F429433

General Info

Members Datasets Scaffolds Average Seq Length
382 343 764 263

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_66757_c1|nmdc:mga03683_66757_c1_496_1431
Length 311
Sequence MLPETARAIAMRAKFGSPGTMVLKSRIALALAAIMLMPVTQASSADYDPPIYVDQAPDYVPVEVGSGWYLRGDIGYAFSHPFDHEETPAGFTSKSSLFDGSVGMGYHFNDYLRAELNFGILPTNRFGDNFITTCDGSITTTVTNVATGTLVSQTNAPASAPCNGSNIANNKAYSLMANGYIDLGTYVGLTPYIGGGLGVVYSKYNRAIGQRDCAETTTTNTAGGFQTVDQFNCDDPAGYAGAVASKGSYDLAYALAAGVSYQVTKNVSVDLGYEYFAIPDAEYVAYDGGAFNIHKGVDYQSVKVGLRYDLW

Samples

Sample ID Description Type Environment
1 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
36 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
37 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
39 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
40 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
58 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
59 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
60 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
61 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
62 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
63 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
64 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
65 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
66 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
67 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
68 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
69 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
70 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
92 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
93 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
94 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
95 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
96 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
97 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
98 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
99 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
100 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
101 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
102 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
103 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
104 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
105 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
106 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
107 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
108 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
109 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
110 2512875024
111 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
112 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
113 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
114 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
115 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
116 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
117 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
118 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
119 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
120 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
121 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
122 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
123 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
124 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
125 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
126 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
127 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
128 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
129 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
130 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
131 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
132 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
133 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
134 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
135 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
136 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
137 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
138 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
139 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
140 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
141 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
142 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
143 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
144 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
145 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
146 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
