F429375

General Info

Members Datasets Scaffolds Average Seq Length
382 143 764 461

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000459|Ga0495650_0000459_33355_34788
Length 477
Sequence MRFPDFLQSSSRSRRAGSALRAPAWLAALAMLCVVVSCKSLPEVDAAAPVKATPTIETTRGTLPVKQASALASKRWTNASADLKALAAAEEQATGVPLIAGNRVSLLFDGPATMREMMAAARAATSNINLETYIFDQDEIGMQFADLLIEKQHAGVQVNVMVDAVGALATPAAFFERMRAAGIRVVVFNPVNPAKAKGKWEVNNRDHRKLMVVDGRIAFTGGINISSTYANSSLFRSKSKARANVDGSKVGWRDTHIKIEGPAVAPLQYSFVNLWVAQEGGELAKADYFPPLAPVGDKILRVLATGPDGDFEIYKSLLVAIGESKKAIHITSAYFVPDQQIVDALVAAAKRGVDVKLVLPGVSDHSMIRYAGQAFYDQLLAGGVKIFELQIAVLHAKTAVIDSAWSTIGSSNIDRRSFIHNYELNVVVVDPAFGRDMESAFAEDLRDCKEVTLEQWRHRPWGDRIREWGANLAGYWI

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
10 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
11 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
12 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
13 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
14 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
15 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
16 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
17 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
18 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
27 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
28 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
29 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
30 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
31 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
32 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
33 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
34 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
35 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
36 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
37 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
38 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
39 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
40 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
41 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
42 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
43 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
44 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
45 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
46 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
47 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
48 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
49 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
50 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
51 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
52 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
53 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
54 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
55 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
56 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
57 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
58 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
59 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
60 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
61 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
62 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
65 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
66 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
67 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
68 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
69 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
70 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
71 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
72 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
73 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
74 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
75 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
76 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
77 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
78 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
79 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
80 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
85 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
86 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
87 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
88 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
91 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
92 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
93 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
