 Bacteria 3703
327 Ga0495580_0078273 3300046472 Bacteria 2306
328 Ga0495585_0078529 3300046492 Bacteria 1790
329 Ga0495583_0000068 3300046506 Bacteria 188922
330 Ga0495583_0059888 3300046506 Bacteria 1704
331 Ga0495643_0015147 3300046522 Bacteria 4567
332 Ga0495663_0009450 3300046525 Bacteria 2705
333 Ga0495597_0019950 3300046542 Bacteria 3129
334 Ga0495658_0109430 3300046683 Bacteria 1660
335 Ga0496100_0127524 3300048903 Bacteria 1788
336 Ga0496102_0086252 3300048905 Bacteria 2899
337 Ga0496102_0212356 3300048905 Bacteria 1824
338 Ga0496102_0253018 3300048905 Bacteria 1661
339 Ga0496103_0210547 3300048906 Bacteria 1250
340 Ga0496109_0060546 3300048912 Bacteria 3460
341 Ga0496112_0051270 3300048915 Bacteria 4047
342 Ga0496113_0299898 3300048916 Unclassified 1287
343 Ga0496114_0304632 3300048917 Unclassified 1407
344 Ga0496116_0006666 3300048919 Bacteria 10419
345 Ga0496116_0014392 3300048919 Bacteria 6322
346 Ga0496116_0048950 3300048919 Bacteria 2831
347 Ga0496117_0013959 3300048920 Bacteria 6961
348 Ga0496118_0090566 3300048921 Bacteria 2107
349 Ga0496121_0001111 3300048924 Bacteria 47443
350 Ga0496121_0071809 3300048924 Bacteria 2782
351 Ga0496122_0001794 3300048925 Bacteria 32871
352 Ga0496122_0070850 3300048925 Bacteria 2487
353 Ga0496123_0001811 3300048926 Bacteria 28121
354 Ga0496124_0031587 3300048927 Bacteria 4686
355 Ga0496125_0000168 3300048928 Bacteria 146364
356 Ga0496125_0074847 3300048928 Bacteria 2623
357 Ga0496126_0019229 3300048929 Bacteria 6732
358 Ga0496126_0054364 3300048929 Bacteria 3627
359 Ga0501034_0001629 3300049571 Bacteria 29092
360 nmdc:mga03683_16904_c1 3300050489 Bacteria 2752
361 nmdc:mga03n38_28370_c1 3300050490 Bacteria 2332
362 nmdc:mga00v17_127723_c1 3300050491 Bacteria 1623
363 nmdc:mga00v17_29068_c1 3300050491 Bacteria 3242
364 nmdc:mga04h51_3486_c1 3300050495 Bacteria 3828
365 nmdc:mga07m45_122110_c1 3300050496 Bacteria 1505
366 nmdc:mga06r32_166918_c1 3300050510 Bacteria 2184
367 Ga0495619_0278205 3300053085 Bacteria 1160
368 Ga0500583_0012443 3300053092 Bacteria 3245
369 Ga0590074_009628 3300059423 Bacteria 1610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10077968 Ga0207706_100779681 248
2 3300006237 Ga0097621_100000927 Ga0097621_10000092717 256
3 3300006358 Ga0068871_100000246 Ga0068871_1000002462 256
4 3300009174 Ga0105241_10608881 Ga0105241_106088811 256
5 3300025917 Ga0207660_10001306 Ga0207660_100013062 256
6 3300025942 Ga0207689_10000007 Ga0207689_10000007139 256
7 3300026035 Ga0207703_10000606 Ga0207703_100006062 256
8 3300026075 Ga0207708_10000086 Ga0207708_1000008673 256
9 3300026089 Ga0207648_10000055 Ga0207648_10000055101 256
10 3300031852 Ga0307410_10006379 Ga0307410_100063796 266
11 3300032005 Ga0307411_10237978 Ga0307411_102379782 266
12 3300026121 Ga0207683_10132235 Ga0207683_101322352 271
13 3300037068 Ga0373925_0143630 Ga0373925_0143630_861_1823 273
14 3300028381 Ga0268264_10007097 Ga0268264_1000709710 274
15 3300026118 Ga0207675_100057796 Ga0207675_1000577962 275
16 3300037471 Ga0395905_0211481 Ga0395905_0211481_873_1793 277
17 3300006846 Ga0075430_100010493 Ga0075430_1000104931 280
18 3300006847 Ga0075431_100204034 Ga0075431_1002040342 280
19 3300045051 Ga0451576_0361542 Ga0451576_0361542_14_937 280
20 3300050510 nmdc:mga06r32_166918_c1 nmdc:mga06r32_166918_c1_98_1156 280
21 3300009098 Ga0105245_10529009 Ga0105245_105290091 281
