F429409

General Info

Members Datasets Scaffolds Average Seq Length
382 280 764 334

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0006093|Ga0496118_0006093_9882_11030
Length 382
Sequence MVIILPGVGAHRLALKAERRSTYTDHCSDYPGRRSETDSVSAAQEKAMSTETMKAVRFHEFGGPQVLRYEDVPKPHLKPGEVLVRVHAVGVNPPDWYLRDGYTTVPNFKPPVTLPVIPGSDVSGVVEAVAPDVQGFSVGDEVFGMVRFPSFGDSAAYAEYVAAPASDLALKPAGIDHVQAAAAPMAGLTAWQFLIDLGHDEPNPFQGQPHQPAPLAGRTVLINGAAGGVGHFAVQLAKWKGARVIAVASGAHEAFLRGLGADAFIDYTLTPPEDVVSDIDLVLDTAGGSTTGRFLRTIRRGGALFPVFLGFSDAEEAAERGVTVSMTQVRSSGAQLADLARPLDAGTVRVAIDSTFPLAEAGRAHERAARGHIQGKIVLTVG

Samples

Sample ID Description Type Environment
1 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
100 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
101 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
210 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
211 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
212 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
214 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
215 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
216 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
217 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
220 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
223 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
224 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
225 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
226 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
227 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
228 2619618881 Frankia sp. ACN1ag Isolate Unclassified
229 2619619003 Frankia sp. CpI1-P Isolate Nodule
230 2643221609 Acidovorax sp. Root217 Isolate Unclassified
231 2643221611 Acidovorax sp. Root219 Isolate Unclassified
232 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
233 2643221647 Streptomyces sp. Root369 Isolate Unclassified
234 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
235 2643221732 Bacillus sp. Root239 Isolate Unclassified
236 2738541278 Niastella sp. CF465 Isolate Unclassified
237 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
238 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
239 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
240 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
241 2854911287 Brucella lupini LUP21 Isolate Unclassified
242 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
243 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
244 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
245 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
246 2862574272 Streptomyces sp. AcE210 Isolate Nodule
247 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
248 2867428634 Streptomyces sp. RP5T Isolate Unclassified
249 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
250 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
251 2891562705 Microbispora tritici MT50 Isolate Unclassified
252 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
253 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
254 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
255 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
256 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
257 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
258 2929004312 Priestia megaterium 1104 Isolate Unclassified
259 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
260 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
261 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
262 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
263 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
264 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
265 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
266 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
267 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
268 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
269 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
270 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