96 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
97 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
102 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
105 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
106 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
107 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
108 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
131 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
135 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
136 2643221556 Massilia sp. Root1485 Isolate Unclassified
137 2643221684 Massilia sp. Root133 Isolate Unclassified
138 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
139 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
140 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
141 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
142 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
143 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 4.97
Rhizosphere 89.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0000459 3300046471 Bacteria 63575
2 rootL2_10191349 3300003322 Bacteria 2217
3 Ga0055525_1000029 3300003759 Bacteria 320663
4 Ga0065165_1000924 3300005262 Bacteria 37694
5 Ga0070660_100028511 3300005339 Bacteria 4178
6 Ga0070660_100116802 3300005339 Bacteria 2127
7 Ga0070659_100005993 3300005366 Bacteria 8763
8 Ga0070659_100060309 3300005366 Bacteria 2996
9 Ga0070662_100160974 3300005457 Bacteria 1756
10 Ga0068855_100034797 3300005563 Bacteria 6004
11 Ga0105244_10085749 3300009036 Bacteria 1554
12 Ga0105243_10066595 3300009148 Bacteria 2897
13 Ga0105242_10037078 3300009176 Bacteria 3915
14 Ga0157371_10000013 3300013102 Bacteria 352631
15 Ga0182008_10005088 3300014497 Bacteria 7552
16 Ga0182008_10052774 3300014497 Bacteria 2014
17 Ga0182006_1000053 3300015261 Bacteria 180648
18 Ga0182006_1016890 3300015261 Bacteria 3110
19 Ga0182007_10000055 3300015262 Bacteria 91532
20 Ga0182005_1000031 3300015265 Bacteria 202902
21 Ga0163161_10028149 3300017792 Bacteria 3989
22 Ga0209563_100003 3300025230 Bacteria 1932942
23 Ga0207705_10005475 3300025909 Bacteria 9494
24 Ga0207654_10002614 3300025911 Bacteria 9136
25 Ga0207657_10006693 3300025919 Bacteria 11912
26 Ga0207690_10006464 3300025932 Bacteria 6947
27 Ga0207706_10107442 3300025933 Bacteria 2456
28 Ga0207709_10046475 3300025935 Bacteria 2635
29 Ga0207667_10058183 3300025949 Bacteria 4056
30 Ga0207667_10080732 3300025949 Bacteria 3369
31 Ga0316177_1199761 3300030731 Bacteria 5389
32 Ga0316180_1110843 3300030736 Bacteria 2476
33 Ga0395899_0000298 3300037312 Bacteria 63982
34 Ga0395899_0007391 3300037312 Bacteria 8492
35 Ga0395899_0015813 3300037312 Bacteria 5753
36 Ga0395899_0024231 3300037312 Bacteria 4590
37 Ga0395900_0000561 3300037418 Bacteria 51758
38 Ga0395900_0000566 3300037418 Bacteria 51197
39 Ga0395900_0018866 3300037418 Bacteria 7034
40 Ga0395900_0043334 3300037418 Bacteria 4638
41 Ga0395900_0079084 3300037418 Bacteria 3378
42 Ga0395900_0085400 3300037418 Bacteria 3243
43 Ga0395900_0156601 3300037418 Bacteria 2326
44 Ga0395898_0116904 3300037466 Bacteria 2555
45 Ga0395898_0169105 3300037466 Bacteria 2089
46 Ga0395905_0027236 3300037471 Bacteria 5390
47 Ga0395905_0041831 3300037471 Bacteria 4300
48 Ga0395905_0056606 3300037471 Bacteria 3667
49 Ga0395905_0073847 3300037471 Bacteria 3196
50 Ga0395901_0000314 3300038443 Bacteria 59738
51 Ga0395901_0010376 3300038443 Bacteria 9433
52 Ga0395901_0037613 3300038443 Bacteria 5005
53 Ga0439448_0014038 3300042005 Bacteria 2413
54 Ga0439455_0000883 3300042012 Bacteria 4622
55 Ga0466965_0036874 3300044683 Bacteria 2399
56 Ga0466966_0065643 3300044684 Bacteria 2281
57 Ga0466966_0101661 3300044684 Bacteria 1777
58 Ga0466964_0000306 3300044706 Bacteria 14504
59 Ga0466964_0002503 3300044706 Bacteria 6533
60 Ga0466971_0027065 3300044719 Bacteria 2567
61 Ga0466968_0000804 3300044735 Bacteria 10926
62 Ga0466957_0002309 3300044842 Bacteria 10215
63 Ga0466959_0062788 3300045049 Bacteria 2699
64 Ga0466959_0066238 3300045049 Bacteria 2620
65 Ga0466958_0040409 3300045836 Bacteria 2803
66 Ga0495617_000030 3300046452 Bacteria 152392
67 Ga0495627_000317 3300046453 Bacteria 47238
68 Ga0495627_028297 3300046453 Bacteria 1791
69 Ga0495627_029703 3300046453 Bacteria 1737
70 Ga0495603_0011757 3300046455 Bacteria 5297
71 Ga0495590_0000027 3300046457 Bacteria 158323
72 Ga0495590_0000660 3300046457 Bacteria 15965
73 Ga0495591_000722 3300046458 Bacteria 23980
74 Ga0495629_0011700 3300046459 Bacteria 6367
75 Ga0495638_0057184 3300046460 Bacteria 2420