22 3300005548 Ga0070665_100056016 Ga0070665_1000560163 282
23 3300025940 Ga0207691_10098979 Ga0207691_100989792 282
24 3300028379 Ga0268266_10074695 Ga0268266_100746952 282
25 3300005331 Ga0070670_100099174 Ga0070670_1000991742 283
26 3300025925 Ga0207650_10139588 Ga0207650_101395881 283
27 3300035692 Ga0373935_0013337 Ga0373935_0013337_761_1822 285
28 3300035695 Ga0373927_0048117 Ga0373927_0048117_1187_2248 285
29 3300037471 Ga0395905_0166216 Ga0395905_0166216_1059_2018 285
30 3300046542 Ga0495597_0019950 Ga0495597_0019950_11_955 285
31 3300045051 Ga0451576_0002743 Ga0451576_0002743_6561_7544 286
32 3300005338 Ga0068868_100218845 Ga0068868_1002188452 287
33 3300005545 Ga0070695_100209052 Ga0070695_1002090521 287
34 3300005549 Ga0070704_100000159 Ga0070704_10000015922 287
35 3300005614 Ga0068856_100056437 Ga0068856_1000564373 287
36 3300025927 Ga0207687_10071177 Ga0207687_100711772 287
37 3300025938 Ga0207704_10109424 Ga0207704_101094242 287
38 3300026023 Ga0207677_10194196 Ga0207677_101941962 287
39 3300026118 Ga0207675_100000093 Ga0207675_1000000932 287
40 3300028381 Ga0268264_10000636 Ga0268264_1000063629 287
41 3300005330 Ga0070690_100000082 Ga0070690_1000000822 288
42 3300005336 Ga0070680_100000771 Ga0070680_10000077118 288
43 3300005440 Ga0070705_100000030 Ga0070705_10000003029 288
44 3300005444 Ga0070694_100004053 Ga0070694_1000040534 288
45 3300005456 Ga0070678_100269915 Ga0070678_1002699151 288
46 3300005459 Ga0068867_100074843 Ga0068867_1000748431 288
47 3300005544 Ga0070686_100125254 Ga0070686_1001252542 288
48 3300005546 Ga0070696_100000344 Ga0070696_1000003442 288
49 3300005547 Ga0070693_100002446 Ga0070693_1000024462 288
50 3300005617 Ga0068859_100062018 Ga0068859_1000620183 288
51 3300005843 Ga0068860_100282448 Ga0068860_1002824481 288
52 3300005844 Ga0068862_100000583 Ga0068862_10000058331 288
53 3300006175 Ga0070712_100030448 Ga0070712_1000304484 288
54 3300006931 Ga0097620_100062020 Ga0097620_1000620202 288
55 3300009176 Ga0105242_10000359 Ga0105242_100003592 288
56 3300009553 Ga0105249_10003756 Ga0105249_1000375610 288
57 3300014326 Ga0157380_10192141 Ga0157380_101921412 288
58 3300014969 Ga0157376_10005251 Ga0157376_100052518 288
59 3300025915 Ga0207693_10039115 Ga0207693_100391151 288
60 3300025918 Ga0207662_10000537 Ga0207662_1000053714 288
61 3300025934 Ga0207686_10003829 Ga0207686_100038296 288
62 3300025938 Ga0207704_10001397 Ga0207704_100013972 288
63 3300025961 Ga0207712_10011847 Ga0207712_100118476 288
64 3300028380 Ga0268265_10040642 Ga0268265_100406422 288
65 3300028381 Ga0268264_10242448 Ga0268264_102424482 288
66 3300005354 Ga0070675_100100030 Ga0070675_1001000302 289
67 3300005367 Ga0070667_100014325 Ga0070667_1000143256 289
68 3300005841 Ga0068863_100154396 Ga0068863_1001543962 289
69 3300031548 Ga0307408_100111165 Ga0307408_1001111652 289
70 3300048905 Ga0496102_0212356 Ga0496102_0212356_23_988 289
71 3300048906 Ga0496103_0210547 Ga0496103_0210547_248_1228 289
72 3300009553 Ga0105249_10171641 Ga0105249_101716412 294
73 3300013297 Ga0157378_10160031 Ga0157378_101600312 294
74 3300013306 Ga0163162_10056529 Ga0163162_100565292 294
75 3300006195 Ga0075366_10024051 Ga0075366_100240514 296
76 3300031995 Ga0307409_100184981 Ga0307409_1001849812 297
77 3300046472 Ga0495580_0033469 Ga0495580_0033469_35_1135 297
