F429413

General Info

Members Datasets Scaffolds Average Seq Length
382 191 376 466

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0024813|Ga0501032_0024813_1077_2609
Length 510
Sequence MPFDPVILWTDALVYLLVAVVITIGWHIQHHSHLLTPWRRATHSASGMAALTVLVIFILIGLLDTIHFRPALDNTSDKSGEKIYSVEVLSLFDIIATPLRTRVEKTYSAPLSAHLYAKETVELADGSQAREFTRLIYGGAHLEKPETQRINDITKRAITGAGWGLLAWSTIVVSLGMLLARQNNISFLQMQSAIWRGVTETPWYAIMITLGLIAVLLGMIVALSTHYHVLGTDKVGQDVLYQSLKSIRTGLLIGTLTTLIMLPFALLLGIAAGYFRGWVDDIIQYTYTTLSSIPSVXXXXAAVLMMQVYIEIHPEIFDTASARADLRLLFLCIILGITSWTGLCRLLRGETLKLREMEYIQAAHAFAVSHWRIISRHILPNVMHIVLITIVMDFSGLVLAEAVLSYVGVGVDPSMISFGTMINAARLEMAREPMVWWTLLAAFGFMFILVLSANLFADAVQNAFNPRIRTLSEKASQSSYQAGNMPQSNTRSPRTATSAISSEAKDTAHP

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
4 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
79 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
83 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
84 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
85 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
86 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
87 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
104 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
105 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
106 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
107 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
108 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
109 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
110 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
111 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
181 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
182 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
183 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
184 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
185 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
186 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
190 639633007 Azoarcus olearius BH72 Isolate Unclassified
191 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 0.52
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 1.83
Rhizosphere 87.43
Stem 0
Stem Tuber 0
Unclassified 7.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100040621 3300005329 Bacteria 4278
2 Ga0070690_100002477 3300005330 Bacteria 9930
3 Ga0070682_100127626 3300005337 Bacteria 1717
4 Ga0070660_100184232 3300005339 Bacteria 1690
5 Ga0070673_100068557 3300005364 Bacteria 2841
6 Ga0070700_100003024 3300005441 Bacteria 8623
7 Ga0070678_100012558 3300005456 Bacteria 5273
8 Ga0070681_10006469 3300005458 Bacteria 11407
9 Ga0070681_10110397 3300005458 Bacteria 2690
10 Ga0070684_100173779 3300005535 Bacteria 1957
11 Ga0068853_100012582 3300005539 Bacteria 6884
12 Ga0070695_100106019 3300005545 Bacteria 1900
13 Ga0070696_100010180 3300005546 Bacteria 6294
14 Ga0070696_100041807 3300005546 Bacteria 3168
15 Ga0068856_100050365 3300005614 Bacteria 4106
16 Ga0070702_100000808 3300005615 Bacteria 11979
17 Ga0068866_10000471 3300005718 Bacteria 18459
18 Ga0068861_100003436 3300005719 Bacteria 10517
19 Ga0068863_100021194 3300005841 Bacteria 6204
20 Ga0068858_100030761 3300005842 Bacteria 4985
21 Ga0068858_100069272 3300005842 Bacteria 3270
22 Ga0068858_100180861 3300005842 Bacteria 1991
23 Ga0068862_100007551 3300005844 Bacteria 9011
24 Ga0075367_10001531 3300006178 Bacteria 9996
25 Ga0075369_10014583 3300006186 Bacteria 3142
26 Ga0075366_10087999 3300006195 Bacteria 1860
27 Ga0097621_100003027 3300006237 Bacteria 11544
28 Ga0068871_100002002 3300006358 Bacteria 13799
29 Ga0068871_100003262 3300006358 Bacteria 11129
30 Ga0075428_100009828 3300006844 Bacteria 10635
31 Ga0075430_100012426 3300006846 Bacteria 7244
32 Ga0075431_100017874 3300006847 Bacteria 7211
33 Ga0075431_100118652 3300006847 Bacteria 2730
34 Ga0075433_10206446 3300006852 Bacteria 1747
35 Ga0099794_10023422 3300007265 Bacteria 2824
36 Ga0111539_10044603 3300009094 Bacteria 5311
37 Ga0105245_10004511 3300009098 Bacteria 12301
38 Ga0114129_10196387 3300009147 Bacteria 2736
39 Ga0105243_10003077 3300009148 Bacteria 13735
40 Ga0105242_10003293 3300009176 Bacteria 12583
41 Ga0105242_10050990 3300009176 Bacteria 3371
42 Ga0105248_10028545 3300009177 Bacteria 6217
43 Ga0105248_10139645 3300009177 Bacteria 2733
44 Ga0105237_10027751 3300009545 Bacteria 5771
45 Ga0105238_10021554 3300009551 Bacteria 6563
46 Ga0105249_10017349 3300009553 Bacteria 6392
47 Ga0105246_10030495 3300011119 Bacteria 3563
48 Ga0157370_10011956 3300013104 Bacteria 9047
49 Ga0157374_10099791 3300013296 Bacteria 2782
50 Ga0157378_10002881 3300013297 Bacteria 15310
51 Ga0157372_10043527 3300013307 Bacteria 4971
52 Ga0157375_10058048 3300013308 Bacteria 3827
53 Ga0157375_10062515 3300013308 Bacteria 3700
54 Ga0157380_10150491 3300014326 Bacteria 2011
55 Ga0157376_10021331 3300014969 Bacteria 5029
56 Ga0157376_10022832 3300014969 Bacteria 4885
57 Ga0207707_10055084 3300025912 Bacteria 3460
58 Ga0207671_10026853 3300025914 Bacteria 4307
59 Ga0207657_10186046 3300025919 Bacteria 1677
60 Ga0207706_10018338 3300025933 Bacteria 6297
61 Ga0207686_10013949 3300025934 Bacteria 4460
62 Ga0207670_10008774 3300025936 Bacteria 5726
63 Ga0207670_10165916 3300025936 Bacteria 1652
64 Ga0207711_10073670 3300025941 Bacteria 2968
65 Ga0207689_10001033 3300025942 Bacteria 26735
66 Ga0207703_10138664 3300026035 Bacteria 2108
67 Ga0207639_10026232 3300026041 Bacteria 4234
68 Ga0207708_10000335 3300026075 Bacteria 37085
69 Ga0207648_10001298 3300026089 Bacteria 27839
70 Ga0207675_100003006 3300026118 Bacteria 16540
71 Ga0207675_100016032 3300026118 Bacteria 6996
72 Ga0207683_10014771 3300026121 Bacteria 6647