76 Ga0495638_0064124 3300046460 Bacteria 2264
77 Ga0495653_0054368 3300046463 Bacteria 3059
78 Ga0495653_0058611 3300046463 Bacteria 2926
79 Ga0495650_0000011 3300046471 Bacteria 615329
80 Ga0495650_0004873 3300046471 Bacteria 8978
81 Ga0495650_0007914 3300046471 Bacteria 6303
82 Ga0495580_0012524 3300046472 Bacteria 6502
83 Ga0495582_0005335 3300046473 Bacteria 7177
84 Ga0495582_0060314 3300046473 Bacteria 2093
85 Ga0495605_0000029 3300046474 Bacteria 215329
86 Ga0495605_0000046 3300046474 Bacteria 175985
87 Ga0495605_0009422 3300046474 Bacteria 5485
88 Ga0495605_0011015 3300046474 Bacteria 5051
89 Ga0495605_0014685 3300046474 Bacteria 4281
90 Ga0495605_0033952 3300046474 Bacteria 2586
91 Ga0495605_0037160 3300046474 Bacteria 2451
92 Ga0495605_0064113 3300046474 Bacteria 1751
93 Ga0495584_0000003 3300046491 Bacteria 323768
94 Ga0495584_0000126 3300046491 Bacteria 52557
95 Ga0495584_0000127 3300046491 Bacteria 52530
96 Ga0495584_0000973 3300046491 Bacteria 17970
97 Ga0495584_0003546 3300046491 Bacteria 8542
98 Ga0495584_0003820 3300046491 Bacteria 8184
99 Ga0495584_0019105 3300046491 Bacteria 3479
100 Ga0495584_0037276 3300046491 Bacteria 2456
101 Ga0495584_0047243 3300046491 Bacteria 2170
102 Ga0495584_0062428 3300046491 Bacteria 1873
103 Ga0495585_0000010 3300046492 Bacteria 229958
104 Ga0495585_0000133 3300046492 Bacteria 80839
105 Ga0495585_0000610 3300046492 Bacteria 33395
106 Ga0495585_0000849 3300046492 Bacteria 26293
107 Ga0495585_0001491 3300046492 Bacteria 18285
108 Ga0495585_0001827 3300046492 Bacteria 16110
109 Ga0495585_0007722 3300046492 Bacteria 6556
110 Ga0495585_0014466 3300046492 Bacteria 4596
111 Ga0495585_0039167 3300046492 Bacteria 2665
112 Ga0495594_0007467 3300046499 Bacteria 5625
113 Ga0495594_0025836 3300046499 Bacteria 3157
114 Ga0495596_0000170 3300046500 Bacteria 45044
115 Ga0495596_0000672 3300046500 Bacteria 21261
116 Ga0495596_0000905 3300046500 Bacteria 17766
117 Ga0495596_0002902 3300046500 Bacteria 8917
118 Ga0495596_0003307 3300046500 Bacteria 8212
119 Ga0495596_0004011 3300046500 Bacteria 7265
120 Ga0495596_0005904 3300046500 Bacteria 5714
121 Ga0495596_0011174 3300046500 Bacteria 3882
122 Ga0495607_0000532 3300046501 Bacteria 37423
123 Ga0495607_0001454 3300046501 Bacteria 21090
124 Ga0495607_0001491 3300046501 Bacteria 20779
125 Ga0495607_0002379 3300046501 Bacteria 15351
126 Ga0495607_0007505 3300046501 Bacteria 7532
127 Ga0495607_0017718 3300046501 Bacteria 4561
128 Ga0495607_0064345 3300046501 Bacteria 2072
129 Ga0495583_0000157 3300046506 Bacteria 113758
130 Ga0495583_0000176 3300046506 Bacteria 108802
131 Ga0495583_0000462 3300046506 Bacteria 60161
132 Ga0495583_0000580 3300046506 Bacteria 50178
133 Ga0495583_0002437 3300046506 Bacteria 15913
134 Ga0495583_0039325 3300046506 Bacteria 2229
135 Ga0495583_0051733 3300046506 Bacteria 1871
136 Ga0495606_0000084 3300046507 Bacteria 158428
137 Ga0495606_0012848 3300046507 Bacteria 6672
138 Ga0495606_0027773 3300046507 Bacteria 4005
139 Ga0495606_0087190 3300046507 Bacteria 1927
140 Ga0495606_0093412 3300046507 Bacteria 1845
141 Ga0495606_0121496 3300046507 Bacteria 1563
142 Ga0495610_0000214 3300046512 Bacteria 62772
143 Ga0495616_0000139 3300046513 Bacteria 63327
144 Ga0495616_0003984 3300046513 Bacteria 9400
145 Ga0495616_0006037 3300046513 Bacteria 7380
146 Ga0495616_0010312 3300046513 Bacteria 5414
147 Ga0495616_0016753 3300046513 Bacteria 4049
148 Ga0495616_0022398 3300046513 Bacteria 3412
149 Ga0495616_0032687 3300046513 Bacteria 2715
150 Ga0495616_0069274 3300046513 Bacteria 1711
151 Ga0495630_0022344 3300046517 Bacteria 4671
152 Ga0495631_0000008 3300046518 Bacteria 121368
153 Ga0495631_0000454 3300046518 Bacteria 27870
154 Ga0495631_0002913 3300046518 Bacteria 9485
155 Ga0495631_0004766 3300046518 Bacteria 7159
156 Ga0495631_0009649 3300046518 Bacteria 4812
157 Ga0495631_0011351 3300046518 Bacteria 4383
158 Ga0495631_0012915 3300046518 Bacteria 4066
159 Ga0495631_0031331 3300046518 Bacteria 2406
160 Ga0495632_0000140 3300046519 Bacteria 74068
161 Ga0495632_0000256 3300046519 Bacteria 52860
162 Ga0495632_0000398 3300046519 Bacteria 40867
163 Ga0495632_0001984 3300046519 Bacteria 16247
164 Ga0495632_0035430 3300046519 Bacteria 2546
165 Ga0495637_0000012 3300046520 Bacteria 273124
166 Ga0495637_0024101 3300046520 Bacteria 2754
167 Ga0495637_0031928 3300046520 Bacteria 2325
168 Ga0495643_0000863 3300046522 Bacteria 32477
169 Ga0495643_0000939 3300046522 Bacteria 30169
170 Ga0495643_0001791 3300046522 Bacteria 18381
171 Ga0495643_0008289 3300046522 Bacteria 6595
172 Ga0495644_0008357 3300046523 Bacteria 3988