78 3300050496 nmdc:mga07m45_122110_c1 nmdc:mga07m45_122110_c1_77_1135 297
79 3300059423 Ga0590074_009628 Ga0590074_009628_225_1286 297
80 3300005347 Ga0070668_100045494 Ga0070668_1000454942 298
81 3300005467 Ga0070706_100133953 Ga0070706_1001339532 298
82 3300005468 Ga0070707_100191680 Ga0070707_1001916802 298
83 3300035695 Ga0373927_0019208 Ga0373927_0019208_999_2099 298
84 3300006042 Ga0075368_10018966 Ga0075368_100189664 299
85 3300006048 Ga0075363_100020735 Ga0075363_1000207351 299
86 3300006177 Ga0075362_10033127 Ga0075362_100331272 299
87 3300006178 Ga0075367_10079047 Ga0075367_100790471 299
88 3300006186 Ga0075369_10018024 Ga0075369_100180242 299
89 3300027866 Ga0209813_10004825 Ga0209813_100048252 299
90 3300050489 nmdc:mga03683_16904_c1 nmdc:mga03683_16904_c1_1216_2274 299
91 3300050491 nmdc:mga00v17_29068_c1 nmdc:mga00v17_29068_c1_1632_2690 299
92 3300050495 nmdc:mga04h51_3486_c1 nmdc:mga04h51_3486_c1_1200_2258 299
93 3300005471 Ga0070698_100033857 Ga0070698_1000338572 300
94 3300046472 Ga0495580_0078273 Ga0495580_0078273_1016_2116 300
95 3300042876 Ga0451577_0003177 Ga0451577_0003177_12483_13604 302
96 3300005456 Ga0070678_100014666 Ga0070678_1000146662 303
97 3300005518 Ga0070699_100127591 Ga0070699_1001275912 303
98 3300009148 Ga0105243_10033530 Ga0105243_100335302 303
99 3300017792 Ga0163161_10035077 Ga0163161_100350773 303
100 3300025938 Ga0207704_10031887 Ga0207704_100318872 303
101 3300026089 Ga0207648_10023443 Ga0207648_100234435 303
102 3300026121 Ga0207683_10018796 Ga0207683_100187965 303
103 3300006358 Ga0068871_100236745 Ga0068871_1002367452 305
104 3300036401 Ga0373937_0056967 Ga0373937_0056967_314_1378 305
105 3300046683 Ga0495658_0109430 Ga0495658_0109430_362_1429 305
106 iso_pu_bacteria 2857537821 2857538185 305
107 3300005367 Ga0070667_100107500 Ga0070667_1001075001 306
108 3300005843 Ga0068860_100231542 Ga0068860_1002315422 306
109 3300025986 Ga0207658_10229427 Ga0207658_102294272 306
110 3300028381 Ga0268264_10194521 Ga0268264_101945212 306
111 3300026035 Ga0207703_10330424 Ga0207703_103304242 307
112 iso_pu_bacteria 2643221594 2643980127 309
113 iso_pu_bacteria 2808606395 2809033328 309
114 3300048917 Ga0496114_0304632 Ga0496114_0304632_21_1103 310
115 3300050490 nmdc:mga03n38_28370_c1 nmdc:mga03n38_28370_c1_965_2020 310
116 3300028381 Ga0268264_10088331 Ga0268264_100883313 311
117 3300025940 Ga0207691_10190837 Ga0207691_101908372 312
118 3300026088 Ga0207641_10090034 Ga0207641_100900343 312
119 3300026142 Ga0207698_10225599 Ga0207698_102255992 312
120 3300053085 Ga0495619_0278205 Ga0495619_0278205_76_1131 312
121 iso_pu_bacteria 2643221569 2643861824 313
122 iso_pu_bacteria 2643221621 2644123413 313
123 iso_pu_bacteria 2858950400 2858951997 313
124 3300005985 Ga0081539_10006646 Ga0081539_100066462 314
125 3300025298 Ga0209050_1002188 Ga0209050_100218812 314
126 3300025303 Ga0209051_1018777 Ga0209051_10187772 314
127 3300026035 Ga0207703_10031207 Ga0207703_100312071 314
128 3300048915 Ga0496112_0051270 Ga0496112_0051270_2436_3494 314
129 3300048916 Ga0496113_0299898 Ga0496113_0299898_210_1268 314
130 iso_pu_bacteria 8002392321 8002395804 314
131 3300025972 Ga0207668_10112943 Ga0207668_101129432 315
132 3300005328 Ga0070676_10008812 Ga0070676_100088124 316
133 3300005331 Ga0070670_100010680 Ga0070670_1000106801 316
134 3300005334 Ga0068869_100000267 Ga0068869_10000026723 316