271 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
272 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
273 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
274 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
275 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
276 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
277 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
278 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
279 8054920844 Frankia tisae Agncl-8 Isolate Nodule
280 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.08
Metatranscriptomes 0
Isolates 14.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.97
Nodule 1.57
Rhizoplane 3.93
Rhizosphere 58.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496118_0006093 3300048921 Bacteria 13404
2 JGI24737J22298_10032508 3300001990 Bacteria 1624
3 JGI25152J39213_1000831 3300002773 Bacteria 15321
4 JGI25153J46596_10001274 3300003215 Bacteria 15140
5 rootH1_10154899 3300003316 Bacteria 1800
6 rootH2_10263809 3300003320 Bacteria 2192
7 rootL2_10029221 3300003322 Bacteria 12469
8 rootL2_10055409 3300003322 Bacteria 4563
9 rootH1_10005689 3300003323 Bacteria 9971
10 rootH1_10022076 3300003323 Bacteria 2065
11 rootH1_10034663 3300003323 Bacteria 4736
12 Ga0055526_1000659 3300003771 Bacteria 26512
13 Ga0055526_1003216 3300003771 Bacteria 10535
14 Ga0055524_1000618 3300003775 Bacteria 25511
15 Ga0055528_1000602 3300003790 Bacteria 26995
16 Ga0065165_1000006 3300005262 Bacteria 352298
17 Ga0065165_1001673 3300005262 Bacteria 22420
18 Ga0065165_1004517 3300005262 Bacteria 8536
19 Ga0070683_100170708 3300005329 Bacteria 2064
20 Ga0070668_100221985 3300005347 Bacteria 1559
21 Ga0070667_100000142 3300005367 Bacteria 90696
22 Ga0070699_100238779 3300005518 Bacteria 1621
23 Ga0068855_100167723 3300005563 Bacteria 2488
24 Ga0068855_100214220 3300005563 Bacteria 2163
25 Ga0068859_100002793 3300005617 Bacteria 17685
26 Ga0068861_100000109 3300005719 Bacteria 41453
27 Ga0068863_100000105 3300005841 Bacteria 90388
28 Ga0068858_100173754 3300005842 Bacteria 2033
29 Ga0068860_100000209 3300005843 Bacteria 92811
30 Ga0068862_100000211 3300005844 Bacteria 65382
31 Ga0068862_100195882 3300005844 Bacteria 1820
32 Ga0075365_10041274 3300006038 Bacteria 3013
33 Ga0075368_10000298 3300006042 Bacteria 14314
34 Ga0075364_10039168 3300006051 Bacteria 3072
35 Ga0075367_10000140 3300006178 Bacteria 21897
36 Ga0075367_10000255 3300006178 Bacteria 18154
37 Ga0075366_10038469 3300006195 Bacteria 2825
38 Ga0075370_10005538 3300006353 Bacteria 6292
39 Ga0075370_10025139 3300006353 Bacteria 3292
40 Ga0075428_100010750 3300006844 Bacteria 10174
41 Ga0075428_100069814 3300006844 Bacteria 3841
42 Ga0075430_100014876 3300006846 Bacteria 6626
43 Ga0075429_100015425 3300006880 Bacteria 6620
44 Ga0097620_100002793 3300006931 Bacteria 17685
45 Ga0105244_10028800 3300009036 Bacteria 2976
46 Ga0105247_10000141 3300009101 Bacteria 70210
47 Ga0114129_10029180 3300009147 Bacteria 7814
48 Ga0114129_10050047 3300009147 Bacteria 5870
49 Ga0105248_10000242 3300009177 Bacteria 63110
50 Ga0105248_10017160 3300009177 Bacteria 7974
51 Ga0105249_10000031 3300009553 Bacteria 220006
52 Ga0157374_10575725 3300013296 Bacteria 1135
53 Ga0163163_10109970 3300014325 Bacteria 2784
54 Ga0157379_10105052 3300014968 Bacteria 2535
55 Ga0163161_10260202 3300017792 Bacteria 1355
56 Ga0213875_10014757 3300021388 Bacteria 3809
57 Ga0209258_100311 3300025242 Bacteria 76151
58 Ga0207425_1000444 3300025245 Bacteria 27112
59 Ga0209148_1000163 3300025254 Bacteria 137449
60 Ga0209129_1000012 3300025258 Bacteria 541516
61 Ga0209673_1000475 3300025273 Bacteria 67091
62 Ga0209025_1021261 3300025294 Bacteria 3503
63 Ga0209564_1000022 3300025295 Bacteria 555109
64 Ga0209564_1000496 3300025295 Bacteria 64984
65 Ga0209758_1000198 3300025297 Bacteria 133584
66 Ga0209050_1000283 3300025298 Bacteria 107761
67 Ga0209256_1000439 3300025299 Bacteria 64161
68 Ga0209256_1013636 3300025299 Bacteria 3002
69 Ga0207426_1002028 3300025302 Bacteria 14201