147 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
148 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
149 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
150 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
151 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
152 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
153 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
154 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
155 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
156 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
157 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
158 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
159 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
160 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
161 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
162 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
163 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
164 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
165 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
166 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
167 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
168 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
169 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
170 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
171 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
172 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
173 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
174 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
175 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
176 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
177 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
178 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
179 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
180 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
181 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
182 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
183 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
184 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
185 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
186 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
187 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
188 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
189 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
190 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
191 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
192 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
193 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
194 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
195 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
196 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
197 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
198 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
199 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
200 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
201 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
202 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
203 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
204 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
205 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
206 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
207 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
208 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
209 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
210 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
211 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
212 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
213 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
214 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
215 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
216 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
217 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
218 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
219 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
220 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
221 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
222 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
223 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
224 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
225 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
226 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
227 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
228 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
229 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
230 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
231 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
232 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
233 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
234 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
235 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
236 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
237 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
238 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
239 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
240 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
241 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
242 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
243 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
244 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
245 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
246 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
247 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
248 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
249 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
250 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
251 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
252 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
253 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
254 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
255 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
256 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
257 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
258 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
259 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
260 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
261 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
262 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
263 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
264 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
265 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
266 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
267 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
268 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
269 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
270 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
271 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
272 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
273 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
274 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
275 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
276 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
277 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
278 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
279 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
280 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
281 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
282 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
283 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
284 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
285 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
286 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
287 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
288 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
289 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
290 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
291 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
292 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
293 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
294 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
295 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
296 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
297 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
298 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
299 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
300 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
301 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
302 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
303 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
304 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
305 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
306 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
307 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
308 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
309 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