135 3300005335 Ga0070666_10052552 Ga0070666_100525522 316
136 3300005338 Ga0068868_100109632 Ga0068868_1001096322 316
137 3300005347 Ga0070668_100002967 Ga0070668_1000029679 316
138 3300005364 Ga0070673_100009498 Ga0070673_1000094981 316
139 3300005367 Ga0070667_100001389 Ga0070667_1000013898 316
140 3300005440 Ga0070705_100030253 Ga0070705_1000302533 316
141 3300005459 Ga0068867_100001367 Ga0068867_1000013679 316
142 3300005543 Ga0070672_100058119 Ga0070672_1000581192 316
143 3300005563 Ga0068855_100136356 Ga0068855_1001363562 316
144 3300005577 Ga0068857_100005520 Ga0068857_1000055205 316
145 3300005617 Ga0068859_100005297 Ga0068859_1000052974 316
146 3300005618 Ga0068864_100000567 Ga0068864_1000005674 316
147 3300005719 Ga0068861_100009628 Ga0068861_1000096283 316
148 3300005841 Ga0068863_100001637 Ga0068863_1000016374 316
149 3300005842 Ga0068858_100005417 Ga0068858_1000054175 316
150 3300005843 Ga0068860_100015997 Ga0068860_1000159975 316
151 3300005844 Ga0068862_100014024 Ga0068862_1000140247 316
152 3300006931 Ga0097620_100005297 Ga0097620_1000052974 316
153 3300009101 Ga0105247_10019313 Ga0105247_100193132 316
154 3300009177 Ga0105248_10005407 Ga0105248_100054076 316
155 3300013297 Ga0157378_10232877 Ga0157378_102328772 316
156 3300013306 Ga0163162_10084780 Ga0163162_100847802 316
157 3300013308 Ga0157375_10107160 Ga0157375_101071602 316
158 3300014325 Ga0163163_10004935 Ga0163163_100049355 316
159 3300014968 Ga0157379_10000556 Ga0157379_100005563 316
160 3300025900 Ga0207710_10028967 Ga0207710_100289672 316
161 3300025903 Ga0207680_10147964 Ga0207680_101479642 316
162 3300025907 Ga0207645_10009762 Ga0207645_100097623 316
163 3300025925 Ga0207650_10034055 Ga0207650_100340553 316
164 3300025935 Ga0207709_10116966 Ga0207709_101169662 316
165 3300025940 Ga0207691_10030185 Ga0207691_100301854 316
166 3300025941 Ga0207711_10014199 Ga0207711_100141993 316
167 3300025942 Ga0207689_10000235 Ga0207689_1000023517 316
168 3300025949 Ga0207667_10096511 Ga0207667_100965112 316
169 3300025960 Ga0207651_10283454 Ga0207651_102834541 316
170 3300025972 Ga0207668_10300548 Ga0207668_103005482 316
171 3300025986 Ga0207658_10018864 Ga0207658_100188641 316
172 3300026035 Ga0207703_10001233 Ga0207703_1000123313 316
173 3300026089 Ga0207648_10007140 Ga0207648_100071409 316
174 3300026095 Ga0207676_10006534 Ga0207676_100065344 316
175 3300026116 Ga0207674_10004809 Ga0207674_1000480910 316
176 3300026118 Ga0207675_100017566 Ga0207675_1000175663 316
177 3300028380 Ga0268265_10009339 Ga0268265_100093397 316
178 3300048912 Ga0496109_0060546 Ga0496109_0060546_604_1650 316
179 3300005445 Ga0070708_100000702 Ga0070708_1000007023 317
180 3300031911 Ga0307412_10002367 Ga0307412_100023677 317
181 3300037466 Ga0395898_0061961 Ga0395898_0061961_1301_2356 317
182 3300044712 Ga0453684_0023570 Ga0453684_0023570_1897_2961 317
183 3300046492 Ga0495585_0078529 Ga0495585_0078529_560_1663 317
184 3300046506 Ga0495583_0000068 Ga0495583_0000068_145262_146302 317
185 3300046522 Ga0495643_0015147 Ga0495643_0015147_2834_3874 317
186 3300046525 Ga0495663_0009450 Ga0495663_0009450_584_1624 317
187 3300048919 Ga0496116_0006666 Ga0496116_0006666_6360_7394 317
188 3300048929 Ga0496126_0019229 Ga0496126_0019229_5299_6333 317
189 iso_pu_bacteria 2904479285 2904483699 317
190 3300006051 Ga0075364_10152467 Ga0075364_101524672 318