70 Ga0209051_1033881 3300025303 Bacteria 1923
71 Ga0209257_1000013 3300025304 Bacteria 1047305
72 Ga0207655_1029708 3300025728 Bacteria 2553
73 Ga0207713_1027200 3300025735 Bacteria 2603
74 Ga0207710_10000164 3300025900 Bacteria 70180
75 Ga0207647_10007912 3300025904 Bacteria 7647
76 Ga0207687_10215230 3300025927 Bacteria 1509
77 Ga0207711_10000196 3300025941 Bacteria 64910
78 Ga0207711_10007713 3300025941 Bacteria 8992
79 Ga0207667_10356777 3300025949 Bacteria 1491
80 Ga0207712_10000029 3300025961 Bacteria 220014
81 Ga0207668_10230906 3300025972 Bacteria 1492
82 Ga0207658_10000113 3300025986 Bacteria 88960
83 Ga0207658_10338499 3300025986 Bacteria 1307
84 Ga0207641_10001920 3300026088 Bacteria 19944
85 Ga0207675_100000255 3300026118 Bacteria 50880
86 Ga0209813_10000145 3300027866 Bacteria 24679
87 Ga0209813_10003282 3300027866 Bacteria 3777
88 Ga0268265_10000040 3300028380 Bacteria 194156
89 Ga0268264_10000017 3300028381 Bacteria 498037
90 Ga0265318_10004374 3300028577 Bacteria 6855
91 Ga0307517_10063754 3300028786 Bacteria 3439
92 Ga0307515_10006532 3300028794 Bacteria 23318
93 Ga0307515_10189233 3300028794 Bacteria 1975
94 Ga0307515_10316683 3300028794 Bacteria 1230
95 Ga0307512_10006223 3300030522 Bacteria 12158
96 Ga0307512_10023291 3300030522 Bacteria 5537
97 Ga0265330_10002686 3300031235 Bacteria 9609
98 Ga0265332_10017136 3300031238 Bacteria 3195
99 Ga0265328_10060707 3300031239 Bacteria 1388
100 Ga0265320_10001020 3300031240 Bacteria 20858
101 Ga0265329_10006019 3300031242 Bacteria 4851
102 Ga0265340_10005110 3300031247 Bacteria 7293
103 Ga0265331_10039765 3300031250 Bacteria 2291
104 Ga0307513_10002122 3300031456 Bacteria 27831
105 Ga0307513_10168595 3300031456 Bacteria 2070
106 Ga0307509_10000047 3300031507 Bacteria 169362
107 Ga0307508_10011219 3300031616 Bacteria 8197
108 Ga0307508_10066042 3300031616 Bacteria 3185
109 Ga0307514_10080196 3300031649 Bacteria 2416
110 Ga0265314_10039874 3300031711 Bacteria 3377
111 Ga0265342_10019479 3300031712 Bacteria 4372
112 Ga0307516_10015740 3300031730 Bacteria 7948
113 Ga0307516_10093180 3300031730 Bacteria 2838
114 Ga0307516_10180039 3300031730 Bacteria 1848
115 Ga0373942_0000468 3300035207 Bacteria 11445
116 Ga0373931_0003427 3300035691 Bacteria 7119
117 Ga0395899_0135063 3300037312 Bacteria 1759
118 Ga0395900_0151249 3300037418 Bacteria 2371
119 Ga0395900_0202467 3300037418 Bacteria 2008
120 Ga0395898_0251128 3300037466 Bacteria 1687
121 Ga0395905_0277313 3300037471 Bacteria 1562
122 Ga0436364_0697584 3300037853 Bacteria 3811
123 Ga0451837_0072614 3300041494 Bacteria 1457
124 Ga0451853_1564484 3300041512 Bacteria 1532
125 Ga0439455_0007303 3300042012 Bacteria 2333
126 Ga0450903_000688 3300042138 Bacteria 6769
127 Ga0439458_0001378 3300042157 Bacteria 6135
128 Ga0466963_0000381 3300044694 Bacteria 20256
129 Ga0453684_0000959 3300044712 Bacteria 94983
130 Ga0453684_0001492 3300044712 Bacteria 66005
131 Ga0466970_0082810 3300044765 Bacteria 1735
132 Ga0466957_0238165 3300044842 Bacteria 1207
133 Ga0495617_018798 3300046452 Bacteria 2337
134 Ga0495603_0000169 3300046455 Bacteria 33188
135 Ga0495603_0191603 3300046455 Bacteria 1182
136 Ga0495629_0010801 3300046459 Bacteria 6643
137 Ga0495629_0054042 3300046459 Bacteria 2809
138 Ga0495629_0087760 3300046459 Bacteria 2170
139 Ga0495638_0130907 3300046460 Bacteria 1473
140 Ga0495651_0030039 3300046462 Bacteria 4237
141 Ga0495653_0000002 3300046463 Bacteria 507262
142 Ga0495650_0000048 3300046471 Bacteria 334427
143 Ga0495580_0041995 3300046472 Bacteria 3259
144 Ga0495605_0009363 3300046474 Bacteria 5504
145 Ga0495662_0003835 3300046476 Bacteria 7578
146 Ga0495664_0057887 3300046477 Bacteria 2306
147 Ga0495584_0049384 3300046491 Bacteria 2120
148 Ga0495594_0001545 3300046499 Bacteria 11952
149 Ga0495594_0007681 3300046499 Bacteria 5548
150 Ga0495607_0000101 3300046501 Bacteria 91495
151 Ga0495607_0073191 3300046501 Bacteria 1905
152 Ga0495583_0002813 3300046506 Bacteria 14240
153 Ga0495583_0102199 3300046506 Bacteria 1222
154 Ga0495606_0000566 3300046507 Bacteria 58661