173 Ga0495644_0053239 3300046523 Bacteria 1520
174 Ga0495648_0000003 3300046524 Bacteria 386817
175 Ga0495648_0000309 3300046524 Bacteria 54245
176 Ga0495648_0000853 3300046524 Bacteria 32161
177 Ga0495648_0015630 3300046524 Bacteria 5501
178 Ga0495648_0022455 3300046524 Bacteria 4343
179 Ga0495648_0025084 3300046524 Bacteria 4044
180 Ga0495648_0031200 3300046524 Bacteria 3512
181 Ga0495666_0006343 3300046526 Bacteria 5952
182 Ga0495642_0000013 3300046528 Bacteria 123896
183 Ga0495642_0000070 3300046528 Bacteria 61042
184 Ga0495642_0000161 3300046528 Bacteria 38994
185 Ga0495642_0007241 3300046528 Bacteria 4258
186 Ga0495642_0043820 3300046528 Bacteria 1825
187 Ga0495652_0003611 3300046529 Bacteria 15164
188 Ga0495654_0007515 3300046530 Bacteria 6084
189 Ga0495654_0017579 3300046530 Bacteria 3755
190 Ga0495665_0016828 3300046531 Bacteria 3936
191 Ga0495609_0000105 3300046538 Bacteria 98586
192 Ga0495609_0002698 3300046538 Bacteria 10715
193 Ga0495609_0003399 3300046538 Bacteria 9138
194 Ga0495609_0005084 3300046538 Bacteria 7010
195 Ga0495597_0000113 3300046542 Bacteria 72390
196 Ga0495597_0000307 3300046542 Bacteria 43960
197 Ga0495597_0005903 3300046542 Bacteria 6395
198 Ga0495597_0007144 3300046542 Bacteria 5708
199 Ga0495597_0007222 3300046542 Bacteria 5660
200 Ga0495597_0010694 3300046542 Bacteria 4474
201 Ga0495597_0010974 3300046542 Bacteria 4404
202 Ga0495597_0016627 3300046542 Bacteria 3472
203 Ga0495622_0008009 3300046557 Bacteria 4897
204 Ga0495622_0033145 3300046557 Bacteria 2411
205 Ga0495622_0069176 3300046557 Bacteria 1630
206 Ga0495633_0000332 3300046558 Bacteria 53300
207 Ga0495633_0002112 3300046558 Bacteria 14272
208 Ga0495633_0002376 3300046558 Bacteria 13328
209 Ga0495633_0006177 3300046558 Bacteria 7157
210 Ga0495633_0009907 3300046558 Bacteria 5233
211 Ga0495633_0029564 3300046558 Bacteria 2665
212 Ga0495656_0007843 3300046615 Bacteria 3792
213 Ga0495656_0014610 3300046615 Bacteria 2946
214 Ga0495668_0000607 3300046616 Bacteria 43408
215 Ga0495668_0000855 3300046616 Bacteria 34381
216 Ga0495668_0004080 3300046616 Bacteria 10588
217 Ga0495668_0006088 3300046616 Bacteria 7988
218 Ga0495668_0008973 3300046616 Bacteria 6174
219 Ga0495668_0045488 3300046616 Bacteria 2440
220 Ga0495668_0070097 3300046616 Bacteria 1927
221 Ga0495634_0017197 3300046642 Bacteria 5164
222 Ga0495611_0003630 3300046648 Bacteria 6758
223 Ga0495611_0004275 3300046648 Bacteria 6208
224 Ga0495611_0013687 3300046648 Bacteria 3457
225 Ga0495625_0004536 3300046660 Bacteria 13088
226 Ga0495625_0010068 3300046660 Bacteria 7859
227 Ga0495635_0022637 3300046663 Bacteria 4379
228 Ga0495635_0143023 3300046663 Bacteria 1629
229 Ga0495661_0000081 3300046665 Bacteria 116927
230 Ga0495661_0000248 3300046665 Bacteria 62330
231 Ga0495661_0000495 3300046665 Bacteria 40972
232 Ga0495661_0001485 3300046665 Bacteria 19558
233 Ga0495661_0002806 3300046665 Bacteria 13190
234 Ga0495661_0023510 3300046665 Bacteria 4000
235 Ga0495661_0039591 3300046665 Bacteria 2928
236 Ga0495661_0071529 3300046665 Bacteria 2026
237 Ga0495661_0087284 3300046665 Bacteria 1784
238 Ga0495588_0000086 3300046674 Bacteria 193241
239 Ga0495588_0013072 3300046674 Bacteria 3945
240 Ga0495588_0019493 3300046674 Bacteria 3322
241 Ga0495623_0006315 3300046679 Bacteria 7705
242 Ga0495623_0009660 3300046679 Bacteria 6263
243 Ga0495669_0000025 3300046684 Bacteria 112395
244 Ga0495669_0002375 3300046684 Bacteria 7723
245 Ga0495669_0003135 3300046684 Bacteria 6805
246 Ga0495669_0003494 3300046684 Bacteria 6479
247 Ga0495669_0005474 3300046684 Bacteria 5300
248 Ga0495613_0022616 3300046689 Bacteria 4683
249 Ga0495670_0003242 3300046691 Bacteria 8011
250 Ga0495670_0009764 3300046691 Bacteria 4717
251 Ga0495670_0011070 3300046691 Bacteria 4436
252 Ga0495670_0049804 3300046691 Bacteria 2096
253 Ga0495671_0000869 3300046692 Bacteria 21668
254 Ga0495671_0018799 3300046692 Bacteria 3661
255 Ga0495671_0021971 3300046692 Bacteria 3346
256 Ga0495649_0000066 3300046694 Bacteria 93487
257 Ga0495649_0008484 3300046694 Bacteria 6177
258 Ga0495589_0000135 3300046794 Bacteria 67821
259 Ga0495589_0000157 3300046794 Bacteria 62544
260 Ga0495589_0000170 3300046794 Bacteria 59283
261 Ga0495589_0001377 3300046794 Bacteria 14146
262 Ga0495589_0010005 3300046794 Bacteria 4928
263 Ga0495589_0016830 3300046794 Bacteria 3754
264 Ga0495600_0001628 3300046809 Bacteria 12512
265 Ga0495660_0000127 3300046810 Bacteria 84034
266 Ga0495660_0000646 3300046810 Bacteria 27076
267 Ga0495604_0029998 3300047317 Bacteria 4324
268 Ga0495604_0100266 3300047317 Bacteria 2129
269 Ga0495636_0010064 3300047318 Bacteria 3730