310 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
311 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
312 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
313 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
314 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
315 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
316 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
317 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
318 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
319 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
320 3004167301 Mesorhizobium loti 582 Isolate Unclassified
321 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
322 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
323 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
324 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
325 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
326 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
327 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
328 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
329 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
330 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
331 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
332 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
333 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
334 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
335 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
336 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
337 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
338 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
339 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
340 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
341 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
342 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
343 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.91
Metatranscriptomes 0
Isolates 63.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 55.76
Rhizoplane 0.52
Rhizosphere 24.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03683_66757_c1 3300050489 Bacteria 1530
2 JGI24740J21852_10003604 3300001979 Bacteria 6755
3 JGI24739J22299_10017596 3300001989 Bacteria 2576
4 JGI25156J39149_1007667 3300002705 Bacteria 2805
5 JGI25157J39369_1001448 3300002741 Bacteria 8889
6 JGI25406J46586_10061082 3300003203 Bacteria 1217
7 JGI25165J46597_1000026 3300003214 Bacteria 332550
8 rootL2_10099317 3300003322 Bacteria 1912
9 Ga0055529_1003379 3300003763 Bacteria 2666
10 Ga0068853_100005573 3300005539 Bacteria 9883
11 Ga0070665_100026133 3300005548 Bacteria 5879
12 Ga0068857_100235403 3300005577 Bacteria 1675
13 Ga0081539_10000942 3300005985 Bacteria 54492
14 Ga0075365_10012502 3300006038 Bacteria 5045
15 Ga0075365_10061973 3300006038 Bacteria 2500
16 Ga0075368_10004616 3300006042 Bacteria 4683
17 Ga0075368_10055858 3300006042 Bacteria 1574
18 Ga0075363_100029077 3300006048 Bacteria 2850
19 Ga0075364_10155647 3300006051 Bacteria 1541
20 Ga0075364_10335106 3300006051 Bacteria 1031
21 Ga0075362_10061950 3300006177 Bacteria 1694
22 Ga0075367_10021000 3300006178 Bacteria 3644
23 Ga0075369_10007441 3300006186 Bacteria 4169
24 Ga0075370_10027685 3300006353 Bacteria 3147
25 Ga0075370_10047155 3300006353 Bacteria 2439
26 Ga0105240_10595571 3300009093 Bacteria 1218
27 Ga0105240_10609814 3300009093 Bacteria 1201
28 Ga0105240_10843439 3300009093 Bacteria 990
29 Ga0105245_10256415 3300009098 Bacteria 1701
30 Ga0105241_10042465 3300009174 Bacteria 3440
31 Ga0105241_10304481 3300009174 Bacteria 1369
32 Ga0105241_10432221 3300009174 Bacteria 1161
33 Ga0105248_10261947 3300009177 Bacteria 1946
34 Ga0105237_10145182 3300009545 Bacteria 2367
35 Ga0105237_10436773 3300009545 Bacteria 1315
36 Ga0105238_10117090 3300009551 Bacteria 2644
37 Ga0105238_10482920 3300009551 Bacteria 1238
38 Ga0105239_10064654 3300010375 Bacteria 4016
39 Ga0105239_10201106 3300010375 Bacteria 2232
40 Ga0105239_10219243 3300010375 Bacteria 2133
41 Ga0105239_10350182 3300010375 Bacteria 1667
42 Ga0105239_10513144 3300010375 Bacteria 1363
43 Ga0105239_10520277 3300010375 Bacteria 1353
44 Ga0157370_10332364 3300013104 Bacteria 1401
45 Ga0157369_10252622 3300013105 Bacteria 1840
46 Ga0157374_10093502 3300013296 Bacteria 2871
47 Ga0157378_10591581 3300013297 Bacteria 1120
48 Ga0182007_10040781 3300015262 Bacteria 1549
49 Ga0163161_10309379 3300017792 Bacteria 1246
50 Ga0209646_1004408 3300025246 Bacteria 2570
51 Ga0209026_1000041 3300025250 Bacteria 275745
52 Ga0209148_1000317 3300025254 Bacteria 67724
53 Ga0209759_1000168 3300025256 Bacteria 111106
54 Ga0209233_1000030 3300025261 Bacteria 636702
55 Ga0209233_1009921 3300025261 Bacteria 2876