155 Ga0495606_0001273 3300046507 Bacteria 34937
156 Ga0495608_0083878 3300046511 Bacteria 2068
157 Ga0495616_0027569 3300046513 Bacteria 3013
158 Ga0495618_0132375 3300046514 Bacteria 1595
159 Ga0495620_0005362 3300046515 Bacteria 7166
160 Ga0495620_0041755 3300046515 Bacteria 2009
161 Ga0495628_0000305 3300046516 Bacteria 44171
162 Ga0495628_0037310 3300046516 Bacteria 3896
163 Ga0495628_0080361 3300046516 Bacteria 2534
164 Ga0495631_0009029 3300046518 Bacteria 4994
165 Ga0495643_0000779 3300046522 Bacteria 35558
166 Ga0495643_0008026 3300046522 Bacteria 6730
167 Ga0495643_0034825 3300046522 Bacteria 2775
168 Ga0495643_0134197 3300046522 Bacteria 1240
169 Ga0495648_0083172 3300046524 Bacteria 1814
170 Ga0495648_0105221 3300046524 Bacteria 1548
171 Ga0495652_0009557 3300046529 Bacteria 8805
172 Ga0495652_0033722 3300046529 Bacteria 4467
173 Ga0495652_0062633 3300046529 Bacteria 3136
174 Ga0495652_0064571 3300046529 Bacteria 3078
175 Ga0495640_0001326 3300046533 Bacteria 19473
176 Ga0495609_0036257 3300046538 Bacteria 2227
177 Ga0495597_0008976 3300046542 Bacteria 4982
178 Ga0495633_0123209 3300046558 Bacteria 1201
179 Ga0495656_0014908 3300046615 Bacteria 2924
180 Ga0495656_0089374 3300046615 Bacteria 1406
181 Ga0495668_0014161 3300046616 Bacteria 4686
182 Ga0495668_0098787 3300046616 Bacteria 1597
183 Ga0495634_0035893 3300046642 Bacteria 3392
184 Ga0495634_0060391 3300046642 Bacteria 2522
185 Ga0495611_0020635 3300046648 Bacteria 2837
186 Ga0495625_0062933 3300046660 Bacteria 2621
187 Ga0495625_0142250 3300046660 Bacteria 1617
188 Ga0495635_0097949 3300046663 Bacteria 2005
189 Ga0495635_0164362 3300046663 Bacteria 1510
190 Ga0495661_0052360 3300046665 Bacteria 2460
191 Ga0495588_0008096 3300046674 Bacteria 4806
192 Ga0495657_0010702 3300046675 Bacteria 6895
193 Ga0495657_0015392 3300046675 Bacteria 5599
194 Ga0495657_0036802 3300046675 Bacteria 3379
195 Ga0495623_0004702 3300046679 Bacteria 8972
196 Ga0495613_0002314 3300046689 Bacteria 14432
197 Ga0495613_0023226 3300046689 Bacteria 4619
198 Ga0495613_0055011 3300046689 Bacteria 2925
199 Ga0495624_0038473 3300046690 Bacteria 3073
200 Ga0495670_0063320 3300046691 Bacteria 1862
201 Ga0495670_0080785 3300046691 Bacteria 1656
202 Ga0495649_0004377 3300046694 Bacteria 9241
203 Ga0495649_0033777 3300046694 Bacteria 2815
204 Ga0495649_0092183 3300046694 Bacteria 1614
205 Ga0495600_0010654 3300046809 Bacteria 5712
206 Ga0495600_0045267 3300046809 Bacteria 2871
207 Ga0495600_0092332 3300046809 Bacteria 1974
208 Ga0495660_0057620 3300046810 Bacteria 2095
209 Ga0495604_0003056 3300047317 Bacteria 13374
210 Ga0495604_0008141 3300047317 Bacteria 8296
211 Ga0495604_0009589 3300047317 Bacteria 7657
212 Ga0495604_0162072 3300047317 Bacteria 1579
213 Ga0495636_0054459 3300047318 Bacteria 1681
214 Ga0495676_0009514 3300047321 Bacteria 8849
215 Ga0495676_0020440 3300047321 Bacteria 5808
216 Ga0495676_0035443 3300047321 Bacteria 4172
217 Ga0495676_0076489 3300047321 Bacteria 2555
218 Ga0495676_0097149 3300047321 Bacteria 2188
219 Ga0495680_0002951 3300047322 Bacteria 17021
220 Ga0495683_0115809 3300047323 Bacteria 1276
221 Ga0495687_003312 3300047443 Bacteria 11815
222 Ga0495687_007993 3300047443 Bacteria 6127
223 Ga0495687_008306 3300047443 Bacteria 5964
224 Ga0495675_0090769 3300047444 Bacteria 1917
225 Ga0495685_007546 3300047447 Bacteria 3593
226 Ga0495685_011054 3300047447 Bacteria 3038
227 Ga0495685_052840 3300047447 Bacteria 1376
228 Ga0495681_0085934 3300047470 Bacteria 1396
229 Ga0495684_0135001 3300047471 Bacteria 1852
230 Ga0495684_0199823 3300047471 Bacteria 1474
231 Ga0495593_0009118 3300047673 Bacteria 5755
232 Ga0495602_0114327 3300048088 Bacteria 2186
233 Ga0495614_0015967 3300048089 Bacteria 3270
234 Ga0495614_0018640 3300048089 Bacteria 3006
235 Ga0495626_0043373 3300048091 Bacteria 2110
236 Ga0496100_0003562 3300048903 Bacteria 8137
237 Ga0496100_0129047 3300048903 Bacteria 1778
238 Ga0496101_0000209 3300048904 Bacteria 44473
239 Ga0496101_0018410 3300048904 Bacteria 4750
240 Ga0496101_0021376 3300048904 Bacteria 4447