191 3300031995 Ga0307409_100036269 Ga0307409_1000362693 318
192 3300050491 nmdc:mga00v17_127723_c1 nmdc:mga00v17_127723_c1_216_1340 318
193 3300005330 Ga0070690_100087997 Ga0070690_1000879972 319
194 3300005334 Ga0068869_100273267 Ga0068869_1002732672 319
195 3300005354 Ga0070675_100053012 Ga0070675_1000530122 319
196 3300005459 Ga0068867_100013617 Ga0068867_1000136171 319
197 3300005617 Ga0068859_100057691 Ga0068859_1000576913 319
198 3300006931 Ga0097620_100057690 Ga0097620_1000576902 319
199 3300036401 Ga0373937_0019605 Ga0373937_0019605_957_2003 319
200 3300042133 Ga0450896_011590 Ga0450896_011590_59_1123 319
201 3300042156 Ga0439446_0011797 Ga0439446_0011797_67_1131 319
202 3300048919 Ga0496116_0048950 Ga0496116_0048950_1222_2286 319
203 3300048920 Ga0496117_0013959 Ga0496117_0013959_1486_2544 319
204 3300048921 Ga0496118_0090566 Ga0496118_0090566_196_1254 319
205 3300048924 Ga0496121_0001111 Ga0496121_0001111_25304_26368 319
206 3300048924 Ga0496121_0071809 Ga0496121_0071809_1258_2322 319
207 3300048925 Ga0496122_0001794 Ga0496122_0001794_24980_26044 319
208 3300048925 Ga0496122_0070850 Ga0496122_0070850_950_2014 319
209 3300048926 Ga0496123_0001811 Ga0496123_0001811_6809_7873 319
210 3300048927 Ga0496124_0031587 Ga0496124_0031587_1523_2587 319
211 3300048928 Ga0496125_0000168 Ga0496125_0000168_25307_26371 319
212 3300048928 Ga0496125_0074847 Ga0496125_0074847_177_1241 319
213 3300048929 Ga0496126_0054364 Ga0496126_0054364_1294_2358 319
214 iso_pu_bacteria 2513237165 2514044357 319
215 iso_pu_bacteria 2599185292 2599902988 319
216 iso_pu_bacteria 2901300506 2901303366 319
217 iso_pu_bacteria 2941479691 2941482423 319
218 iso_pu_bacteria 644736347 644749501 319
219 3300009147 Ga0114129_10047389 Ga0114129_100473893 320
220 3300005293 Ga0065715_10159110 Ga0065715_101591102 321
221 3300005327 Ga0070658_10047651 Ga0070658_100476512 321
222 3300005331 Ga0070670_100028388 Ga0070670_1000283882 321
223 3300005334 Ga0068869_100061251 Ga0068869_1000612512 321
224 3300005335 Ga0070666_10004321 Ga0070666_100043213 321
225 3300005335 Ga0070666_10053869 Ga0070666_100538692 321
226 3300005338 Ga0068868_100069404 Ga0068868_1000694042 321
227 3300005347 Ga0070668_100004242 Ga0070668_1000042427 321
228 3300005347 Ga0070668_100010606 Ga0070668_1000106063 321
229 3300005353 Ga0070669_100013145 Ga0070669_1000131453 321
230 3300005354 Ga0070675_100002591 Ga0070675_1000025914 321
231 3300005354 Ga0070675_100186265 Ga0070675_1001862652 321
232 3300005355 Ga0070671_100013678 Ga0070671_1000136784 321
233 3300005355 Ga0070671_100013907 Ga0070671_1000139076 321
234 3300005356 Ga0070674_100000372 Ga0070674_10000037217 321
235 3300005356 Ga0070674_100012275 Ga0070674_1000122753 321
236 3300005356 Ga0070674_100020026 Ga0070674_1000200262 321
237 3300005364 Ga0070673_100000878 Ga0070673_1000008789 321
238 3300005364 Ga0070673_100027816 Ga0070673_1000278163 321
239 3300005455 Ga0070663_100096832 Ga0070663_1000968322 321
240 3300005456 Ga0070678_100000157 Ga0070678_10000015715 321
241 3300005456 Ga0070678_100003653 Ga0070678_1000036533 321
242 3300005456 Ga0070678_100137514 Ga0070678_1001375142 321
243 3300005457 Ga0070662_100189926 Ga0070662_1001899262 321
244 3300005459 Ga0068867_100001231 Ga0068867_1000012314 321
245 3300005459 Ga0068867_100038149 Ga0068867_1000381492 321
246 3300005459 Ga0068867_100063553 Ga0068867_1000635532 321