73 Ga0209974_10007299 3300027876 Bacteria 3811
74 Ga0207428_10077987 3300027907 Bacteria 2593
75 Ga0265318_10002903 3300028577 Bacteria 8910
76 Ga0307511_10000510 3300030521 Bacteria 41770
77 Ga0265330_10029580 3300031235 Bacteria 2463
78 Ga0265332_10001562 3300031238 Bacteria 12574
79 Ga0265332_10003928 3300031238 Bacteria 7089
80 Ga0265328_10004543 3300031239 Bacteria 6016
81 Ga0265329_10006847 3300031242 Bacteria 4474
82 Ga0265331_10007393 3300031250 Bacteria 6360
83 Ga0265331_10042786 3300031250 Bacteria 2196
84 Ga0265327_10007378 3300031251 Bacteria 8509
85 Ga0265327_10017977 3300031251 Bacteria 4403
86 Ga0265316_10018691 3300031344 Bacteria 5952
87 Ga0265316_10036020 3300031344 Bacteria 4003
88 Ga0265316_10119704 3300031344 Bacteria 1989
89 Ga0307509_10000053 3300031507 Bacteria 164364
90 Ga0307508_10030679 3300031616 Bacteria 4859
91 Ga0316575_10000029 3300031665 Bacteria 35444
92 Ga0316575_10001617 3300031665 Bacteria 7344
93 Ga0316575_10006798 3300031665 Bacteria 4132
94 Ga0316575_10022964 3300031665 Bacteria 2409
95 Ga0316579_10000051 3300031691 Bacteria 28043
96 Ga0316579_10000067 3300031691 Bacteria 25952
97 Ga0316579_10008809 3300031691 Bacteria 4222
98 Ga0316579_10009615 3300031691 Bacteria 4070
99 Ga0316579_10010830 3300031691 Bacteria 3863
100 Ga0316579_10033632 3300031691 Bacteria 2355
101 Ga0265314_10000245 3300031711 Bacteria 79757
102 Ga0316576_10001846 3300031727 Bacteria 11760
103 Ga0316576_10003806 3300031727 Bacteria 8927
104 Ga0316576_10007517 3300031727 Bacteria 6870
105 Ga0316576_10007869 3300031727 Bacteria 6741
106 Ga0316576_10009714 3300031727 Bacteria 6223
107 Ga0316576_10020028 3300031727 Bacteria 4594
108 Ga0316576_10022968 3300031727 Bacteria 4339
109 Ga0316576_10057468 3300031727 Bacteria 2842
110 Ga0316576_10084121 3300031727 Bacteria 2364
111 Ga0316578_10000266 3300031728 Bacteria 15650
112 Ga0316578_10000289 3300031728 Bacteria 15279
113 Ga0316578_10000612 3300031728 Bacteria 12512
114 Ga0316578_10001403 3300031728 Bacteria 9740
115 Ga0316578_10002498 3300031728 Bacteria 8103
116 Ga0316578_10006954 3300031728 Bacteria 5631
117 Ga0316578_10010460 3300031728 Bacteria 4815
118 Ga0316578_10015946 3300031728 Bacteria 4055
119 Ga0316578_10019721 3300031728 Bacteria 3717
120 Ga0316578_10023058 3300031728 Bacteria 3480
121 Ga0316578_10024002 3300031728 Bacteria 3418
122 Ga0316578_10035651 3300031728 Bacteria 2861
123 Ga0316577_10000110 3300031733 Bacteria 23020
124 Ga0316577_10010359 3300031733 Bacteria 5032
125 Ga0316577_10010482 3300031733 Bacteria 5006
126 Ga0316577_10025418 3300031733 Bacteria 3293
127 Ga0316583_10003546 3300032133 Bacteria 5505
128 Ga0316583_10016888 3300032133 Bacteria 2625
129 Ga0316583_10028791 3300032133 Bacteria 1981
130 Ga0316583_10034653 3300032133 Bacteria 1791
131 Ga0316585_10000748 3300032137 Bacteria 8184
132 Ga0316585_10001261 3300032137 Bacteria 6616
133 Ga0316585_10007766 3300032137 Bacteria 3100
134 Ga0316585_10021846 3300032137 Bacteria 1966
135 Ga0316580_10000061 3300032139 Bacteria 18072
136 Ga0316580_10000472 3300032139 Bacteria 9287
137 Ga0316580_10016794 3300032139 Bacteria 2247
138 Ga0316592_1002048 3300033524 Bacteria 3415
139 Ga0316596_1002776 3300033541 Bacteria 3777
140 Ga0373926_0052142 3300035083 Bacteria 1478
141 Ga0373934_0010768 3300035086 Bacteria 3434
142 Ga0373923_0044008 3300035111 Bacteria 1849
143 Ga0373953_0012939 3300035117 Bacteria 2967
144 Ga0373956_0000078 3300035119 Bacteria 32263
145 Ga0373956_0059282 3300035119 Bacteria 1731
146 Ga0373955_0065176 3300035172 Bacteria 2021
147 Ga0316574_0000013 3300035398 Bacteria 44586
148 Ga0316574_0002375 3300035398 Bacteria 9414
149 Ga0316574_0005382 3300035398 Bacteria 6823
150 Ga0316574_0007575 3300035398 Bacteria 5961
151 Ga0316574_0008701 3300035398 Bacteria 5648
152 Ga0316574_0012206 3300035398 Bacteria 4909
153 Ga0316574_0017187 3300035398 Bacteria 4228
154 Ga0316574_0025765 3300035398 Bacteria 3532
155 Ga0316574_0029063 3300035398 Bacteria 3337
156 Ga0316574_0031815 3300035398 Bacteria 3202
157 Ga0316574_0040308 3300035398 Bacteria 2876
158 Ga0316574_0101935 3300035398 Bacteria 1838
159 Ga0373931_0027613 3300035691 Bacteria 2899
160 Ga0373931_0067562 3300035691 Bacteria 1943
161 Ga0373935_0003537 3300035692 Bacteria 9094
162 Ga0373927_0038700 3300035695 Bacteria 3096
163 Ga0373933_0000380 3300035724 Bacteria 28436
164 Ga0373933_0017664 3300035724 Bacteria 4001
165 Ga0373937_0000480 3300036401 Bacteria 36669
166 Ga0373937_0120471 3300036401 Bacteria 2445
167 Ga0373937_0336855 3300036401 Bacteria 1428
168 Ga0316582_0000035 3300036647 Bacteria 31472
169 Ga0316582_0000491 3300036647 Bacteria 14866
170 Ga0316582_0001355 3300036647 Bacteria 10649
171 Ga0316582_0002944 3300036647 Bacteria 8193
172 Ga0316582_0004601 3300036647 Bacteria 6991
173 Ga0316582_0027256 3300036647 Bacteria 3449
174 Ga0316582_0038250 3300036647 Bacteria 2980
175 Ga0316582_0091454 3300036647 Bacteria 2003
176 Ga0316584_0000296 3300036712 Bacteria 25440
177 Ga0316584_0001072 3300036712 Bacteria 15986
178 Ga0316584_0003511 3300036712 Bacteria 10219
179 Ga0316584_0004970 3300036712 Bacteria 8852
180 Ga0316584_0007500 3300036712 Bacteria 7467
181 Ga0316584_0011625 3300036712 Bacteria 6189
182 Ga0316584_0020465 3300036712 Bacteria 4797
183 Ga0316584_0021625 3300036712 Bacteria 4678
184 Ga0316584_0022744 3300036712 Bacteria 4576
185 Ga0316584_0061816 3300036712 Bacteria 2805
186 Ga0316584_0071541 3300036712 Bacteria 2598
187 Ga0316581_0007157 3300037588 Bacteria 2984
188 Ga0400484_07117 3300038725 Bacteria 17206
189 Ga0400484_19659 3300038725 Bacteria 16225
190 Ga0400484_34275 3300038725 Bacteria 23521
191 Ga0400484_44267 3300038725 Bacteria 4152