241 Ga0496102_0000014 3300048905 Bacteria 310241
242 Ga0496102_0000941 3300048905 Bacteria 27484
243 Ga0496103_0000004 3300048906 Bacteria 510080
244 Ga0496103_0004108 3300048906 Bacteria 8840
245 Ga0496103_0004615 3300048906 Bacteria 8339
246 Ga0496105_0138936 3300048908 Bacteria 2001
247 Ga0496106_0107568 3300048909 Bacteria 2169
248 Ga0496112_0141469 3300048915 Bacteria 2375
249 Ga0496114_0523276 3300048917 Bacteria 1049
250 Ga0496116_0000069 3300048919 Bacteria 252643
251 Ga0496116_0033265 3300048919 Bacteria 3661
252 Ga0496117_0000003 3300048920 Bacteria 1881097
253 Ga0496117_0000160 3300048920 Bacteria 141709
254 Ga0496118_0000001 3300048921 Bacteria 1881100
255 Ga0496118_0013637 3300048921 Bacteria 7671
256 Ga0496119_0000262 3300048922 Bacteria 74530
257 Ga0496119_0003411 3300048922 Bacteria 16508
258 Ga0496120_0000085 3300048923 Bacteria 155343
259 Ga0496121_0000032 3300048924 Bacteria 378997
260 Ga0496121_0001187 3300048924 Bacteria 45612
261 Ga0496121_0011050 3300048924 Bacteria 10077
262 Ga0496121_0038495 3300048924 Bacteria 4233
263 Ga0496121_0063135 3300048924 Bacteria 3029
264 Ga0496121_0107825 3300048924 Bacteria 2132
265 Ga0496125_0067371 3300048928 Bacteria 2821
266 Ga0496125_0135446 3300048928 Bacteria 1724
267 Ga0496126_0001225 3300048929 Bacteria 41693
268 Ga0496126_0018246 3300048929 Bacteria 6960
269 Ga0496126_0120269 3300048929 Bacteria 2278
270 Ga0501031_0045388 3300049568 Bacteria 2867
271 Ga0501032_0034774 3300049569 Bacteria 3447
272 Ga0501033_0058570 3300049570 Bacteria 2845
273 Ga0501033_0070424 3300049570 Bacteria 2569
274 Ga0501034_0171235 3300049571 Bacteria 2138
275 Ga0501034_0209622 3300049571 Bacteria 1904
276 Ga0501036_0022012 3300049572 Bacteria 5361
277 Ga0501036_0026501 3300049572 Bacteria 4893
278 Ga0501037_0006008 3300049573 Bacteria 8862
279 Ga0501037_0080902 3300049573 Bacteria 2356
280 Ga0501038_0043508 3300049574 Bacteria 3904
281 Ga0501038_0047987 3300049574 Bacteria 3697
282 Ga0501043_0003130 3300049579 Bacteria 13723
283 Ga0501043_0010871 3300049579 Bacteria 7128
284 Ga0501046_0028148 3300049580 Bacteria 4579
285 Ga0501070_0066425 3300049586 Bacteria 2987
286 Ga0501070_0400321 3300049586 Bacteria 1110
287 Ga0501077_0007313 3300049593 Bacteria 6813
288 Ga0501241_000278 3300049758 Bacteria 11304
289 Ga0501035_0150390 3300049822 Bacteria 2021
290 Ga0501044_0008318 3300049823 Bacteria 11369
291 Ga0501044_0039673 3300049823 Bacteria 4911
292 Ga0501044_0243158 3300049823 Bacteria 1743
293 Ga0501045_0086082 3300049824 Bacteria 2320
294 nmdc:mga03n38_33242_c1 3300050490 Bacteria 2192
295 nmdc:mga0yw44_105838_c1 3300050492 Bacteria 1797
296 nmdc:mga0k408_100422_c1 3300050493 Bacteria 1706
297 nmdc:mga06z11_263_c1 3300050494 Bacteria 20517
298 nmdc:mga04h51_150_c1 3300050495 Bacteria 20503
299 nmdc:mga04h51_4781_c1 3300050495 Bacteria 3400
300 nmdc:mga07m45_26197_c1 3300050496 Bacteria 3204
301 nmdc:mga05p37_96407_c1 3300050507 Bacteria 3644
302 nmdc:mga09592_151470_c1 3300050508 Bacteria 2001
303 nmdc:mga0qj67_134616_c1 3300050509 Bacteria 2002
304 nmdc:mga06r32_126006_c1 3300050510 Bacteria 2530
305 Ga0495619_0036037 3300053085 Bacteria 3220
306 Ga0500578_0000086 3300053086 Bacteria 103107
307 Ga0500643_015477 3300053087 Bacteria 2614
308 Ga0500644_0013968 3300053088 Bacteria 2255
309 Ga0500646_0038188 3300053090 Bacteria 1344
310 Ga0500641_0037984 3300053096 Bacteria 1933
311 Ga0500650_0137366 3300053098 Bacteria 1134
312 Ga0500555_031630 3300053103 Bacteria 1499
313 Ga0500556_0000991 3300053104 Bacteria 15004
314 Ga0500569_000537 3300053109 Bacteria 6336
315 Ga0500594_0018230 3300053118 Bacteria 1726
316 Ga0500652_043523 3300053131 Bacteria 1815
317 Ga0500658_0000826 3300053134 Bacteria 12746
318 Ga0500573_0024734 3300053140 Bacteria 3453
319 Ga0500577_0041869 3300053142 Bacteria 1673
320 Ga0500600_0049015 3300053149 Bacteria 2403
321 Ga0500616_0000106 3300053153 Bacteria 153706
322 Ga0500616_0000181 3300053153 Bacteria 104316
323 Ga0500616_0003944 3300053153 Bacteria 10885
324 Ga0500622_0000051 3300053156 Bacteria 145514