247 3300005539 Ga0068853_100004908 Ga0068853_1000049089 321
248 3300005539 Ga0068853_100187172 Ga0068853_1001871722 321
249 3300005543 Ga0070672_100011382 Ga0070672_1000113823 321
250 3300005543 Ga0070672_100019165 Ga0070672_1000191653 321
251 3300005543 Ga0070672_100242456 Ga0070672_1002424562 321
252 3300005548 Ga0070665_100007095 Ga0070665_10000709512 321
253 3300005548 Ga0070665_100027406 Ga0070665_1000274062 321
254 3300005548 Ga0070665_100167325 Ga0070665_1001673252 321
255 3300005578 Ga0068854_100027815 Ga0068854_1000278152 321
256 3300005616 Ga0068852_100001558 Ga0068852_10000155812 321
257 3300005617 Ga0068859_100094231 Ga0068859_1000942312 321
258 3300005617 Ga0068859_100231843 Ga0068859_1002318432 321
259 3300005618 Ga0068864_100060175 Ga0068864_1000601752 321
260 3300005618 Ga0068864_100088141 Ga0068864_1000881413 321
261 3300005719 Ga0068861_100154249 Ga0068861_1001542492 321
262 3300005834 Ga0068851_10001185 Ga0068851_100011854 321
263 3300005840 Ga0068870_10002513 Ga0068870_100025134 321
264 3300005841 Ga0068863_100009606 Ga0068863_1000096062 321
265 3300005841 Ga0068863_100047146 Ga0068863_1000471462 321
266 3300005842 Ga0068858_100028067 Ga0068858_1000280672 321
267 3300005842 Ga0068858_100073107 Ga0068858_1000731073 321
268 3300005843 Ga0068860_100020575 Ga0068860_1000205754 321
269 3300005843 Ga0068860_100032148 Ga0068860_1000321482 321
270 3300006237 Ga0097621_100017191 Ga0097621_1000171912 321
271 3300006237 Ga0097621_100033092 Ga0097621_1000330923 321
272 3300006237 Ga0097621_100065735 Ga0097621_1000657352 321
273 3300006358 Ga0068871_100011398 Ga0068871_1000113982 321
274 3300006358 Ga0068871_100046383 Ga0068871_1000463833 321
275 3300006881 Ga0068865_100018522 Ga0068865_1000185222 321
276 3300006881 Ga0068865_100048893 Ga0068865_1000488932 321
277 3300006931 Ga0097620_100094233 Ga0097620_1000942333 321
278 3300006931 Ga0097620_100231849 Ga0097620_1002318492 321
279 3300009093 Ga0105240_10107030 Ga0105240_101070302 321
280 3300009177 Ga0105248_10007212 Ga0105248_100072127 321
281 3300009553 Ga0105249_10066955 Ga0105249_100669552 321
282 3300013296 Ga0157374_10041515 Ga0157374_100415153 321
283 3300013296 Ga0157374_10045391 Ga0157374_100453913 321
284 3300013306 Ga0163162_10041166 Ga0163162_100411663 321
285 3300013306 Ga0163162_10221246 Ga0163162_102212462 321
286 3300013306 Ga0163162_10360077 Ga0163162_103600772 321
287 3300013308 Ga0157375_10005432 Ga0157375_100054328 321
288 3300013308 Ga0157375_10157899 Ga0157375_101578992 321
289 3300013308 Ga0157375_10288485 Ga0157375_102884852 321
290 3300014968 Ga0157379_10021484 Ga0157379_100214843 321
291 3300014969 Ga0157376_10079069 Ga0157376_100790693 321
292 3300014969 Ga0157376_10082361 Ga0157376_100823612 321
293 3300017792 Ga0163161_10016256 Ga0163161_100162563 321
294 3300025294 Ga0209025_1000110 Ga0209025_1000110146 321
295 3300025315 Ga0207697_10006185 Ga0207697_100061854 321
296 3300025321 Ga0207656_10030685 Ga0207656_100306852 321
297 3300025907 Ga0207645_10000709 Ga0207645_1000070913 321
298 3300025907 Ga0207645_10003948 Ga0207645_100039483 321
299 3300025908 Ga0207643_10006329 Ga0207643_100063294 321
300 3300025923 Ga0207681_10003509 Ga0207681_100035094 321
301 3300025923 Ga0207681_10085577 Ga0207681_100855772 321
302 3300025925 Ga0207650_10165516 Ga0207650_101655162 321