192 Ga0400490_29076 3300038726 Bacteria 21153
193 Ga0400490_37773 3300038726 Bacteria 14861
194 Ga0400490_40843 3300038726 Bacteria 6251
195 Ga0400490_55945 3300038726 Bacteria 5942
196 Ga0400485_03865 3300038735 Bacteria 2227
197 Ga0400485_03895 3300038735 Bacteria 5269
198 Ga0400488_15820 3300038741 Bacteria 8677
199 Ga0400488_44659 3300038741 Bacteria 1974
200 Ga0400486_17090 3300038742 Bacteria 7880
201 Ga0400483_077120 3300039062 Bacteria 3803
202 Ga0400483_111451 3300039062 Bacteria 3307
203 Ga0400483_142061 3300039062 Bacteria 2183
204 Ga0400483_165139 3300039062 Bacteria 2271
205 Ga0400483_215310 3300039062 Bacteria 8984
206 Ga0400483_250402 3300039062 Bacteria 1394
207 Ga0400489_11495 3300039093 Bacteria 1563
208 Ga0400489_11716 3300039093 Bacteria 27221
209 Ga0439434_0000276 3300042435 Bacteria 14722
210 Ga0439435_0001055 3300042436 Bacteria 4864
211 Ga0451577_0020022 3300042876 Bacteria 6145
212 Ga0451577_0036909 3300042876 Bacteria 4400
213 Ga0451577_0057986 3300042876 Bacteria 3451
214 Ga0453684_0003047 3300044712 Bacteria 38939
215 Ga0453684_0004425 3300044712 Bacteria 29667
216 Ga0453684_0025225 3300044712 Bacteria 8641
217 Ga0453684_0171885 3300044712 Bacteria 2553
218 Ga0453684_0300757 3300044712 Bacteria 1824
219 Ga0453684_0465946 3300044712 Bacteria 1404
220 Ga0451576_0000234 3300045051 Bacteria 135387
221 Ga0451576_0000355 3300045051 Bacteria 110049
222 Ga0451576_0004889 3300045051 Bacteria 17122
223 Ga0451576_0037753 3300045051 Bacteria 5115
224 Ga0451576_0039092 3300045051 Bacteria 5022
225 Ga0451576_0054595 3300045051 Bacteria 4183
226 Ga0451576_0166463 3300045051 Bacteria 2301
227 Ga0495592_0002686 3300046454 Bacteria 12579
228 Ga0495592_0030149 3300046454 Bacteria 4102
229 Ga0495592_0039501 3300046454 Bacteria 3544
230 Ga0495651_0005200 3300046462 Bacteria 9922
231 Ga0495662_0015680 3300046476 Bacteria 3678
232 Ga0495608_0002518 3300046511 Bacteria 13143
233 Ga0495628_0005649 3300046516 Bacteria 10949
234 Ga0495628_0007077 3300046516 Bacteria 9716
235 Ga0495628_0076609 3300046516 Bacteria 2602
236 Ga0495630_0046012 3300046517 Bacteria 3261
237 Ga0495666_0009140 3300046526 Bacteria 4958
238 Ga0495666_0045026 3300046526 Bacteria 2129
239 Ga0495652_0001265 3300046529 Bacteria 28259
240 Ga0495652_0029485 3300046529 Bacteria 4820
241 Ga0495652_0057351 3300046529 Bacteria 3303
242 Ga0495640_0013095 3300046533 Bacteria 6313
243 Ga0495587_0013214 3300046536 Bacteria 5190
244 Ga0495645_0000794 3300046543 Bacteria 21665
245 Ga0495645_0067620 3300046543 Bacteria 2580
246 Ga0495634_0011522 3300046642 Bacteria 6431
247 Ga0495599_0004390 3300046678 Bacteria 8351
248 Ga0495599_0005019 3300046678 Bacteria 7873
249 Ga0495658_0006299 3300046683 Bacteria 5832
250 Ga0495658_0071185 3300046683 Bacteria 2019
251 Ga0495613_0006340 3300046689 Bacteria 8847
252 Ga0495600_0007156 3300046809 Bacteria 6813
253 Ga0495604_0013866 3300047317 Bacteria 6429
254 Ga0495674_0004132 3300047319 Bacteria 14017
255 Ga0495680_0035025 3300047322 Bacteria 4047
256 Ga0495675_0034402 3300047444 Bacteria 3235
257 Ga0495684_0098173 3300047471 Bacteria 2215
258 Ga0496108_0004104 3300048911 Bacteria 11698
259 Ga0496108_0227318 3300048911 Bacteria 1622
260 Ga0496109_0042841 3300048912 Bacteria 4102
261 Ga0496112_0213426 3300048915 Bacteria 1887
262 Ga0496114_0001834 3300048917 Bacteria 16097
263 Ga0496114_0011859 3300048917 Bacteria 6974
264 Ga0496115_0019447 3300048918 Bacteria 5227
265 Ga0501031_0015722 3300049568 Bacteria 4912
266 Ga0501031_0022743 3300049568 Bacteria 4086
267 Ga0501032_0000464 3300049569 Bacteria 32673
268 Ga0501032_0000835 3300049569 Bacteria 25050
269 Ga0501032_0016930 3300049569 Bacteria 5123
270 Ga0501032_0024813 3300049569 Bacteria 4136
271 Ga0501033_0001142 3300049570 Bacteria 23980
272 Ga0501033_0002593 3300049570 Bacteria 15236
273 Ga0501033_0006581 3300049570 Bacteria 9088
274 Ga0501033_0079766 3300049570 Bacteria 2402
275 Ga0501034_0001115 3300049571 Bacteria 37686
276 Ga0501034_0004664 3300049571 Bacteria 15185
277 Ga0501034_0013615 3300049571 Bacteria 8369
278 Ga0501034_0046949 3300049571 Bacteria 4362
279 Ga0501034_0057296 3300049571 Bacteria 3918
280 Ga0501034_0168096 3300049571 Bacteria 2161
281 Ga0501036_0002335 3300049572 Bacteria 14827
282 Ga0501036_0026680 3300049572 Bacteria 4879
283 Ga0501036_0044021 3300049572 Bacteria 3780
284 Ga0501036_0091694 3300049572 Bacteria 2567
285 Ga0501036_0125327 3300049572 Bacteria 2169
286 Ga0501036_0160066 3300049572 Bacteria 1898
287 Ga0501037_0028650 3300049573 Bacteria 4113
288 Ga0501037_0071455 3300049573 Bacteria 2524
289 Ga0501037_0140129 3300049573 Bacteria 1731
290 Ga0501038_0000689 3300049574 Bacteria 30044
291 Ga0501038_0001990 3300049574 Bacteria 18885
292 Ga0501038_0005128 3300049574 Bacteria 12168
293 Ga0501038_0008506 3300049574 Bacteria 9432
294 Ga0501038_0150128 3300049574 Bacteria 1900
295 Ga0501038_0198920 3300049574 Bacteria 1609
296 Ga0501039_0014679 3300049575 Bacteria 5993
297 Ga0501040_0002441 3300049576 Bacteria 11969
298 Ga0501040_0010624 3300049576 Bacteria 6021
299 Ga0501041_0007151 3300049577 Bacteria 6547
300 Ga0501041_0127090 3300049577 Bacteria 1587
301 Ga0501042_0009087 3300049578 Bacteria 6608
302 Ga0501043_0001529 3300049579 Bacteria 20190
303 Ga0501043_0005791 3300049579 Bacteria 9942
304 Ga0501043_0029493 3300049579 Bacteria 4310
305 Ga0501043_0161068 3300049579 Bacteria 1753
306 Ga0501046_0018687 3300049580 Bacteria 5760
307 Ga0501046_0026490 3300049580 Bacteria 4736
308 Ga0501047_0051384 3300049581 Bacteria 3982
309 Ga0501048_0010308 3300049582 Bacteria 6986
310 Ga0501048_0022198 3300049582 Bacteria 4644
311 Ga0501048_0022773 3300049582 Bacteria 4580