325 Ga0500636_0037856 3300053177 Bacteria 2853
326 2579855767 2579778521 Bacteria 7624758
327 2585303019 2582581313 Bacteria 10042643
328 2585321883 2582581314 Bacteria 11452267
329 2616698461 2616644814 Bacteria 11555299
330 2619856451 2619618881 Bacteria 7521104
331 2620351967 2619619003 Bacteria 7619552
332 2644061744 2643221609 Bacteria 6756331
333 2644070950 2643221611 Bacteria 6820941
334 2644130915 2643221623 Bacteria 5239945
335 2644265670 2643221647 Bacteria 10741251
336 2644440122 2643221678 Bacteria 9540101
337 2644724549 2643221732 Bacteria 5756404
338 2738731281 2738541278 Bacteria 9755573
339 2739206374 2738543005 Bacteria 5278128
340 2786667587 2786546132 Bacteria 10419719
341 2808848937 2808606359 Bacteria 9866990
342 2808917177 2808606375 Bacteria 9466072
343 2854913131 2854911287 Bacteria 5582813
344 2856743708 2856741275 Bacteria 8096094
345 2857576948 2857576091 Bacteria 5465855
346 2857595148 2857591370 Bacteria 6569758
347 2862384976 2862382967 Bacteria 10317375
348 2862581211 2862574272 Bacteria 10567477
349 2865006154 2865002811 Bacteria 6333767
350 2867431595 2867428634 Bacteria 9590268
351 2891397072 2891395885 Bacteria 9251614
352 2891558090 2891554331 Bacteria 8812224
353 2891566203 2891562705 Bacteria 8039471
354 2895434752 2895427314 Bacteria 13147766
355 2904529810 2904524088 Bacteria 5887454
356 2912727930 2912723979 Bacteria 8557534
357 2919149738 2919143609 Bacteria 6219228
358 2919522849 2919517244 Bacteria 5858162
359 2928099537 2928093941 Bacteria 5965005
360 2929009650 2929004312 Bacteria 5678476
361 2929924086 2929921140 Bacteria 8649150
362 2954381328 2954380949 Bacteria 10050426
363 2954673727 2954673503 Bacteria 9685905
364 2954690263 2954682443 Bacteria 9862841
365 2954719719 2954711539 Bacteria 10867210
366 2954729754 2954721474 Bacteria 10456478
367 2954732025 2954731030 Bacteria 10243860
368 2954748660 2954740390 Bacteria 10229294
369 2954750994 2954749733 Bacteria 10366972
370 2954767777 2954759201 Bacteria 9358192
371 3001896097 3001892409 Bacteria 6328293
372 8008565345 8008558824 Bacteria 10610750
373 8008581861 8008574985 Bacteria 7815457
374 8047712329 8047710418 Bacteria 11023148
375 8047896400 8047893842 Bacteria 11723082
376 8048133166 8048127548 Bacteria 11053136
377 8048362536 8048356638 Bacteria 11044339
378 8048373409 8048369669 Bacteria 11666822
379 8048384833 8048379754 Bacteria 11877923
380 8054918834 8054913762 Bacteria 7713009
381 8054927610 8054920844 Bacteria 7068637
382 8055072576 8055066027 Bacteria 9479577
383 Ga0496118_0006093
384 JGI24737J22298_10032508
385 JGI25152J39213_1000831
386 JGI25153J46596_10001274
387 rootH1_10154899
388 rootH2_10263809
389 rootL2_10029221
390 rootL2_10055409
391 rootH1_10005689
392 rootH1_10022076
393 rootH1_10034663
394 Ga0055526_1000659
395 Ga0055526_1003216
396 Ga0055524_1000618
397 Ga0055528_1000602
398 Ga0065165_1000006
399 Ga0065165_1001673
400 Ga0065165_1004517
401 Ga0070683_100170708
402 Ga0070668_100221985
403 Ga0070667_100000142
404 Ga0070699_100238779
405 Ga0068855_100167723
406 Ga0068855_100214220
407 Ga0068859_100002793
408 Ga0068861_100000109
409 Ga0068863_100000105
410 Ga0068858_100173754
411 Ga0068860_100000209
412 Ga0068862_100000211
413 Ga0068862_100195882
414 Ga0075365_10041274
415 Ga0075368_10000298
416 Ga0075364_10039168
417 Ga0075367_10000140
418 Ga0075367_10000255
419 Ga0075366_10038469
420 Ga0075370_10005538
421 Ga0075370_10025139
422 Ga0075428_100010750
423 Ga0075428_100069814
424 Ga0075430_100014876
425 Ga0075429_100015425
426 Ga0097620_100002793
427 Ga0105244_10028800
428 Ga0105247_10000141
429 Ga0114129_10029180
430 Ga0114129_10050047
431 Ga0105248_10000242
432 Ga0105248_10017160
433 Ga0105249_10000031
434 Ga0157374_10575725
435 Ga0163163_10109970
436 Ga0157379_10105052
437 Ga0163161_10260202
438 Ga0213875_10014757
439 Ga0209258_100311
440 Ga0207425_1000444
441 Ga0209148_1000163
442 Ga0209129_1000012
443 Ga0209673_1000475
444 Ga0209025_1021261
445 Ga0209564_1000022
446 Ga0209564_1000496
447 Ga0209758_1000198
448 Ga0209050_1000283