303 3300025926 Ga0207659_10004007 Ga0207659_100040073 321
304 3300025926 Ga0207659_10010573 Ga0207659_100105734 321
305 3300025931 Ga0207644_10003047 Ga0207644_100030473 321
306 3300025937 Ga0207669_10007751 Ga0207669_100077512 321
307 3300025937 Ga0207669_10129671 Ga0207669_101296712 321
308 3300025938 Ga0207704_10007877 Ga0207704_100078773 321
309 3300025938 Ga0207704_10087067 Ga0207704_100870672 321
310 3300025940 Ga0207691_10000328 Ga0207691_100003283 321
311 3300025940 Ga0207691_10000441 Ga0207691_100004413 321
312 3300025940 Ga0207691_10018872 Ga0207691_100188722 321
313 3300025942 Ga0207689_10007878 Ga0207689_100078785 321
314 3300025960 Ga0207651_10014486 Ga0207651_100144862 321
315 3300025960 Ga0207651_10026331 Ga0207651_100263312 321
316 3300025972 Ga0207668_10007425 Ga0207668_100074252 321
317 3300025972 Ga0207668_10105836 Ga0207668_101058362 321
318 3300025972 Ga0207668_10218421 Ga0207668_102184212 321
319 3300025986 Ga0207658_10003168 Ga0207658_100031684 321
320 3300025986 Ga0207658_10011685 Ga0207658_100116853 321
321 3300025986 Ga0207658_10140594 Ga0207658_101405942 321
322 3300026023 Ga0207677_10018850 Ga0207677_100188503 321
323 3300026023 Ga0207677_10027910 Ga0207677_100279102 321
324 3300026035 Ga0207703_10037898 Ga0207703_100378983 321
325 3300026041 Ga0207639_10024911 Ga0207639_100249113 321
326 3300026041 Ga0207639_10053476 Ga0207639_100534762 321
327 3300026041 Ga0207639_10288670 Ga0207639_102886702 321
328 3300026067 Ga0207678_10006874 Ga0207678_100068745 321
329 3300026088 Ga0207641_10009282 Ga0207641_100092824 321
330 3300026088 Ga0207641_10012370 Ga0207641_100123701 321
331 3300026089 Ga0207648_10001130 Ga0207648_1000113018 321
332 3300026089 Ga0207648_10001696 Ga0207648_1000169617 321
333 3300026089 Ga0207648_10051470 Ga0207648_100514703 321
334 3300026089 Ga0207648_10109677 Ga0207648_101096772 321
335 3300026095 Ga0207676_10024411 Ga0207676_100244113 321
336 3300026095 Ga0207676_10037001 Ga0207676_100370013 321
337 3300026118 Ga0207675_100109723 Ga0207675_1001097232 321
338 3300026118 Ga0207675_100447240 Ga0207675_1004472402 321
339 3300026121 Ga0207683_10000222 Ga0207683_100002229 321
340 3300026121 Ga0207683_10003607 Ga0207683_1000360710 321
341 3300026121 Ga0207683_10004239 Ga0207683_100042393 321
342 3300026142 Ga0207698_10008196 Ga0207698_100081962 321
343 3300028379 Ga0268266_10026019 Ga0268266_100260192 321
344 3300028379 Ga0268266_10029360 Ga0268266_100293603 321
345 3300028379 Ga0268266_10148626 Ga0268266_101486262 321
346 3300028381 Ga0268264_10014206 Ga0268264_100142062 321
347 3300030521 Ga0307511_10000056 Ga0307511_1000005631 321
348 3300031235 Ga0265330_10000506 Ga0265330_100005065 321
349 3300031238 Ga0265332_10000218 Ga0265332_100002187 321
350 3300031241 Ga0265325_10042798 Ga0265325_100427982 321
351 3300031242 Ga0265329_10002379 Ga0265329_100023793 321
352 3300031250 Ga0265331_10001881 Ga0265331_100018816 321
353 3300031251 Ga0265327_10002939 Ga0265327_1000293910 321
354 3300031344 Ga0265316_10006026 Ga0265316_100060264 321
355 3300031548 Ga0307408_100003370 Ga0307408_1000033705 321
356 3300031712 Ga0265342_10013929 Ga0265342_100139293 321
357 3300031731 Ga0307405_10151912 Ga0307405_101519122 321
358 3300031824 Ga0307413_10004960 Ga0307413_100049604 321
359 3300031824 Ga0307413_10028274 Ga0307413_100282743 321