312 Ga0501067_0041114 3300049583 Bacteria 2567
313 Ga0501068_0002049 3300049584 Bacteria 10756
314 Ga0501068_0006722 3300049584 Bacteria 6355
315 Ga0501068_0034572 3300049584 Bacteria 3014
316 Ga0501068_0069853 3300049584 Bacteria 2142
317 Ga0501070_0027884 3300049586 Bacteria 4737
318 Ga0501070_0119689 3300049586 Bacteria 2176
319 Ga0501071_0008223 3300049587 Bacteria 6886
320 Ga0501071_0041324 3300049587 Bacteria 3302
321 Ga0501071_0078013 3300049587 Bacteria 2420
322 Ga0501072_0001920 3300049588 Bacteria 15473
323 Ga0501072_0009790 3300049588 Bacteria 7288
324 Ga0501072_0013634 3300049588 Bacteria 6223
325 Ga0501073_0009039 3300049589 Bacteria 7356
326 Ga0501075_0008175 3300049591 Bacteria 7284
327 Ga0501075_0020355 3300049591 Bacteria 4825
328 Ga0501076_0005303 3300049592 Bacteria 9248
329 Ga0501076_0044472 3300049592 Bacteria 3502
330 Ga0501076_0155039 3300049592 Bacteria 1864
331 Ga0501079_0028828 3300049741 Bacteria 4261
332 Ga0501079_0045359 3300049741 Bacteria 3392
333 Ga0501079_0183377 3300049741 Bacteria 1634
334 Ga0501080_0002738 3300049742 Bacteria 15466
335 Ga0501080_0014328 3300049742 Bacteria 7301
336 Ga0501080_0052302 3300049742 Bacteria 3802
337 Ga0501080_0053756 3300049742 Bacteria 3750
338 Ga0501081_0000777 3300049743 Bacteria 18701
339 Ga0501081_0029686 3300049743 Bacteria 3697
340 Ga0501081_0138290 3300049743 Bacteria 1744
341 Ga0501280_000534 3300049776 Bacteria 8913
342 Ga0501035_0002349 3300049822 Bacteria 18642
343 Ga0501035_0006358 3300049822 Bacteria 11109
344 Ga0501035_0008565 3300049822 Bacteria 9521
345 Ga0501035_0013972 3300049822 Bacteria 7407
346 Ga0501035_0035240 3300049822 Bacteria 4542
347 Ga0501044_0003017 3300049823 Bacteria 19046
348 Ga0501044_0015854 3300049823 Bacteria 8108
349 Ga0501044_0029823 3300049823 Bacteria 5750
350 Ga0501044_0058150 3300049823 Bacteria 3966
351 Ga0501045_0001856 3300049824 Bacteria 14297
352 Ga0501045_0006441 3300049824 Bacteria 8133
353 Ga0501045_0085169 3300049824 Bacteria 2332
354 nmdc:mga00v17_25147_c1 3300050491 Bacteria 3459
355 nmdc:mga0k408_7407_c1 3300050493 Bacteria 5860
356 nmdc:mga0qj67_62835_c1 3300050509 Bacteria 2952
357 nmdc:mga06r32_107611_c1 3300050510 Bacteria 2740
358 nmdc:mga06r32_81573_c1 3300050510 Bacteria 3150
359 nmdc:mga08y16_149033_c1 3300050511 Bacteria 2432
360 nmdc:mga08y16_20817_c1 3300050511 Bacteria 6923
361 nmdc:mga0n895_59697_c1 3300050512 Bacteria 3763
362 nmdc:mga0rr50_169357_c1 3300050513 Bacteria 1778
363 nmdc:mga0a205_202447_c1 3300050515 Bacteria 1875
364 nmdc:mga0sz30_9566_c1 3300050516 Bacteria 2959
365 Ga0500607_053359 3300053121 Bacteria 2143
366 Ga0500655_003709 3300053133 Bacteria 2753
367 Ga0500604_0003068 3300053151 Bacteria 4487
368 Ga0500636_0000380 3300053177 Bacteria 24363
369 Ga0500637_0005029 3300053178 Bacteria 6364
370 Ga0500625_012884 3300053729 Bacteria 3832
371 Ga0501084_0012261 3300054114 Bacteria 7098
372 Ga0501084_0014428 3300054114 Bacteria 6548
373 Ga0501082_0042608 3300060353 Bacteria 3913
374 Ga0501082_0188304 3300060353 Bacteria 1795
375 Ga0530510_0000056 3300061734 Bacteria 54243
376 Ga0530510_0001132 3300061734 Bacteria 17734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0078013 Ga0501071_0078013_13_1212 359
2 3300049574 Ga0501038_0198920 Ga0501038_0198920_229_1563 363
3 3300049577 Ga0501041_0127090 Ga0501041_0127090_70_1374 363
4 3300049742 Ga0501080_0014328 Ga0501080_0014328_6031_7290 371
5 3300039062 Ga0400483_250402 Ga0400483_250402_74_1339 376
6 3300044712 Ga0453684_0465946 Ga0453684_0465946_175_1386 381
7 3300035691 Ga0373931_0027613 Ga0373931_0027613_1628_2869 383
8 3300035083 Ga0373926_0052142 Ga0373926_0052142_132_1427 386
9 3300035117 Ga0373953_0012939 Ga0373953_0012939_18_1313 386
10 3300044712 Ga0453684_0171885 Ga0453684_0171885_782_2206 387
11 3300039093 Ga0400489_11495 Ga0400489_11495_32_1324 395
12 3300031616 Ga0307508_10030679 Ga0307508_100306793 397
13 3300042876 Ga0451577_0036909 Ga0451577_0036909_1837_3243 399
14 3300031507 Ga0307509_10000053 Ga0307509_100000534 400
15 3300045051 Ga0451576_0004889 Ga0451576_0004889_8851_10287 402
16 3300035691 Ga0373931_0067562 Ga0373931_0067562_342_1685 404
17 3300045051 Ga0451576_0037753 Ga0451576_0037753_1056_2396 404
18 3300031728 Ga0316578_10035651 Ga0316578_100356512 406
19 3300035398 Ga0316574_0017187 Ga0316574_0017187_2172_3578 406
20 3300042876 Ga0451577_0020022 Ga0451577_0020022_4178_5584 406
21 3300031235 Ga0265330_10029580 Ga0265330_100295803 407
22 3300031344 Ga0265316_10119704 Ga0265316_101197042 407
23 3300044712 Ga0453684_0004425 Ga0453684_0004425_27605_28987 407
24 3300045051 Ga0451576_0039092 Ga0451576_0039092_527_1909 407
25 3300049572 Ga0501036_0091694 Ga0501036_0091694_227_1687 407
26 3300031238 Ga0265332_10003928 Ga0265332_100039282 408
27 3300032133 Ga0316583_10003546 Ga0316583_100035466 409
28 3300042435 Ga0439434_0000276 Ga0439434_0000276_9166_10512 410
29 3300042436 Ga0439435_0001055 Ga0439435_0001055_3431_4777 410
30 3300049579 Ga0501043_0161068 Ga0501043_0161068_31_1476 410
31 3300049584 Ga0501068_0069853 Ga0501068_0069853_364_1839 410
32 3300049741 Ga0501079_0028828 Ga0501079_0028828_2598_4073 410
33 3300049743 Ga0501081_0138290 Ga0501081_0138290_258_1733 410
34 3300049824 Ga0501045_0085169 Ga0501045_0085169_546_1991 410
35 3300049592 Ga0501076_0044472 Ga0501076_0044472_411_1871 411
36 3300031344 Ga0265316_10036020 Ga0265316_100360202 412
37 3300044712 Ga0453684_0025225 Ga0453684_0025225_6449_7789 413
38 3300032133 Ga0316583_10016888 Ga0316583_100168882 416
39 3300035398 Ga0316574_0040308 Ga0316574_0040308_515_1924 416
40 3300036712 Ga0316584_0021625 Ga0316584_0021625_3213_4622 416
41 3300049575 Ga0501039_0014679 Ga0501039_0014679_1558_2892 416