270 Ga0495674_0004869 3300047319 Bacteria 12909
271 Ga0495672_0000138 3300047320 Bacteria 108026
272 Ga0495672_0000147 3300047320 Bacteria 102295
273 Ga0495672_0000475 3300047320 Bacteria 47536
274 Ga0495672_0004442 3300047320 Bacteria 11485
275 Ga0495672_0037973 3300047320 Bacteria 2942
276 Ga0495676_0000140 3300047321 Bacteria 55144
277 Ga0495683_0000046 3300047323 Bacteria 129843
278 Ga0495683_0003138 3300047323 Bacteria 9674
279 Ga0495683_0017444 3300047323 Bacteria 3721
280 Ga0495683_0019238 3300047323 Bacteria 3525
281 Ga0495683_0033803 3300047323 Bacteria 2600
282 Ga0495683_0050211 3300047323 Bacteria 2088
283 Ga0495687_000033 3300047443 Bacteria 263788
284 Ga0495687_000102 3300047443 Bacteria 129228
285 Ga0495687_000184 3300047443 Bacteria 91103
286 Ga0495687_000349 3300047443 Bacteria 59074
287 Ga0495687_000797 3300047443 Bacteria 33934
288 Ga0495675_0014457 3300047444 Bacteria 4987
289 Ga0495675_0029758 3300047444 Bacteria 3483
290 Ga0495675_0061147 3300047444 Bacteria 2386
291 Ga0495677_0000002 3300047445 Bacteria 346767
292 Ga0495677_0000115 3300047445 Bacteria 39026
293 Ga0495677_0000889 3300047445 Bacteria 12053
294 Ga0495677_0002904 3300047445 Bacteria 6669
295 Ga0495677_0017733 3300047445 Bacteria 2579
296 Ga0495679_003840 3300047446 Bacteria 7112
297 Ga0495685_001514 3300047447 Bacteria 7120
298 Ga0495673_0014204 3300047469 Bacteria 4147
299 Ga0495681_0000100 3300047470 Bacteria 75759
300 Ga0495681_0000391 3300047470 Bacteria 34074
301 Ga0495681_0001620 3300047470 Bacteria 16733
302 Ga0495681_0009406 3300047470 Bacteria 6026
303 Ga0495681_0011783 3300047470 Bacteria 5177
304 Ga0495681_0023204 3300047470 Bacteria 3301
305 Ga0495686_0000362 3300047472 Bacteria 73476
306 Ga0495686_0000681 3300047472 Bacteria 45971
307 Ga0495686_0041026 3300047472 Bacteria 2948
308 Ga0495686_0079864 3300047472 Bacteria 2000
309 Ga0495593_0010710 3300047673 Bacteria 5286
310 Ga0495602_0009728 3300048088 Bacteria 9988
311 Ga0495602_0038729 3300048088 Bacteria 4402
312 Ga0495614_0006919 3300048089 Bacteria 5071
313 Ga0495626_0000014 3300048091 Bacteria 246660
314 Ga0495626_0000028 3300048091 Bacteria 204580
315 Ga0495626_0001245 3300048091 Bacteria 20900
316 Ga0495626_0003149 3300048091 Bacteria 10780
317 Ga0495626_0004600 3300048091 Bacteria 8409
318 Ga0495626_0004847 3300048091 Bacteria 8101
319 Ga0495626_0005921 3300048091 Bacteria 7041
320 Ga0495626_0008759 3300048091 Bacteria 5508
321 Ga0495626_0011333 3300048091 Bacteria 4721
322 Ga0495626_0020818 3300048091 Bacteria 3263
323 Ga0495626_0021290 3300048091 Bacteria 3218
324 Ga0495626_0023292 3300048091 Bacteria 3051
325 Ga0495626_0024787 3300048091 Bacteria 2937
326 Ga0495626_0027731 3300048091 Bacteria 2751
327 Ga0495626_0054730 3300048091 Bacteria 1831
328 Ga0496102_0000140 3300048905 Bacteria 98196
329 Ga0496102_0000406 3300048905 Bacteria 50075
330 Ga0496102_0006015 3300048905 Bacteria 10333
331 Ga0496102_0321335 3300048905 Bacteria 1458
332 Ga0496103_0008037 3300048906 Bacteria 6265
333 Ga0496103_0009106 3300048906 Bacteria 5880
334 Ga0496103_0053070 3300048906 Bacteria 2512
335 Ga0496106_0001144 3300048909 Bacteria 19669
336 Ga0496106_0121177 3300048909 Bacteria 2045
337 Ga0496109_0003323 3300048912 Bacteria 13448
338 Ga0496110_0000027 3300048913 Bacteria 71164
339 Ga0496111_0002081 3300048914 Bacteria 11929
340 Ga0496111_0135776 3300048914 Bacteria 1822
341 Ga0496112_0072062 3300048915 Bacteria 3415
342 Ga0496113_0009733 3300048916 Bacteria 6317
343 Ga0496113_0009847 3300048916 Bacteria 6293
344 Ga0496115_0026536 3300048918 Bacteria 4522
345 Ga0496115_0094145 3300048918 Bacteria 2451
346 Ga0496117_0000032 3300048920 Bacteria 375533
347 Ga0496118_0000027 3300048921 Bacteria 375533
348 Ga0496121_0005148 3300048924 Bacteria 16995
349 Ga0496121_0008098 3300048924 Bacteria 12502
350 Ga0496121_0142006 3300048924 Bacteria 1780
351 Ga0496122_0000674 3300048925 Bacteria 68775
352 Ga0496122_0001905 3300048925 Bacteria 31538
353 Ga0496122_0014534 3300048925 Bacteria 7601
354 Ga0496123_0000492 3300048926 Bacteria 68380
355 Ga0496123_0003183 3300048926 Bacteria 18738
356 Ga0496123_0019721 3300048926 Bacteria 5305
357 Ga0496124_0020681 3300048927 Bacteria 6073
358 Ga0496125_0000657 3300048928 Bacteria 57617
359 Ga0496125_0031115 3300048928 Bacteria 4762
360 Ga0495678_000075 3300049459 Bacteria 125154
361 Ga0495678_000107 3300049459 Bacteria 100130
362 Ga0495678_000184 3300049459 Bacteria 72485
363 Ga0495678_000700 3300049459 Bacteria 30512
364 Ga0495678_000702 3300049459 Bacteria 30428
365 Ga0495678_002328 3300049459 Bacteria 13084