360 3300031852 Ga0307410_10015718 Ga0307410_100157182 321
361 3300031901 Ga0307406_10009646 Ga0307406_100096463 321
362 3300031903 Ga0307407_10007683 Ga0307407_100076834 321
363 3300031903 Ga0307407_10273910 Ga0307407_102739101 321
364 3300032002 Ga0307416_100019312 Ga0307416_1000193124 321
365 3300032002 Ga0307416_100076529 Ga0307416_1000765292 321
366 3300032004 Ga0307414_10018604 Ga0307414_100186042 321
367 3300032005 Ga0307411_10001644 Ga0307411_100016445 321
368 3300032126 Ga0307415_100127226 Ga0307415_1001272262 321
369 3300035121 Ga0373960_0036130 Ga0373960_0036130_331_1383 321
370 3300036401 Ga0373937_0004294 Ga0373937_0004294_2047_3117 321
371 3300042876 Ga0451577_0008633 Ga0451577_0008633_5633_6775 321
372 3300044673 Ga0453683_0033861 Ga0453683_0033861_955_2028 321
373 3300044712 Ga0453684_0149916 Ga0453684_0149916_202_1344 321
374 3300045051 Ga0451576_0001433 Ga0451576_0001433_26930_28072 321
375 3300045051 Ga0451576_0029923 Ga0451576_0029923_1138_2211 321
376 3300046506 Ga0495583_0059888 Ga0495583_0059888_373_1449 321
377 3300048903 Ga0496100_0127524 Ga0496100_0127524_567_1646 321
378 3300048905 Ga0496102_0086252 Ga0496102_0086252_1213_2289 321
379 3300048905 Ga0496102_0253018 Ga0496102_0253018_370_1428 321
380 3300048919 Ga0496116_0014392 Ga0496116_0014392_4876_5934 321
381 3300049571 Ga0501034_0001629 Ga0501034_0001629_27378_28436 321
382 3300053092 Ga0500583_0012443 Ga0500583_0012443_548_1633 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05145

AbrB

Transition state regulatory protein AbrB

63

365

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xat-assembly1.cif.gz_A structural insights into the elevator-like mechanism of the sodium/citrate symporter cits 0.6022 6 316
5a1s-assembly1.cif.gz_C crystal structure of the sodium-dependent citrate symporter secits form salmonella enterica. 0.5989 6 316
5xat-assembly2.cif.gz_B structural insights into the elevator-like mechanism of the sodium/citrate symporter cits 0.5976 6 316
5xat-assembly2.cif.gz_C structural insights into the elevator-like mechanism of the sodium/citrate symporter cits 0.5887 6 316
5xat-assembly1.cif.gz_A structural insights into the elevator-like mechanism of the sodium/citrate symporter cits 0.5859 6 316
ID Description Score Start End Superfamily
af_Q2FXR6_31_348_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8771 33 317 1.20.1530.20
af_Q2FXR6_31_348_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7896 33 317 1.20.1530.20
af_B2RYK8_113_519_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.5335 5 318 1.20.1530.20
af_B2RYK8_113_519_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.5225 5 318 1.20.1530.20
af_G5EFS0_68_469_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.5146 5 318 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A536T6N6-F1-model_v4 AbrB family transcriptional regulator 0.9569 4 317 GO:0010468
GO:0016020
AF-A0A4Q7NIR1-F1-model_v4 Ammonia monooxygenase 0.9568 6 318 GO:0010468
GO:0016020
AF-A0A7G9T9V8-F1-model_v4 AbrB family transcriptional regulator 0.9508 15 316 GO:0010468
GO:0016020
AF-C5TBJ2-F1-model_v4 Membrane protein AbrB duplication 0.9496 1 317 GO:0010468
GO:0016020
AF-A0A4Q5PTT5-F1-model_v4 AbrB family transcriptional regulator 0.9493 4 318 GO:0010468
GO:0016020

Feature Viewer

pLDDT pTM Quality
83.37 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map