42 3300053729 Ga0500625_012884 Ga0500625_012884_1358_2728 416
43 3300061734 Ga0530510_0000056 Ga0530510_0000056_4661_5995 416
44 3300006846 Ga0075430_100012426 Ga0075430_1000124263 417
45 3300006847 Ga0075431_100118652 Ga0075431_1001186522 417
46 3300031250 Ga0265331_10042786 Ga0265331_100427862 417
47 3300031251 Ga0265327_10017977 Ga0265327_100179773 417
48 3300048918 Ga0496115_0019447 Ga0496115_0019447_150_1532 417
49 3300050509 nmdc:mga0qj67_62835_c1 nmdc:mga0qj67_62835_c1_1123_2475 417
50 3300050510 nmdc:mga06r32_107611_c1 nmdc:mga06r32_107611_c1_874_2226 417
51 3300006844 Ga0075428_100009828 Ga0075428_1000098285 418
52 3300006847 Ga0075431_100017874 Ga0075431_1000178745 418
53 3300009147 Ga0114129_10196387 Ga0114129_101963872 418
54 3300042876 Ga0451577_0057986 Ga0451577_0057986_109_1509 418
55 3300045051 Ga0451576_0000355 Ga0451576_0000355_62133_63560 418
56 3300050510 nmdc:mga06r32_81573_c1 nmdc:mga06r32_81573_c1_828_2171 418
57 3300035398 Ga0316574_0005382 Ga0316574_0005382_3171_4577 419
58 3300005842 Ga0068858_100180861 Ga0068858_1001808612 420
59 3300006237 Ga0097621_100003027 Ga0097621_1000030279 420
60 3300006358 Ga0068871_100003262 Ga0068871_1000032622 420
61 3300014969 Ga0157376_10022832 Ga0157376_100228324 420
62 3300026035 Ga0207703_10138664 Ga0207703_101386642 420
63 3300049776 Ga0501280_000534 Ga0501280_000534_7198_8658 420
64 3300053121 Ga0500607_053359 Ga0500607_053359_51_1421 420
65 3300053177 Ga0500636_0000380 Ga0500636_0000380_9441_10811 420
66 3300053178 Ga0500637_0005029 Ga0500637_0005029_4404_5774 420
67 3300025936 Ga0207670_10165916 Ga0207670_101659162 421
68 3300031665 Ga0316575_10006798 Ga0316575_100067982 421
69 3300031728 Ga0316578_10001403 Ga0316578_100014035 421
70 3300036647 Ga0316582_0000491 Ga0316582_0000491_12293_13801 421
71 3300036647 Ga0316582_0091454 Ga0316582_0091454_196_1602 421
72 3300036712 Ga0316584_0020465 Ga0316584_0020465_1930_3438 421
73 3300045051 Ga0451576_0166463 Ga0451576_0166463_738_2069 421
74 3300049570 Ga0501033_0079766 Ga0501033_0079766_842_2176 421
75 3300049572 Ga0501036_0125327 Ga0501036_0125327_211_1545 421
76 3300049573 Ga0501037_0140129 Ga0501037_0140129_19_1353 421
77 3300049574 Ga0501038_0150128 Ga0501038_0150128_109_1443 421
78 3300049576 Ga0501040_0010624 Ga0501040_0010624_4367_5701 421
79 3300049577 Ga0501041_0007151 Ga0501041_0007151_1472_2806 421
80 3300049582 Ga0501048_0022773 Ga0501048_0022773_295_1629 421
81 3300049587 Ga0501071_0008223 Ga0501071_0008223_2848_4182 421
82 3300049587 Ga0501071_0041324 Ga0501071_0041324_916_2268 421
83 3300049588 Ga0501072_0001920 Ga0501072_0001920_6379_7713 421
84 3300049591 Ga0501075_0020355 Ga0501075_0020355_3103_4437 421
85 3300049742 Ga0501080_0053756 Ga0501080_0053756_2264_3616 421
86 3300049743 Ga0501081_0000777 Ga0501081_0000777_2553_3887 421
87 3300050511 nmdc:mga08y16_149033_c1 nmdc:mga08y16_149033_c1_905_2248 421
88 3300054114 Ga0501084_0012261 Ga0501084_0012261_2151_3485 421
89 3300006195 Ga0075366_10087999 Ga0075366_100879991 422
90 3300038741 Ga0400488_44659 Ga0400488_44659_389_1801 422
91 3300046529 Ga0495652_0029485 Ga0495652_0029485_3467_4804 422
92 iso_pu_bacteria 2989392574 2989395962 422
93 3300036401 Ga0373937_0120471 Ga0373937_0120471_897_2243 423
94 3300038725 Ga0400484_19659 Ga0400484_19659_8382_9779 423
95 3300039062 Ga0400483_077120 Ga0400483_077120_325_1737 423
96 3300045051 Ga0451576_0000234 Ga0451576_0000234_82235_83572 423
97 3300031250 Ga0265331_10007393 Ga0265331_100073933 424
98 3300031665 Ga0316575_10022964 Ga0316575_100229642 424
99 3300031691 Ga0316579_10008809 Ga0316579_100088092 424
100 3300031733 Ga0316577_10010482 Ga0316577_100104823 424
101 3300036712 Ga0316584_0011625 Ga0316584_0011625_4103_5515 424
102 3300037588 Ga0316581_0007157 Ga0316581_0007157_1396_2808 424
103 3300038725 Ga0400484_34275 Ga0400484_34275_2296_3693 424
104 3300044712 Ga0453684_0003047 Ga0453684_0003047_16542_17879 424
105 3300044712 Ga0453684_0300757 Ga0453684_0300757_202_1542 424
106 3300045051 Ga0451576_0054595 Ga0451576_0054595_2630_3967 424
107 iso_pu_bacteria 8001522603 8001524252 424
108 3300006852 Ga0075433_10206446 Ga0075433_102064462 425
109 3300009094 Ga0111539_10044603 Ga0111539_100446034 425
110 3300027907 Ga0207428_10077987 Ga0207428_100779872 425
111 3300046454 Ga0495592_0002686 Ga0495592_0002686_9999_11375 425
112 3300046516 Ga0495628_0007077 Ga0495628_0007077_6100_7476 425
113 3300046529 Ga0495652_0001265 Ga0495652_0001265_7886_9262 425
114 3300046543 Ga0495645_0000794 Ga0495645_0000794_5092_6468 425
115 3300046678 Ga0495599_0005019 Ga0495599_0005019_1511_2887 425
116 3300050511 nmdc:mga08y16_20817_c1 nmdc:mga08y16_20817_c1_2726_4084 425
117 3300050515 nmdc:mga0a205_202447_c1 nmdc:mga0a205_202447_c1_251_1609 425
118 3300050513 nmdc:mga0rr50_169357_c1 nmdc:mga0rr50_169357_c1_334_1725 426
119 3300030521 Ga0307511_10000510 Ga0307511_1000051030 427
120 3300049586 Ga0501070_0027884 Ga0501070_0027884_186_1652 427
121 3300049742 Ga0501080_0052302 Ga0501080_0052302_587_2053 427
122 3300053133 Ga0500655_003709 Ga0500655_003709_585_2066 427
123 3300053151 Ga0500604_0003068 Ga0500604_0003068_2530_4011 427
124 iso_pu_bacteria 2574179768 2574431806 428
125 3300031251 Ga0265327_10007378 Ga0265327_100073785 429
126 3300031344 Ga0265316_10018691 Ga0265316_100186915 429
127 3300031727 Ga0316576_10007869 Ga0316576_100078694 429
128 3300036712 Ga0316584_0061816 Ga0316584_0061816_1114_2496 429
129 3300049582 Ga0501048_0022198 Ga0501048_0022198_1898_3331 429
130 3300049588 Ga0501072_0009790 Ga0501072_0009790_2002_3435 429
131 3300049591 Ga0501075_0008175 Ga0501075_0008175_3831_5264 429
132 3300049592 Ga0501076_0005303 Ga0501076_0005303_5907_7340 429