366 Ga0495678_042151 3300049459 Bacteria 1821
367 Ga0495682_0000674 3300049460 Bacteria 22513
368 Ga0495682_0010087 3300049460 Bacteria 3667
369 Ga0495682_0011416 3300049460 Bacteria 3417
370 Ga0495682_0012143 3300049460 Bacteria 3307
371 Ga0501036_0046469 3300049572 Bacteria 3677
372 Ga0501035_0002473 3300049822 Bacteria 18050
373 Ga0466962_0059620 3300061719 Bacteria 1822
374 2601671747 2600255292 Bacteria 6300551
375 2643802585 2643221556 Bacteria 7251154
376 2644472090 2643221684 Bacteria 7145183
377 2809142555 2808606418 Bacteria 6724496
378 2857552049 2857547612 Bacteria 6179999
379 2885083877 2885080285 Bacteria 6355622
380 2932413871 2932410948 Bacteria 6312192
381 2932417931 2932416698 Bacteria 6315112
382 8047674856 8047673197 Bacteria 7395230
383 Ga0495650_0000459
384 rootL2_10191349
385 Ga0055525_1000029
386 Ga0065165_1000924
387 Ga0070660_100028511
388 Ga0070660_100116802
389 Ga0070659_100005993
390 Ga0070659_100060309
391 Ga0070662_100160974
392 Ga0068855_100034797
393 Ga0105244_10085749
394 Ga0105243_10066595
395 Ga0105242_10037078
396 Ga0157371_10000013
397 Ga0182008_10005088
398 Ga0182008_10052774
399 Ga0182006_1000053
400 Ga0182006_1016890
401 Ga0182007_10000055
402 Ga0182005_1000031
403 Ga0163161_10028149
404 Ga0209563_100003
405 Ga0207705_10005475
406 Ga0207654_10002614
407 Ga0207657_10006693
408 Ga0207690_10006464
409 Ga0207706_10107442
410 Ga0207709_10046475
411 Ga0207667_10058183
412 Ga0207667_10080732
413 Ga0316177_1199761
414 Ga0316180_1110843
415 Ga0395899_0000298
416 Ga0395899_0007391
417 Ga0395899_0015813
418 Ga0395899_0024231
419 Ga0395900_0000561
420 Ga0395900_0000566
421 Ga0395900_0018866
422 Ga0395900_0043334
423 Ga0395900_0079084
424 Ga0395900_0085400
425 Ga0395900_0156601
426 Ga0395898_0116904
427 Ga0395898_0169105
428 Ga0395905_0027236
429 Ga0395905_0041831
430 Ga0395905_0056606
431 Ga0395905_0073847
432 Ga0395901_0000314
433 Ga0395901_0010376
434 Ga0395901_0037613
435 Ga0439448_0014038
436 Ga0439455_0000883
437 Ga0466965_0036874
438 Ga0466966_0065643
439 Ga0466966_0101661
440 Ga0466964_0000306
441 Ga0466964_0002503
442 Ga0466971_0027065
443 Ga0466968_0000804
444 Ga0466957_0002309
445 Ga0466959_0062788
446 Ga0466959_0066238
447 Ga0466958_0040409
448 Ga0495617_000030
449 Ga0495627_000317
450 Ga0495627_028297
451 Ga0495627_029703
452 Ga0495603_0011757
453 Ga0495590_0000027
454 Ga0495590_0000660
455 Ga0495591_000722
456 Ga0495629_0011700
457 Ga0495638_0057184
458 Ga0495638_0064124
459 Ga0495653_0054368
460 Ga0495653_0058611
461 Ga0495650_0000011
462 Ga0495650_0004873
463 Ga0495650_0007914
464 Ga0495580_0012524
465 Ga0495582_0005335
466 Ga0495582_0060314
467 Ga0495605_0000029
468 Ga0495605_0000046
469 Ga0495605_0009422
470 Ga0495605_0011015
471 Ga0495605_0014685
472 Ga0495605_0033952
473 Ga0495605_0037160
474 Ga0495605_0064113
475 Ga0495584_0000003
476 Ga0495584_0000126
477 Ga0495584_0000127
478 Ga0495584_0000973
479 Ga0495584_0003546
480 Ga0495584_0003820
481 Ga0495584_0019105
482 Ga0495584_0037276
483 Ga0495584_0047243
484 Ga0495584_0062428
485 Ga0495585_0000010
486 Ga0495585_0000133
487 Ga0495585_0000610
488 Ga0495585_0000849
489 Ga0495585_0001491
490 Ga0495585_0001827
491 Ga0495585_0007722
492 Ga0495585_0014466
493 Ga0495585_0039167
494 Ga0495594_0007467
495 Ga0495594_0025836
496 Ga0495596_0000170
497 Ga0495596_0000672
498 Ga0495596_0000905
499 Ga0495596_0002902
500 Ga0495596_0003307
501 Ga0495596_0004011
502 Ga0495596_0005904
503 Ga0495596_0011174
504 Ga0495607_0000532
505 Ga0495607_0001454
506 Ga0495607_0001491
507 Ga0495607_0002379
508 Ga0495607_0007505
509 Ga0495607_0017718
510 Ga0495607_0064345
511 Ga0495583_0000157
512 Ga0495583_0000176
513 Ga0495583_0000462
514 Ga0495583_0000580
515 Ga0495583_0002437
516 Ga0495583_0039325
517 Ga0495583_0051733
518 Ga0495606_0000084
519 Ga0495606_0012848
520 Ga0495606_0027773
521 Ga0495606_0087190
522 Ga0495606_0093412
523 Ga0495606_0121496
524 Ga0495610_0000214
525 Ga0495616_0000139
526 Ga0495616_0003984
527 Ga0495616_0006037
528 Ga0495616_0010312
529 Ga0495616_0016753
530 Ga0495616_0022398
531 Ga0495616_0032687
532 Ga0495616_0069274
533 Ga0495630_0022344
534 Ga0495631_0000008
535 Ga0495631_0000454
536 Ga0495631_0002913
537 Ga0495631_0004766
538 Ga0495631_0009649
539 Ga0495631_0011351
540 Ga0495631_0012915
541 Ga0495631_0031331
542 Ga0495632_0000140
543 Ga0495632_0000256
544 Ga0495632_0000398
545 Ga0495632_0001984
546 Ga0495632_0035430
547 Ga0495637_0000012
548 Ga0495637_0024101
549 Ga0495637_0031928
550 Ga0495643_0000863
551 Ga0495643_0000939
552 Ga0495643_0001791
553 Ga0495643_0008289
554 Ga0495644_0008357
555 Ga0495644_0053239