449 Ga0209256_1000439
450 Ga0209256_1013636
451 Ga0207426_1002028
452 Ga0209051_1033881
453 Ga0209257_1000013
454 Ga0207655_1029708
455 Ga0207713_1027200
456 Ga0207710_10000164
457 Ga0207647_10007912
458 Ga0207687_10215230
459 Ga0207711_10000196
460 Ga0207711_10007713
461 Ga0207667_10356777
462 Ga0207712_10000029
463 Ga0207668_10230906
464 Ga0207658_10000113
465 Ga0207658_10338499
466 Ga0207641_10001920
467 Ga0207675_100000255
468 Ga0209813_10000145
469 Ga0209813_10003282
470 Ga0268265_10000040
471 Ga0268264_10000017
472 Ga0265318_10004374
473 Ga0307517_10063754
474 Ga0307515_10006532
475 Ga0307515_10189233
476 Ga0307515_10316683
477 Ga0307512_10006223
478 Ga0307512_10023291
479 Ga0265330_10002686
480 Ga0265332_10017136
481 Ga0265328_10060707
482 Ga0265320_10001020
483 Ga0265329_10006019
484 Ga0265340_10005110
485 Ga0265331_10039765
486 Ga0307513_10002122
487 Ga0307513_10168595
488 Ga0307509_10000047
489 Ga0307508_10011219
490 Ga0307508_10066042
491 Ga0307514_10080196
492 Ga0265314_10039874
493 Ga0265342_10019479
494 Ga0307516_10015740
495 Ga0307516_10093180
496 Ga0307516_10180039
497 Ga0373942_0000468
498 Ga0373931_0003427
499 Ga0395899_0135063
500 Ga0395900_0151249
501 Ga0395900_0202467
502 Ga0395898_0251128
503 Ga0395905_0277313
504 Ga0436364_0697584
505 Ga0451837_0072614
506 Ga0451853_1564484
507 Ga0439455_0007303
508 Ga0450903_000688
509 Ga0439458_0001378
510 Ga0466963_0000381
511 Ga0453684_0000959
512 Ga0453684_0001492
513 Ga0466970_0082810
514 Ga0466957_0238165
515 Ga0495617_018798
516 Ga0495603_0000169
517 Ga0495603_0191603
518 Ga0495629_0010801
519 Ga0495629_0054042
520 Ga0495629_0087760
521 Ga0495638_0130907
522 Ga0495651_0030039
523 Ga0495653_0000002
524 Ga0495650_0000048
525 Ga0495580_0041995
526 Ga0495605_0009363
527 Ga0495662_0003835
528 Ga0495664_0057887
529 Ga0495584_0049384
530 Ga0495594_0001545
531 Ga0495594_0007681
532 Ga0495607_0000101
533 Ga0495607_0073191
534 Ga0495583_0002813
535 Ga0495583_0102199
536 Ga0495606_0000566
537 Ga0495606_0001273
538 Ga0495608_0083878
539 Ga0495616_0027569
540 Ga0495618_0132375
541 Ga0495620_0005362
542 Ga0495620_0041755
543 Ga0495628_0000305
544 Ga0495628_0037310
545 Ga0495628_0080361
546 Ga0495631_0009029
547 Ga0495643_0000779
548 Ga0495643_0008026
549 Ga0495643_0034825
550 Ga0495643_0134197
551 Ga0495648_0083172
552 Ga0495648_0105221
553 Ga0495652_0009557
554 Ga0495652_0033722
555 Ga0495652_0062633
556 Ga0495652_0064571
557 Ga0495640_0001326
558 Ga0495609_0036257
559 Ga0495597_0008976
560 Ga0495633_0123209
561 Ga0495656_0014908
562 Ga0495656_0089374
563 Ga0495668_0014161
564 Ga0495668_0098787
565 Ga0495634_0035893
566 Ga0495634_0060391
567 Ga0495611_0020635
568 Ga0495625_0062933
569 Ga0495625_0142250
570 Ga0495635_0097949
571 Ga0495635_0164362
572 Ga0495661_0052360
573 Ga0495588_0008096
574 Ga0495657_0010702
575 Ga0495657_0015392
576 Ga0495657_0036802
577 Ga0495623_0004702
578 Ga0495613_0002314
579 Ga0495613_0023226
580 Ga0495613_0055011
581 Ga0495624_0038473
582 Ga0495670_0063320
583 Ga0495670_0080785
584 Ga0495649_0004377
585 Ga0495649_0033777
586 Ga0495649_0092183
587 Ga0495600_0010654
588 Ga0495600_0045267
589 Ga0495600_0092332
590 Ga0495660_0057620
591 Ga0495604_0003056
592 Ga0495604_0008141
593 Ga0495604_0009589
594 Ga0495604_0162072
595 Ga0495636_0054459
596 Ga0495676_0009514
597 Ga0495676_0020440
598 Ga0495676_0035443
599 Ga0495676_0076489
600 Ga0495676_0097149
601 Ga0495680_0002951
602 Ga0495683_0115809
603 Ga0495687_003312
604 Ga0495687_007993
605 Ga0495687_008306
606 Ga0495675_0090769
607 Ga0495685_007546
608 Ga0495685_011054
609 Ga0495685_052840
610 Ga0495681_0085934
611 Ga0495684_0135001
612 Ga0495684_0199823
613 Ga0495593_0009118
614 Ga0495602_0114327
615 Ga0495614_0015967
616 Ga0495614_0018640
617 Ga0495626_0043373
618 Ga0496100_0003562
619 Ga0496100_0129047
620 Ga0496101_0000209
621 Ga0496101_0018410
622 Ga0496101_0021376
623 Ga0496102_0000014
624 Ga0496102_0000941
625 Ga0496103_0000004
626 Ga0496103_0004108
627 Ga0496103_0004615
628 Ga0496105_0138936
629 Ga0496106_0107568
630 Ga0496112_0141469