133 3300049592 Ga0501076_0155039 Ga0501076_0155039_368_1807 429
134 3300049741 Ga0501079_0045359 Ga0501079_0045359_45_1478 429
135 3300049824 Ga0501045_0001856 Ga0501045_0001856_1348_2781 429
136 3300054114 Ga0501084_0014428 Ga0501084_0014428_1870_3303 429
137 3300060353 Ga0501082_0042608 Ga0501082_0042608_1299_2732 429
138 3300061734 Ga0530510_0001132 Ga0530510_0001132_10611_12044 429
139 iso_pu_bacteria 2526164512 2526212891 429
140 iso_pu_bacteria 2891633521 2891634490 429
141 3300005364 Ga0070673_100068557 Ga0070673_1000685572 430
142 3300005841 Ga0068863_100021194 Ga0068863_1000211943 430
143 3300005842 Ga0068858_100069272 Ga0068858_1000692722 430
144 3300009176 Ga0105242_10050990 Ga0105242_100509902 430
145 3300009177 Ga0105248_10028545 Ga0105248_100285452 430
146 3300011119 Ga0105246_10030495 Ga0105246_100304952 430
147 3300013296 Ga0157374_10099791 Ga0157374_100997913 430
148 3300013308 Ga0157375_10062515 Ga0157375_100625153 430
149 3300025941 Ga0207711_10073670 Ga0207711_100736702 430
150 3300026118 Ga0207675_100016032 Ga0207675_1000160323 430
151 3300031727 Ga0316576_10020028 Ga0316576_100200283 430
152 3300031727 Ga0316576_10022968 Ga0316576_100229683 430
153 3300031728 Ga0316578_10024002 Ga0316578_100240023 430
154 3300035398 Ga0316574_0002375 Ga0316574_0002375_3728_5098 430
155 3300035398 Ga0316574_0007575 Ga0316574_0007575_4435_5811 430
156 3300039062 Ga0400483_165139 Ga0400483_165139_835_2244 430
157 iso_pu_bacteria 639633007 639786714 430
158 3300006178 Ga0075367_10001531 Ga0075367_100015315 431
159 3300006186 Ga0075369_10014583 Ga0075369_100145832 431
160 3300035111 Ga0373923_0044008 Ga0373923_0044008_357_1787 431
161 3300035119 Ga0373956_0059282 Ga0373956_0059282_89_1519 431
162 3300035172 Ga0373955_0065176 Ga0373955_0065176_221_1651 431
163 3300035398 Ga0316574_0101935 Ga0316574_0101935_23_1423 431
164 3300035692 Ga0373935_0003537 Ga0373935_0003537_1354_2700 431
165 3300035695 Ga0373927_0038700 Ga0373927_0038700_1270_2700 431
166 3300035724 Ga0373933_0017664 Ga0373933_0017664_943_2373 431
167 3300036401 Ga0373937_0336855 Ga0373937_0336855_44_1408 431
168 3300036647 Ga0316582_0004601 Ga0316582_0004601_442_1938 431
169 3300036712 Ga0316584_0003511 Ga0316584_0003511_6509_8005 431
170 3300046454 Ga0495592_0030149 Ga0495592_0030149_2361_3791 431
171 3300046454 Ga0495592_0039501 Ga0495592_0039501_314_1678 431
172 3300046476 Ga0495662_0015680 Ga0495662_0015680_2035_3399 431
173 3300046511 Ga0495608_0002518 Ga0495608_0002518_6222_7586 431
174 3300046516 Ga0495628_0005649 Ga0495628_0005649_3674_5038 431
175 3300046516 Ga0495628_0076609 Ga0495628_0076609_315_1745 431
176 3300046517 Ga0495630_0046012 Ga0495630_0046012_414_1844 431
177 3300046526 Ga0495666_0009140 Ga0495666_0009140_85_1515 431
178 3300046526 Ga0495666_0045026 Ga0495666_0045026_546_1910 431
179 3300046529 Ga0495652_0057351 Ga0495652_0057351_1798_3228 431
180 3300046533 Ga0495640_0013095 Ga0495640_0013095_4899_6263 431
181 3300046536 Ga0495587_0013214 Ga0495587_0013214_539_1903 431
182 3300046543 Ga0495645_0067620 Ga0495645_0067620_324_1688 431
183 3300046642 Ga0495634_0011522 Ga0495634_0011522_199_1629 431
184 3300046678 Ga0495599_0004390 Ga0495599_0004390_5939_7303 431
185 3300046683 Ga0495658_0006299 Ga0495658_0006299_1183_2547 431
186 3300046683 Ga0495658_0071185 Ga0495658_0071185_347_1777 431
187 3300046689 Ga0495613_0006340 Ga0495613_0006340_7430_8794 431
188 3300046809 Ga0495600_0007156 Ga0495600_0007156_3016_4446 431
189 3300047317 Ga0495604_0013866 Ga0495604_0013866_4831_6195 431
190 3300047319 Ga0495674_0004132 Ga0495674_0004132_11154_12584 431
191 3300047322 Ga0495680_0035025 Ga0495680_0035025_989_2419 431
192 3300047444 Ga0495675_0034402 Ga0495675_0034402_262_1692 431
193 3300047471 Ga0495684_0098173 Ga0495684_0098173_119_1483 431
194 3300050491 nmdc:mga00v17_25147_c1 nmdc:mga00v17_25147_c1_1540_3006 431
195 3300050493 nmdc:mga0k408_7407_c1 nmdc:mga0k408_7407_c1_1196_2662 431
196 3300050516 nmdc:mga0sz30_9566_c1 nmdc:mga0sz30_9566_c1_1125_2591 431
197 3300007265 Ga0099794_10023422 Ga0099794_100234222 432
198 3300031665 Ga0316575_10000029 Ga0316575_1000002925 432
199 3300005337 Ga0070682_100127626 Ga0070682_1001276261 433
200 3300025919 Ga0207657_10186046 Ga0207657_101860462 433
201 3300031691 Ga0316579_10009615 Ga0316579_100096152 433
202 3300031727 Ga0316576_10057468 Ga0316576_100574682 433
203 3300031728 Ga0316578_10010460 Ga0316578_100104603 433
204 3300031728 Ga0316578_10019721 Ga0316578_100197212 433
205 3300031728 Ga0316578_10023058 Ga0316578_100230583 433
206 3300031733 Ga0316577_10010359 Ga0316577_100103593 433
207 3300031733 Ga0316577_10025418 Ga0316577_100254183 433
208 3300032133 Ga0316583_10034653 Ga0316583_100346532 433
209 3300032137 Ga0316585_10001261 Ga0316585_100012613 433
210 3300032137 Ga0316585_10021846 Ga0316585_100218462 433
211 3300032139 Ga0316580_10000472 Ga0316580_100004723 433
212 3300032139 Ga0316580_10016794 Ga0316580_100167942 433
213 3300033524 Ga0316592_1002048 Ga0316592_10020482 433
214 3300033541 Ga0316596_1002776 Ga0316596_10027762 433
215 3300035398 Ga0316574_0008701 Ga0316574_0008701_2270_3673 433
216 3300035398 Ga0316574_0025765 Ga0316574_0025765_1904_3319 433
217 3300035398 Ga0316574_0029063 Ga0316574_0029063_1609_3039 433
218 3300035398 Ga0316574_0031815 Ga0316574_0031815_1337_2803 433
219 3300036712 Ga0316584_0007500 Ga0316584_0007500_2983_4449 433
220 3300036712 Ga0316584_0071541 Ga0316584_0071541_974_2389 433
221 3300038725 Ga0400484_07117 Ga0400484_07117_2845_4257 433
222 3300038725 Ga0400484_44267 Ga0400484_44267_582_1994 433
223 3300038726 Ga0400490_29076 Ga0400490_29076_15433_16845 433