56 Ga0209455_1000152 3300025272 Bacteria 125942
57 Ga0207647_10077348 3300025904 Bacteria 2000
58 Ga0207654_10089343 3300025911 Bacteria 1874
59 Ga0207695_10215066 3300025913 Bacteria 1831
60 Ga0207695_10604213 3300025913 Bacteria 978
61 Ga0207671_10169653 3300025914 Bacteria 1694
62 Ga0207671_10460607 3300025914 Bacteria 1013
63 Ga0207657_10143225 3300025919 Bacteria 1951
64 Ga0207694_10060112 3300025924 Bacteria 2957
65 Ga0207694_10133637 3300025924 Bacteria 1990
66 Ga0207694_10146610 3300025924 Bacteria 1900
67 Ga0207667_10776231 3300025949 Bacteria 956
68 Ga0207640_10031859 3300025981 Bacteria 3264
69 Ga0207640_10380112 3300025981 Bacteria 1144
70 Ga0207639_10039364 3300026041 Bacteria 3522
71 Ga0268266_10057176 3300028379 Bacteria 3356
72 Ga0307408_100211708 3300031548 Bacteria 1576
73 Ga0307412_10097249 3300031911 Bacteria 2074
74 Ga0307416_100153235 3300032002 Bacteria 2118
75 Ga0395900_0551263 3300037418 Bacteria 1097
76 Ga0395905_0140673 3300037471 Bacteria 2270
77 Ga0395905_0213926 3300037471 Bacteria 1805
78 Ga0395905_0468290 3300037471 Bacteria 1159
79 Ga0395901_0094265 3300038443 Bacteria 3136
80 Ga0395901_0365092 3300038443 Bacteria 1488
81 Ga0439465_0055558 3300041413 Bacteria 1304
82 Ga0439465_0100888 3300041413 Bacteria 996
83 Ga0451853_3667098 3300041512 Bacteria 1468
84 Ga0466972_0122321 3300044658 Bacteria 1227
85 Ga0495638_0021974 3300046460 Bacteria 4193
86 Ga0495638_0081126 3300046460 Bacteria 1970
87 Ga0495638_0124720 3300046460 Bacteria 1519
88 Ga0495637_0065701 3300046520 Bacteria 1476
89 Ga0495597_0174986 3300046542 Bacteria 870
90 Ga0495668_0029902 3300046616 Bacteria 3078
91 Ga0495668_0159567 3300046616 Bacteria 1235
92 Ga0495625_0017318 3300046660 Bacteria 5644
93 Ga0496112_0184396 3300048915 Bacteria 2050
94 Ga0496119_0034000 3300048922 Bacteria 3367
95 Ga0496120_0021509 3300048923 Bacteria 4076
96 Ga0496125_0138171 3300048928 Bacteria 1700
97 Ga0496126_0488899 3300048929 Bacteria 985
98 Ga0501031_0008821 3300049568 Bacteria 6555
99 Ga0501032_0021313 3300049569 Bacteria 4506
100 Ga0501033_0008246 3300049570 Bacteria 8065
101 Ga0501034_0006012 3300049571 Bacteria 13124
102 Ga0501036_0108252 3300049572 Bacteria 2349
103 Ga0501037_0013983 3300049573 Bacteria 5914
104 Ga0501038_0014007 3300049574 Bacteria 7308
105 Ga0501039_0004436 3300049575 Bacteria 10593
106 Ga0501042_0005414 3300049578 Bacteria 8219
107 Ga0501043_0012320 3300049579 Bacteria 6685
108 Ga0501046_0003164 3300049580 Bacteria 15202
109 Ga0501047_0008236 3300049581 Bacteria 9839
110 Ga0501047_0235199 3300049581 Bacteria 1684
111 Ga0501048_0003241 3300049582 Bacteria 12396
112 Ga0501068_0008675 3300049584 Bacteria 5668
113 Ga0501070_0006094 3300049586 Bacteria 10273
114 Ga0501071_0460860 3300049587 Bacteria 973
115 Ga0501073_0006851 3300049589 Bacteria 8474
116 Ga0501079_0456459 3300049741 Bacteria 1003
117 Ga0501080_0048887 3300049742 Bacteria 3935
118 Ga0501035_0029422 3300049822 Bacteria 5008
119 Ga0501035_0125758 3300049822 Bacteria 2238
120 Ga0501044_0009588 3300049823 Bacteria 10534
121 Ga0501045_0021146 3300049824 Bacteria 4652
122 nmdc:mga03n38_114483_c1 3300050490 Bacteria 1318
123 nmdc:mga03n38_71315_c1 3300050490 Bacteria 1609
124 nmdc:mga00v17_117972_c1 3300050491 Bacteria 1688
125 nmdc:mga00v17_265951_c1 3300050491 Bacteria 1113
126 nmdc:mga00v17_291438_c1 3300050491 Bacteria 1060
127 nmdc:mga0yw44_219460_c1 3300050492 Bacteria 1260
128 nmdc:mga0yw44_338319_c1 3300050492 Bacteria 1012
129 nmdc:mga0yw44_424186_c1 3300050492 Bacteria 901
130 nmdc:mga06z11_174877_c1 3300050494 Bacteria 1235
131 nmdc:mga06z11_32302_c1 3300050494 Bacteria 2552
132 nmdc:mga07m45_154341_c1 3300050496 Bacteria 1332
133 nmdc:mga07m45_51392_c1 3300050496 Bacteria 2324
134 Ga0495655_0068206 3300053083 Bacteria 988
135 Ga0500643_038598 3300053087 Bacteria 1415
136 Ga0500658_0056081 3300053134 Bacteria 1624
137 Ga0500568_0000207 3300053139 Bacteria 51335
138 Ga0500604_0010672 3300053151 Bacteria 2460
139 Ga0500616_0087207 3300053153 Bacteria 1554
140 Ga0500620_005542 3300053155 Bacteria 2936
141 Ga0500620_066141 3300053155 Bacteria 1237
142 2503199338 2503198000 Bacteria 6884444
143 2509113354 2508501123 Bacteria 6283661
144 2509142183 2508501127 Bacteria 7037543
145 2509369879 2509276018 Bacteria 6910194
146 2510318037 2510065059 Bacteria 6847884
147 2512933272 2512875016 Bacteria 6529530
148 2512961373 2512875024 Bacteria 7195110
149 2513610353 2513237090 Bacteria 7096802
150 2514035393 2513237164 Bacteria 7563725
151 2514419309 2513237305 Bacteria 7293571
152 2514586712 2513237351 Bacteria 6968952
153 2588519340 2588253730 Bacteria 6881675
154 2599937252 2599185301 Bacteria 6161860
155 2643988827 2643221595 Bacteria 6565519
156 2644154887 2643221627 Bacteria 6761570