556 Ga0495648_0000003
557 Ga0495648_0000309
558 Ga0495648_0000853
559 Ga0495648_0015630
560 Ga0495648_0022455
561 Ga0495648_0025084
562 Ga0495648_0031200
563 Ga0495666_0006343
564 Ga0495642_0000013
565 Ga0495642_0000070
566 Ga0495642_0000161
567 Ga0495642_0007241
568 Ga0495642_0043820
569 Ga0495652_0003611
570 Ga0495654_0007515
571 Ga0495654_0017579
572 Ga0495665_0016828
573 Ga0495609_0000105
574 Ga0495609_0002698
575 Ga0495609_0003399
576 Ga0495609_0005084
577 Ga0495597_0000113
578 Ga0495597_0000307
579 Ga0495597_0005903
580 Ga0495597_0007144
581 Ga0495597_0007222
582 Ga0495597_0010694
583 Ga0495597_0010974
584 Ga0495597_0016627
585 Ga0495622_0008009
586 Ga0495622_0033145
587 Ga0495622_0069176
588 Ga0495633_0000332
589 Ga0495633_0002112
590 Ga0495633_0002376
591 Ga0495633_0006177
592 Ga0495633_0009907
593 Ga0495633_0029564
594 Ga0495656_0007843
595 Ga0495656_0014610
596 Ga0495668_0000607
597 Ga0495668_0000855
598 Ga0495668_0004080
599 Ga0495668_0006088
600 Ga0495668_0008973
601 Ga0495668_0045488
602 Ga0495668_0070097
603 Ga0495634_0017197
604 Ga0495611_0003630
605 Ga0495611_0004275
606 Ga0495611_0013687
607 Ga0495625_0004536
608 Ga0495625_0010068
609 Ga0495635_0022637
610 Ga0495635_0143023
611 Ga0495661_0000081
612 Ga0495661_0000248
613 Ga0495661_0000495
614 Ga0495661_0001485
615 Ga0495661_0002806
616 Ga0495661_0023510
617 Ga0495661_0039591
618 Ga0495661_0071529
619 Ga0495661_0087284
620 Ga0495588_0000086
621 Ga0495588_0013072
622 Ga0495588_0019493
623 Ga0495623_0006315
624 Ga0495623_0009660
625 Ga0495669_0000025
626 Ga0495669_0002375
627 Ga0495669_0003135
628 Ga0495669_0003494
629 Ga0495669_0005474
630 Ga0495613_0022616
631 Ga0495670_0003242
632 Ga0495670_0009764
633 Ga0495670_0011070
634 Ga0495670_0049804
635 Ga0495671_0000869
636 Ga0495671_0018799
637 Ga0495671_0021971
638 Ga0495649_0000066
639 Ga0495649_0008484
640 Ga0495589_0000135
641 Ga0495589_0000157
642 Ga0495589_0000170
643 Ga0495589_0001377
644 Ga0495589_0010005
645 Ga0495589_0016830
646 Ga0495600_0001628
647 Ga0495660_0000127
648 Ga0495660_0000646
649 Ga0495604_0029998
650 Ga0495604_0100266
651 Ga0495636_0010064
652 Ga0495674_0004869
653 Ga0495672_0000138
654 Ga0495672_0000147
655 Ga0495672_0000475
656 Ga0495672_0004442
657 Ga0495672_0037973
658 Ga0495676_0000140
659 Ga0495683_0000046
660 Ga0495683_0003138
661 Ga0495683_0017444
662 Ga0495683_0019238
663 Ga0495683_0033803
664 Ga0495683_0050211
665 Ga0495687_000033
666 Ga0495687_000102
667 Ga0495687_000184
668 Ga0495687_000349
669 Ga0495687_000797
670 Ga0495675_0014457
671 Ga0495675_0029758
672 Ga0495675_0061147
673 Ga0495677_0000002
674 Ga0495677_0000115
675 Ga0495677_0000889
676 Ga0495677_0002904
677 Ga0495677_0017733
678 Ga0495679_003840
679 Ga0495685_001514
680 Ga0495673_0014204
681 Ga0495681_0000100
682 Ga0495681_0000391
683 Ga0495681_0001620
684 Ga0495681_0009406
685 Ga0495681_0011783
686 Ga0495681_0023204
687 Ga0495686_0000362
688 Ga0495686_0000681
689 Ga0495686_0041026
690 Ga0495686_0079864
691 Ga0495593_0010710
692 Ga0495602_0009728
693 Ga0495602_0038729
694 Ga0495614_0006919
695 Ga0495626_0000014
696 Ga0495626_0000028
697 Ga0495626_0001245
698 Ga0495626_0003149
699 Ga0495626_0004600
700 Ga0495626_0004847
701 Ga0495626_0005921
702 Ga0495626_0008759
703 Ga0495626_0011333
704 Ga0495626_0020818
705 Ga0495626_0021290
706 Ga0495626_0023292
707 Ga0495626_0024787
708 Ga0495626_0027731
709 Ga0495626_0054730
710 Ga0496102_0000140
711 Ga0496102_0000406
712 Ga0496102_0006015
713 Ga0496102_0321335
714 Ga0496103_0008037
715 Ga0496103_0009106
716 Ga0496103_0053070
717 Ga0496106_0001144
718 Ga0496106_0121177
719 Ga0496109_0003323
720 Ga0496110_0000027
721 Ga0496111_0002081
722 Ga0496111_0135776
723 Ga0496112_0072062
724 Ga0496113_0009733
725 Ga0496113_0009847
726 Ga0496115_0026536
727 Ga0496115_0094145
728 Ga0496117_0000032
729 Ga0496118_0000027
730 Ga0496121_0005148
731 Ga0496121_0008098
732 Ga0496121_0142006
733 Ga0496122_0000674
734 Ga0496122_0001905
735 Ga0496122_0014534
736 Ga0496123_0000492
737 Ga0496123_0003183
738 Ga0496123_0019721
739 Ga0496124_0020681
740 Ga0496125_0000657
741 Ga0496125_0031115
742 Ga0495678_000075
743 Ga0495678_000107
744 Ga0495678_000184
745 Ga0495678_000700
746 Ga0495678_000702
747 Ga0495678_002328
748 Ga0495678_042151
749 Ga0495682_0000674
750 Ga0495682_0010087
751 Ga0495682_0011416
752 Ga0495682_0012143
753 Ga0501036_0046469
754 Ga0501035_0002473
755 Ga0466962_0059620
756 2601671747
757 2643802585
758 2644472090
759 2809142555
760 2857552049
761 2885083877
762 2932413871
763 2932417931
764 8047674856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13091