224 3300038726 Ga0400490_37773 Ga0400490_37773_8970_10382 433
225 3300038726 Ga0400490_40843 Ga0400490_40843_3930_5327 433
226 3300038726 Ga0400490_55945 Ga0400490_55945_4076_5488 433
227 3300038735 Ga0400485_03865 Ga0400485_03865_561_1973 433
228 3300038735 Ga0400485_03895 Ga0400485_03895_1764_3176 433
229 3300038741 Ga0400488_15820 Ga0400488_15820_3201_4613 433
230 3300038742 Ga0400486_17090 Ga0400486_17090_6234_7646 433
231 3300039062 Ga0400483_111451 Ga0400483_111451_1862_3274 433
232 3300039062 Ga0400483_142061 Ga0400483_142061_327_1739 433
233 3300039062 Ga0400483_215310 Ga0400483_215310_421_1833 433
234 3300039093 Ga0400489_11716 Ga0400489_11716_3307_4719 433
235 3300049572 Ga0501036_0044021 Ga0501036_0044021_30_1478 433
236 3300031727 Ga0316576_10003806 Ga0316576_100038064 434
237 3300031727 Ga0316576_10084121 Ga0316576_100841212 434
238 3300031728 Ga0316578_10002498 Ga0316578_100024985 434
239 3300032133 Ga0316583_10028791 Ga0316583_100287912 434
240 3300025933 Ga0207706_10018338 Ga0207706_100183383 435
241 3300031691 Ga0316579_10000067 Ga0316579_1000006718 435
242 3300031691 Ga0316579_10010830 Ga0316579_100108302 435
243 3300031728 Ga0316578_10006954 Ga0316578_100069544 435
244 3300031728 Ga0316578_10015946 Ga0316578_100159463 435
245 3300032137 Ga0316585_10007766 Ga0316585_100077662 435
246 3300035398 Ga0316574_0012206 Ga0316574_0012206_889_2301 435
247 3300036647 Ga0316582_0001355 Ga0316582_0001355_6656_8068 435
248 3300036647 Ga0316582_0002944 Ga0316582_0002944_348_1760 435
249 3300036647 Ga0316582_0027256 Ga0316582_0027256_20_1432 435
250 3300036647 Ga0316582_0038250 Ga0316582_0038250_1312_2724 435
251 3300036712 Ga0316584_0000296 Ga0316584_0000296_7721_9133 435
252 3300036712 Ga0316584_0022744 Ga0316584_0022744_366_1778 435
253 3300049571 Ga0501034_0004664 Ga0501034_0004664_6465_7967 435
254 3300049573 Ga0501037_0071455 Ga0501037_0071455_251_1753 435
255 3300049574 Ga0501038_0001990 Ga0501038_0001990_12500_14002 435
256 3300049579 Ga0501043_0001529 Ga0501043_0001529_15967_17469 435
257 3300049583 Ga0501067_0041114 Ga0501067_0041114_437_1939 435
258 3300049584 Ga0501068_0034572 Ga0501068_0034572_1319_2821 435
259 3300049589 Ga0501073_0009039 Ga0501073_0009039_1640_3142 435
260 3300049742 Ga0501080_0002738 Ga0501080_0002738_8617_10119 435
261 3300049822 Ga0501035_0008565 Ga0501035_0008565_3533_5035 435
262 3300060353 Ga0501082_0188304 Ga0501082_0188304_278_1780 435
263 3300031665 Ga0316575_10001617 Ga0316575_100016175 436
264 3300031691 Ga0316579_10000051 Ga0316579_1000005121 436
265 3300031691 Ga0316579_10033632 Ga0316579_100336322 436
266 3300031727 Ga0316576_10001846 Ga0316576_100018464 436
267 3300031727 Ga0316576_10007517 Ga0316576_100075172 436
268 3300031727 Ga0316576_10009714 Ga0316576_100097143 436
269 3300031728 Ga0316578_10000266 Ga0316578_1000026612 436
270 3300031728 Ga0316578_10000289 Ga0316578_100002892 436
271 3300031728 Ga0316578_10000612 Ga0316578_1000061211 436
272 3300031733 Ga0316577_10000110 Ga0316577_1000011017 436
273 3300032137 Ga0316585_10000748 Ga0316585_100007483 436
274 3300032139 Ga0316580_10000061 Ga0316580_100000613 436
275 3300035398 Ga0316574_0000013 Ga0316574_0000013_39281_40693 436
276 3300036647 Ga0316582_0000035 Ga0316582_0000035_1628_3040 436
277 3300036712 Ga0316584_0001072 Ga0316584_0001072_3155_4573 436
278 3300036712 Ga0316584_0004970 Ga0316584_0004970_1083_2495 436
279 3300050512 nmdc:mga0n895_59697_c1 nmdc:mga0n895_59697_c1_905_2269 436
280 3300035086 Ga0373934_0010768 Ga0373934_0010768_1048_2454 437
281 3300035119 Ga0373956_0000078 Ga0373956_0000078_9050_10456 437
282 3300035724 Ga0373933_0000380 Ga0373933_0000380_20962_22368 437
283 3300036401 Ga0373937_0000480 Ga0373937_0000480_26117_27523 437
284 3300046462 Ga0495651_0005200 Ga0495651_0005200_7404_8810 437
285 3300049571 Ga0501034_0057296 Ga0501034_0057296_1756_3204 439
286 3300049741 Ga0501079_0183377 Ga0501079_0183377_114_1574 439
287 3300049569 Ga0501032_0000835 Ga0501032_0000835_7570_9084 441
288 3300005458 Ga0070681_10110397 Ga0070681_101103971 442
289 3300049571 Ga0501034_0168096 Ga0501034_0168096_286_1746 442
290 3300005458 Ga0070681_10006469 Ga0070681_100064692 444
291 3300005539 Ga0068853_100012582 Ga0068853_1000125822 444
292 3300009545 Ga0105237_10027751 Ga0105237_100277515 444
293 3300025912 Ga0207707_10055084 Ga0207707_100550842 444
294 3300026041 Ga0207639_10026232 Ga0207639_100262323 444
295 3300028577 Ga0265318_10002903 Ga0265318_100029034 444
296 3300031238 Ga0265332_10001562 Ga0265332_100015628 444
297 3300031239 Ga0265328_10004543 Ga0265328_100045434 444
298 3300005330 Ga0070690_100002477 Ga0070690_1000024772 445
299 3300005441 Ga0070700_100003024 Ga0070700_1000030243 445
300 3300005456 Ga0070678_100012558 Ga0070678_1000125583 445
301 3300005545 Ga0070695_100106019 Ga0070695_1001060192 445
302 3300005546 Ga0070696_100010180 Ga0070696_1000101804 445
303 3300005546 Ga0070696_100041807 Ga0070696_1000418072 445
304 3300005615 Ga0070702_100000808 Ga0070702_1000008084 445
305 3300005718 Ga0068866_10000471 Ga0068866_100004713 445
306 3300005719 Ga0068861_100003436 Ga0068861_1000034363 445
307 3300005842 Ga0068858_100030761 Ga0068858_1000307612 445
308 3300005844 Ga0068862_100007551 Ga0068862_1000075513 445
309 3300006358 Ga0068871_100002002 Ga0068871_1000020027 445
310 3300009098 Ga0105245_10004511 Ga0105245_100045115 445
311 3300009148 Ga0105243_10003077 Ga0105243_100030779 445
312 3300009176 Ga0105242_10003293 Ga0105242_1000329310 445
313 3300009177 Ga0105248_10139645 Ga0105248_101396452 445
314 3300009553 Ga0105249_10017349 Ga0105249_100173493 445
315 3300013297 Ga0157378_10002881 Ga0157378_1000288110 445
316 3300013308 Ga0157375_10058048 Ga0157375_100580482 445