157 2688596615 2687453392 Bacteria 6880454
158 2694629999 2693429783 Bacteria 7019804
159 2694635811 2693429784 Bacteria 7241525
160 2723573725 2721755686 Bacteria 7343952
161 2756674017 2756170246 Bacteria 7451806
162 2792750679 2791355123 Bacteria 8049106
163 2841737041 2841734538 Bacteria 6784580
164 2844002432 2844002411 Bacteria 7168230
165 2844011855 2844009547 Bacteria 6728125
166 2847674383 2847670302 Bacteria 6165597
167 2847690507 2847686936 Bacteria 6278406
168 2856317701 2856314179 Bacteria 6477897
169 2856321434 2856320880 Bacteria 7263508
170 2856329704 2856328259 Bacteria 6528202
171 2856337719 2856334872 Bacteria 7037011
172 2856350507 2856349417 Bacteria 6230045
173 2856366493 2856364286 Bacteria 6939991
174 2857356826 2857349434 Bacteria 7926032
175 2857370221 2857367948 Bacteria 6965560
176 2869165057 2869162929 Bacteria 6399702
177 2869172494 2869169390 Bacteria 6659796
178 2869238305 2869234852 Bacteria 6654993
179 2869250023 2869249662 Bacteria 6868783
180 2869262980 2869256925 Bacteria 6981691
181 2869264959 2869264136 Bacteria 6880765
182 2869271605 2869271264 Bacteria 6908218
183 2869285371 2869278585 Bacteria 7077053
184 2869288096 2869285874 Bacteria 6901219
185 2871429982 2871429161 Bacteria 6547891
186 2871438617 2871435913 Bacteria 6880295
187 2871447034 2871444079 Bacteria 6423508
188 2871457348 2871451962 Bacteria 7336357
189 2871466811 2871459585 Bacteria 6866887
190 2871467412 2871466892 Bacteria 6923287
191 2871477368 2871474448 Bacteria 6806570
192 2871484059 2871481445 Bacteria 6700002
193 2871497786 2871495908 Bacteria 6935695
194 2874107358 2874102143 Bacteria 6342645
195 2874113670 2874109183 Bacteria 6517025
196 2874117600 2874116593 Bacteria 6674494
197 2874134739 2874131515 Bacteria 6820270
198 2874146386 2874139085 Bacteria 7021506
199 2874151729 2874146452 Bacteria 7533118
200 2874159361 2874155637 Bacteria 6724144
201 2874164735 2874162495 Bacteria 6174670
202 2874176543 2874168670 Bacteria 8062617
203 2876364476 2876363079 Bacteria 6544991
204 2876375608 2876369609 Bacteria 6807521
205 2876383217 2876377896 Bacteria 6565995
206 2876391122 2876386047 Bacteria 6698674
207 2876396495 2876392853 Bacteria 6660880
208 2876402127 2876399893 Bacteria 6927900
209 2876408972 2876406927 Bacteria 6191900
210 2876417780 2876413966 Bacteria 6831344
211 2876421181 2876420981 Bacteria 6687741
212 2878038760 2878035449 Bacteria 6555736
213 2878735536 2878730984 Bacteria 6380721
214 2878741435 2878738818 Bacteria 7136951
215 2878749607 2878745973 Bacteria 6867388
216 2878762009 2878760144 Bacteria 6823465
217 2878768975 2878767105 Bacteria 6898628
218 2878774327 2878774303 Bacteria 6108671
219 2878783459 2878781027 Bacteria 6834456
220 2878796700 2878788777 Bacteria 6567085
221 2881149153 2881147464 Bacteria 7779814
222 2881160388 2881155292 Bacteria 6461656
223 2881165987 2881161766 Bacteria 7127907
224 2881857049 2881853255 Bacteria 6698367
225 2882638341 2882632389 Bacteria 8154593
226 2885307468 2885305155 Bacteria 7348390
227 2885313493 2885312484 Bacteria 6415165
228 2885328429 2885326080 Bacteria 7134805
229 2885338256 2885334103 Bacteria 7216818
230 2885350562 2885342637 Bacteria 7011821
231 2888337683 2888337043 Bacteria 6629336
232 2888354199 2888350351 Bacteria 7372807
233 2889015911 2889010040 Bacteria 6749192
234 2889019037 2889016732 Bacteria 6700763
235 2903454999 2903448605 Bacteria 7357801
236 2903493836 2903492973 Bacteria 13473544
237 2903514382 2903513507 Bacteria 6344008
238 2903523461 2903521522 Bacteria 6525694
239 2903529167 2903528002 Bacteria 6586099
240 2903542584 2903540706 Bacteria 7062119
241 2904663271 2904659560 Bacteria 6685615
242 2906310645 2906308376 Bacteria 6841989
243 2906324708 2906321335 Bacteria 6579571
244 2906333513 2906328253 Bacteria 6585166
245 2906354497 2906354277 Bacteria 6991324
246 2906369456 2906363423 Bacteria 6856682
247 2906372083 2906370794 Bacteria 6881062
248 2906381858 2906378014 Bacteria 6911440
249 2906388047 2906386501 Bacteria 5977019
250 2906401149 2906393657 Bacteria 6790866
251 2906407375 2906401398 Bacteria 6693206
252 2906413034 2906408224 Bacteria 6162342
253 2906417766 2906414383 Bacteria 6580790
254 2906434420 2906427513 Bacteria 6375796
255 2922131030 2922130491 Bacteria 7173936
256 2922152517 2922151315 Bacteria 6902399
257 2922159820 2922158528 Bacteria 6573167
258 2922174852 2922172374 Bacteria 6167644
259 2922183674 2922178524 Bacteria 6025201
260 2922189140 2922185730 Bacteria 7113964
261 2924716770 2924710171 Bacteria 6752351
262 2924720984 2924718760 Bacteria 6331356
263 2924726882 2924726620 Bacteria 6271473
264 2924740111 2924733363 Bacteria 7574837
265 2924747844 2924741084 Bacteria 6661321
266 2924751213 2924748358 Bacteria 6154725