631 Ga0496114_0523276
632 Ga0496116_0000069
633 Ga0496116_0033265
634 Ga0496117_0000003
635 Ga0496117_0000160
636 Ga0496118_0000001
637 Ga0496118_0013637
638 Ga0496119_0000262
639 Ga0496119_0003411
640 Ga0496120_0000085
641 Ga0496121_0000032
642 Ga0496121_0001187
643 Ga0496121_0011050
644 Ga0496121_0038495
645 Ga0496121_0063135
646 Ga0496121_0107825
647 Ga0496125_0067371
648 Ga0496125_0135446
649 Ga0496126_0001225
650 Ga0496126_0018246
651 Ga0496126_0120269
652 Ga0501031_0045388
653 Ga0501032_0034774
654 Ga0501033_0058570
655 Ga0501033_0070424
656 Ga0501034_0171235
657 Ga0501034_0209622
658 Ga0501036_0022012
659 Ga0501036_0026501
660 Ga0501037_0006008
661 Ga0501037_0080902
662 Ga0501038_0043508
663 Ga0501038_0047987
664 Ga0501043_0003130
665 Ga0501043_0010871
666 Ga0501046_0028148
667 Ga0501070_0066425
668 Ga0501070_0400321
669 Ga0501077_0007313
670 Ga0501241_000278
671 Ga0501035_0150390
672 Ga0501044_0008318
673 Ga0501044_0039673
674 Ga0501044_0243158
675 Ga0501045_0086082
676 nmdc:mga03n38_33242_c1
677 nmdc:mga0yw44_105838_c1
678 nmdc:mga0k408_100422_c1
679 nmdc:mga06z11_263_c1
680 nmdc:mga04h51_150_c1
681 nmdc:mga04h51_4781_c1
682 nmdc:mga07m45_26197_c1
683 nmdc:mga05p37_96407_c1
684 nmdc:mga09592_151470_c1
685 nmdc:mga0qj67_134616_c1
686 nmdc:mga06r32_126006_c1
687 Ga0495619_0036037
688 Ga0500578_0000086
689 Ga0500643_015477
690 Ga0500644_0013968
691 Ga0500646_0038188
692 Ga0500641_0037984
693 Ga0500650_0137366
694 Ga0500555_031630
695 Ga0500556_0000991
696 Ga0500569_000537
697 Ga0500594_0018230
698 Ga0500652_043523
699 Ga0500658_0000826
700 Ga0500573_0024734
701 Ga0500577_0041869
702 Ga0500600_0049015
703 Ga0500616_0000106
704 Ga0500616_0000181
705 Ga0500616_0003944
706 Ga0500622_0000051
707 Ga0500636_0037856
708 2579855767
709 2585303019
710 2585321883
711 2616698461
712 2619856451
713 2620351967
714 2644061744
715 2644070950
716 2644130915
717 2644265670
718 2644440122
719 2644724549
720 2738731281
721 2739206374
722 2786667587
723 2808848937
724 2808917177
725 2854913131
726 2856743708
727 2857576948
728 2857595148
729 2862384976
730 2862581211
731 2865006154
732 2867431595
733 2891397072
734 2891558090
735 2891566203
736 2895434752
737 2904529810
738 2912727930
739 2919149738
740 2919522849
741 2928099537
742 2929009650
743 2929924086
744 2954381328
745 2954673727
746 2954690263
747 2954719719
748 2954729754
749 2954732025
750 2954748660
751 2954750994
752 2954767777
753 3001896097
754 8008565345
755 8008581861
756 8047712329
757 8047896400
758 8048133166
759 8048362536
760 8048373409
761 8048384833
762 8054918834
763 8054927610
764 8055072576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

259

379

0.87

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

78

173

0.84

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

228

341

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.9172 1 335
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8942 4 337
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8914 4 337
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.8869 1 335
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.8816 4 335
ID Description Score Start End Superfamily
4a27B01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9391 4 135 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9389 6 131 3.90.180.10
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9384 6 131 3.90.180.10
af_A0A0R0I1N1_1_153_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9361 6 151 3.90.180.10
af_A0A0P0W924_2_174_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.935 20 148 3.90.180.10
ID Description Score Start End GO Terms
AF-B6A117-F1-model_v4 deleted 0.9864 6 337
AF-A0A8B4TPP6-F1-model_v4 Bifunctional zinc-containing alcohol dehydrogenase/quinone oxidoreductase (EC 1.6.5.5) 0.9792 1 323 GO:0008270
GO:0016491
AF-B6A117-F1-model_v4 deleted 0.9777 6 337
AF-A0A7Y2W8E6-F1-model_v4 NADP-dependent oxidoreductase 0.9755 67 337 GO:0016491
AF-A0A4Q5QYW0-F1-model_v4 NADP-dependent oxidoreductase 0.9713 43 336 GO:0008270
GO:0016491

Map