317 3300014326 Ga0157380_10150491 Ga0157380_101504912 445
318 3300025934 Ga0207686_10013949 Ga0207686_100139492 445
319 3300025936 Ga0207670_10008774 Ga0207670_100087742 445
320 3300025942 Ga0207689_10001033 Ga0207689_100010336 445
321 3300026075 Ga0207708_10000335 Ga0207708_1000033519 445
322 3300026089 Ga0207648_10001298 Ga0207648_1000129813 445
323 3300026118 Ga0207675_100003006 Ga0207675_10000300610 445
324 3300026121 Ga0207683_10014771 Ga0207683_100147713 445
325 3300048911 Ga0496108_0227318 Ga0496108_0227318_68_1537 445
326 3300049571 Ga0501034_0001115 Ga0501034_0001115_10667_12124 445
327 3300049584 Ga0501068_0002049 Ga0501068_0002049_421_1887 445
328 3300049586 Ga0501070_0119689 Ga0501070_0119689_683_2149 445
329 3300049588 Ga0501072_0013634 Ga0501072_0013634_4139_5596 445
330 3300049743 Ga0501081_0029686 Ga0501081_0029686_439_1923 445
331 3300005329 Ga0070683_100040621 Ga0070683_1000406213 446
332 3300005339 Ga0070660_100184232 Ga0070660_1001842322 446
333 3300005535 Ga0070684_100173779 Ga0070684_1001737791 446
334 3300005614 Ga0068856_100050365 Ga0068856_1000503652 446
335 3300009551 Ga0105238_10021554 Ga0105238_100215543 446
336 3300013104 Ga0157370_10011956 Ga0157370_100119566 446
337 3300013307 Ga0157372_10043527 Ga0157372_100435271 446
338 3300014969 Ga0157376_10021331 Ga0157376_100213312 446
339 3300025914 Ga0207671_10026853 Ga0207671_100268533 446
340 3300027876 Ga0209974_10007299 Ga0209974_100072992 446
341 3300031242 Ga0265329_10006847 Ga0265329_100068473 446
342 3300031711 Ga0265314_10000245 Ga0265314_100002451 446
343 3300048911 Ga0496108_0004104 Ga0496108_0004104_2040_3548 446
344 3300048912 Ga0496109_0042841 Ga0496109_0042841_650_2158 446
345 3300048915 Ga0496112_0213426 Ga0496112_0213426_47_1552 446
346 3300048917 Ga0496114_0001834 Ga0496114_0001834_12281_13789 446
347 3300048917 Ga0496114_0011859 Ga0496114_0011859_620_2098 446
348 3300049568 Ga0501031_0015722 Ga0501031_0015722_1036_2523 446
349 3300049568 Ga0501031_0022743 Ga0501031_0022743_2396_3883 446
350 3300049569 Ga0501032_0000464 Ga0501032_0000464_21916_23403 446
351 3300049569 Ga0501032_0016930 Ga0501032_0016930_2511_3998 446
352 3300049569 Ga0501032_0024813 Ga0501032_0024813_1077_2609 446
353 3300049570 Ga0501033_0001142 Ga0501033_0001142_9111_10598 446
354 3300049570 Ga0501033_0002593 Ga0501033_0002593_7585_9072 446
355 3300049570 Ga0501033_0006581 Ga0501033_0006581_664_2151 446
356 3300049571 Ga0501034_0013615 Ga0501034_0013615_6091_7578 446
357 3300049571 Ga0501034_0046949 Ga0501034_0046949_2751_4283 446
358 3300049572 Ga0501036_0002335 Ga0501036_0002335_9195_10682 446
359 3300049572 Ga0501036_0026680 Ga0501036_0026680_1088_2575 446
360 3300049572 Ga0501036_0160066 Ga0501036_0160066_395_1882 446
361 3300049573 Ga0501037_0028650 Ga0501037_0028650_2109_3596 446
362 3300049574 Ga0501038_0000689 Ga0501038_0000689_19465_20952 446
363 3300049574 Ga0501038_0005128 Ga0501038_0005128_9195_10682 446
364 3300049574 Ga0501038_0008506 Ga0501038_0008506_5914_7401 446
365 3300049576 Ga0501040_0002441 Ga0501040_0002441_9271_10758 446
366 3300049578 Ga0501042_0009087 Ga0501042_0009087_3906_5393 446
367 3300049579 Ga0501043_0005791 Ga0501043_0005791_5374_6861 446
368 3300049579 Ga0501043_0029493 Ga0501043_0029493_2321_3808 446
369 3300049580 Ga0501046_0018687 Ga0501046_0018687_3193_4680 446
370 3300049580 Ga0501046_0026490 Ga0501046_0026490_1609_3096 446
371 3300049581 Ga0501047_0051384 Ga0501047_0051384_2200_3687 446
372 3300049582 Ga0501048_0010308 Ga0501048_0010308_4554_6041 446
373 3300049584 Ga0501068_0006722 Ga0501068_0006722_1867_3354 446
374 3300049822 Ga0501035_0002349 Ga0501035_0002349_9046_10533 446
375 3300049822 Ga0501035_0006358 Ga0501035_0006358_9342_10829 446
376 3300049822 Ga0501035_0013972 Ga0501035_0013972_1878_3365 446
377 3300049822 Ga0501035_0035240 Ga0501035_0035240_1589_3076 446
378 3300049823 Ga0501044_0003017 Ga0501044_0003017_9598_11085 446
379 3300049823 Ga0501044_0015854 Ga0501044_0015854_5617_7104 446
380 3300049823 Ga0501044_0029823 Ga0501044_0029823_1081_2568 446
381 3300049823 Ga0501044_0058150 Ga0501044_0058150_1014_2501 446
382 3300049824 Ga0501045_0006441 Ga0501045_0006441_1983_3470 446

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

265

470

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.766 203 429
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7625 204 429
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7582 203 429
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.747 203 429
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7405 204 429
ID Description Score Start End Superfamily
af_Q2FZQ8_74_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9054 204 426 1.10.3720.10
af_Q2FZQ8_74_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8935 204 426 1.10.3720.10
af_Q2FZR6_145_349_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8901 202 426 1.10.3720.10
af_Q2FZR6_145_349_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8819 202 426 1.10.3720.10
af_P33915_131_335_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8654 202 427 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A257W6A0-F1-model_v4 deleted 0.9277 195 403
AF-A0A359GW25-F1-model_v4 Peptide ABC transporter 0.9261 192 394 GO:0005886
GO:0055085
AF-A0A3C1LS47-F1-model_v4 ABC transporter permease 0.9225 193 432 GO:0005886
GO:0015031
GO:0015833
GO:0055085
AF-A0A6S6SIA8-F1-model_v4 Oligopeptide transport system permease protein 0.9164 4 431 GO:0005886
GO:0055085
AF-A0A7C5BCW0-F1-model_v4 ABC transporter permease 0.9158 192 402 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
80.64 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map