PLDc_2

PLD-like domain

317

445

0.95

PF00614

PLDc

Phospholipase D Active site motif

202

229

0.91

PF13091

PLDc_2

PLD-like domain

117

234

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1byr-assembly1.cif.gz_A crystal structure of a phospholipase d family member, nuc from salmonella typhimurium 0.7812 93 269
1byr-assembly1.cif.gz_A crystal structure of a phospholipase d family member, nuc from salmonella typhimurium 0.7537 93 269
6ohq-assembly1.cif.gz_A structure of compound 4 bound human phospholipase d2 catalytic domain 0.7391 82 392
6ohq-assembly2.cif.gz_B structure of compound 4 bound human phospholipase d2 catalytic domain 0.739 84 392
6ohr-assembly2.cif.gz_B structure of compound 5 bound human phospholipase d1 catalytic domain 0.7366 85 392
ID Description Score Start End Superfamily
af_P0A6H8_316_458_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9817 303 398 3.30.870.10
af_P0AA84_201_339_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.969 299 398 3.30.870.10
af_Q54P99_397_594_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9598 300 398 3.30.870.10
af_Q2FWG8_323_468_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9476 303 392 3.30.870.10
af_Q4CVT1_429_588_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9433 296 398 3.30.870.10
ID Description Score Start End GO Terms
AF-A0A3D3EYT0-F1-model_v4 Cardiolipin synthase 0.9823 302 392 GO:0030572
GO:0032049
AF-A0A7X8KCA8-F1-model_v4 Cardiolipin synthase 0.9796 312 392 GO:0030572
GO:0032049
AF-H0I2S4-F1-model_v4 Phospholipase D (Choline phosphatase) 0.9785 308 391 GO:0005576
GO:0008808
GO:0016020
GO:0032049
AF-A0A4V1UNN8-F1-model_v4 Cardiolipin synthase 0.9778 308 398 GO:0008808
GO:0016020
GO:0032049
AF-A0A2N1UYR8-F1-model_v4 PLD phosphodiesterase domain-containing protein 0.9762 303 398 GO:0005524
GO:0016887
GO:0030572
GO:0032049

Map