267 2924766691 2924762789 Bacteria 6561353
268 2924779117 2924776078 Bacteria 7492003
269 2937817472 2937813078 Bacteria 7783518
270 2937828110 2937822353 Bacteria 7290551
271 2937841109 2937836603 Bacteria 6811263
272 2937849396 2937848649 Bacteria 6983481
273 2937868474 2937861824 Bacteria 6660327
274 2937883231 2937877337 Bacteria 7246526
275 2937897863 2937891427 Bacteria 6357007
276 2937979155 2937972304 Bacteria 7532020
277 2937986609 2937980651 Bacteria 6517427
278 2937996437 2937994558 Bacteria 7036190
279 2938019297 2938014810 Bacteria 6700592
280 2958041076 2958034702 Bacteria 6989922
281 2958046014 2958041894 Bacteria 13082850
282 2958057570 2958041894 Bacteria 13082850
283 2958070037 2958064165 Bacteria 7158582
284 2958073322 2958071322 Bacteria 6815895
285 2958090397 2958084443 Bacteria 7312792
286 2958103366 2958100919 Bacteria 6800575
287 2958113785 2958108152 Bacteria 6681128
288 2958115921 2958115193 Bacteria 6923548
289 2958129125 2958122699 Bacteria 7280457
290 2958132498 2958130278 Bacteria 6897202
291 2958142913 2958137437 Bacteria 6050276
292 2958151440 2958144490 Bacteria 6677056
293 2958159937 2958158011 Bacteria 6058449
294 2958166907 2958165035 Bacteria 6906348
295 2958173824 2958172287 Bacteria 6716688
296 2958182312 2958179912 Bacteria 6874908
297 2961080157 2961077736 Bacteria 7079850
298 2961118298 2961114664 Bacteria 6680456
299 2961143542 2961136820 Bacteria 6775228
300 2961165377 2961163497 Bacteria 6901077
301 2961185354 2961183825 Bacteria 6688536
302 2963645933 2963644680 Bacteria 6530403
303 2965020199 2965018300 Bacteria 6883036
304 2965030763 2965025482 Bacteria 6532201
305 2965034465 2965032056 Bacteria 6887443
306 2965047149 2965040258 Bacteria 6855979
307 2965052567 2965047637 Bacteria 6623551
308 2965070133 2965062239 Bacteria 7412989
309 2965089860 2965089291 Bacteria 6866420
310 2965104889 2965102966 Bacteria 6800987
311 2965115765 2965110997 Bacteria 6693150
312 2968022670 2968016561 Bacteria 7022047
313 2968089443 2968083720 Bacteria 7351627
314 2968091662 2968091066 Bacteria 6052692
315 2968097682 2968097103 Bacteria 6107094
316 2968114359 2968110612 Bacteria 6814636
317 2968133367 2968128360 Bacteria 6270294
318 2968143558 2968138860 Bacteria 6605449
319 2968173778 2968171901 Bacteria 6894245
320 2970475254 2970469710 Bacteria 6969209
321 2970491151 2970489779 Bacteria 6517260
322 2970511950 2970510686 Bacteria 7006402
323 2970537511 2970532167 Bacteria 6553173
324 2970549216 2970547951 Bacteria 6931819
325 2970556864 2970554993 Bacteria 6814252
326 2970599987 2970593180 Bacteria 7073582
327 2970624477 2970619444 Bacteria 6986144
328 2970629078 2970627176 Bacteria 6680862
329 2977847759 2977843712 Bacteria 6753583
330 2977852133 2977851361 Bacteria 6694324
331 2977858655 2977858184 Bacteria 6215359
332 2977876982 2977872689 Bacteria 7270173
333 2977910040 2977907340 Bacteria 6577984
334 2977920447 2977915119 Bacteria 6829656
335 2977923675 2977922695 Bacteria 6956781
336 2977937645 2977935797 Bacteria 6252826
337 2977950039 2977942078 Bacteria 7570577
338 2977955866 2977950692 Bacteria 6893264
339 2977959666 2977957713 Bacteria 6877875
340 2977973106 2977971508 Bacteria 7472917
341 2977988422 2977986579 Bacteria 6581278
342 2979714419 2979710463 Bacteria 6785254
343 2979744953 2979742915 Bacteria 7301278
344 2979764819 2979764755 Bacteria 6610066
345 2979773339 2979772303 Bacteria 6618277
346 2979782278 2979779861 Bacteria 6219781
347 2979793692 2979793036 Bacteria 6808957
348 2987644107 2987636660 Bacteria 8088555
349 2987651894 2987645492 Bacteria 6117018
350 2987652500 2987652177 Bacteria 6969023
351 2987661384 2987659509 Bacteria 6966464
352 2987670964 2987666974 Bacteria 6509233
353 2996315449 2996310559 Bacteria 6357320
354 2996337315 2996336353 Bacteria 5511628
355 2996343216 2996341866 Bacteria 6643098
356 2996353319 2996348954 Bacteria 7239054
357 2996393499 2996386984 Bacteria 6978667
358 3000141603 3000135777 Bacteria 6891109
359 3004173959 3004167301 Bacteria 8330599
360 3004190433 3004188549 Bacteria 6952365
361 3004196661 3004195979 Bacteria 6776956
362 3004208256 3004203850 Bacteria 7307914
363 3004212984 3004211236 Bacteria 7417683
364 3004220663 3004218560 Bacteria 7421728
365 3004233341 3004232784 Bacteria 6662140
366 3004246248 3004239961 Bacteria 6892290
367 3004255185 3004248173 Bacteria 6563236
368 3004272789 3004268573 Bacteria 7043476
369 3004280001 3004275668 Bacteria 7114440
370 3004336511 3004334049 Bacteria 8449246
371 637076352 637000159 Bacteria 7596297
372 649871170 649633066 Bacteria 6690028
373 8004304484 8004300914 Bacteria 6132239
374 8004318702 8004312739 Bacteria 7444653
375 8004362253 8004361976 Bacteria 6858373
376 8004389883 8004387939 Bacteria 7049250
377 8004445570 8004445564 Bacteria 6322258
378 8004634866 8004633249 Bacteria 6723080
379 8004645744 8004640170 Bacteria 6723001
380 8004704287 8004703790 Bacteria 8006957
381 8004718280 8004714634 Bacteria 6776161
382 8004732197 8004727605 Bacteria 6643904
383 nmdc:mga03683_66757_c1
384 JGI24740J21852_10003604
385 JGI24739J22299_10017596
386 JGI25156J39149_1007667
387 JGI25157J39369_1001448
388 JGI25406J46586_10061082
389 JGI25165J46597_1000026
390 rootL2_10099317
391 Ga0055529_1003379
392 Ga0068853_100005573
393 Ga0070665_100026133
394 Ga0068857_100235403
395 Ga0081539_10000942
396 Ga0075365_10012502
397 Ga0075365_10061973
398 Ga0075368_10004616
399 Ga0075368_10055858
400 Ga0075363_100029077
401 Ga0075364_10155647
402 Ga0075364_10335106
403 Ga0075362_10061950
404 Ga0075367_10021000
405 Ga0075369_10007441
406 Ga0075370_10027685
407 Ga0075370_10047155
408 Ga0105240_10595571
409 Ga0105240_10609814
410 Ga0105240_10843439
411 Ga0105245_10256415
412 Ga0105241_10042465
413 Ga0105241_10304481
414 Ga0105241_10432221
415 Ga0105248_10261947
416 Ga0105237_10145182
417 Ga0105237_10436773
418 Ga0105238_10117090
419 Ga0105238_10482920
420 Ga0105239_10064654
421 Ga0105239_10201106
422 Ga0105239_10219243
423 Ga0105239_10350182
424 Ga0105239_10513144
425 Ga0105239_10520277
426 Ga0157370_10332364
427 Ga0157369_10252622
428 Ga0157374_10093502
429 Ga0157378_10591581
430 Ga0182007_10040781
431 Ga0163161_10309379
432 Ga0209646_1004408
433 Ga0209026_1000041
434 Ga0209148_1000317
435 Ga0209759_1000168
436 Ga0209233_1000030
437 Ga0209233_1009921
438 Ga0209455_1000152
439 Ga0207647_10077348
440 Ga0207654_10089343
441 Ga0207695_10215066
442 Ga0207695_10604213
443 Ga0207671_10169653
444 Ga0207671_10460607
445 Ga0207657_10143225
446 Ga0207694_10060112
447 Ga0207694_10133637
448 Ga0207694_10146610
449 Ga0207667_10776231
450 Ga0207640_10031859
451 Ga0207640_10380112
452 Ga0207639_10039364
453 Ga0268266_10057176
454 Ga0307408_100211708
455 Ga0307412_10097249
456 Ga0307416_100153235
457 Ga0395900_0551263
458 Ga0395905_0140673
459 Ga0395905_0213926
460 Ga0395905_0468290
461 Ga0395901_0094265
462 Ga0395901_0365092
463 Ga0439465_0055558
464 Ga0439465_0100888
465 Ga0451853_3667098
466 Ga0466972_0122321
467 Ga0495638_0021974
468 Ga0495638_0081126
469 Ga0495638_0124720
470 Ga0495637_0065701
471 Ga0495597_0174986
472 Ga0495668_0029902
473 Ga0495668_0159567
474 Ga0495625_0017318
475 Ga0496112_0184396
476 Ga0496119_0034000
477 Ga0496120_0021509
478 Ga0496125_0138171
479 Ga0496126_0488899
480 Ga0501031_0008821
481 Ga0501032_0021313
482 Ga0501033_0008246
483 Ga0501034_0006012
484 Ga0501036_0108252
485 Ga0501037_0013983
486 Ga0501038_0014007
487 Ga0501039_0004436
488 Ga0501042_0005414
489 Ga0501043_0012320
490 Ga0501046_0003164
491 Ga0501047_0008236
492 Ga0501047_0235199
493 Ga0501048_0003241
494 Ga0501068_0008675
495 Ga0501070_0006094
496 Ga0501071_0460860
497 Ga0501073_0006851
498 Ga0501079_0456459
499 Ga0501080_0048887
500 Ga0501035_0029422
501 Ga0501035_0125758
502 Ga0501044_0009588
503 Ga0501045_0021146
504 nmdc:mga03n38_114483_c1
505 nmdc:mga03n38_71315_c1
506 nmdc:mga00v17_117972_c1
507 nmdc:mga00v17_265951_c1
508 nmdc:mga00v17_291438_c1
509 nmdc:mga0yw44_219460_c1
510 nmdc:mga0yw44_338319_c1
511 nmdc:mga0yw44_424186_c1
512 nmdc:mga06z11_174877_c1
513 nmdc:mga06z11_32302_c1
514 nmdc:mga07m45_154341_c1
515 nmdc:mga07m45_51392_c1
516 Ga0495655_0068206
517 Ga0500643_038598
518 Ga0500658_0056081
519 Ga0500568_0000207
520 Ga0500604_0010672
521 Ga0500616_0087207
522 Ga0500620_005542
523 Ga0500620_066141
524 2503199338
525 2509113354
526 2509142183
527 2509369879
528 2510318037
529 2512933272
530 2512961373
531 2513610353
532 2514035393
533 2514419309
534 2514586712
535 2588519340
536 2599937252
537 2643988827
538 2644154887
539 2688596615
540 2694629999
541 2694635811
542 2723573725
543 2756674017
544 2792750679
545 2841737041
546 2844002432
547 2844011855
548 2847674383
549 2847690507
550 2856317701
551 2856321434
552 2856329704
553 2856337719
554 2856350507
555 2856366493
556 2857356826
557 2857370221
558 2869165057
559 2869172494
560 2869238305
561 2869250023
562 2869262980
563 2869264959
564 2869271605
565 2869285371
566 2869288096
567 2871429982
568 2871438617
569 2871447034
570 2871457348
571 2871466811
572 2871467412
573 2871477368
574 2871484059
575 2871497786
576 2874107358
577 2874113670
578 2874117600
579 2874134739
580 2874146386
581 2874151729
582 2874159361
583 2874164735
584 2874176543
585 2876364476
586 2876375608
587 2876383217
588 2876391122
589 2876396495
590 2876402127
591 2876408972
592 2876417780
593 2876421181
594 2878038760
595 2878735536
596 2878741435
597 2878749607
598 2878762009
599 2878768975
600 2878774327
601 2878783459
602 2878796700
603 2881149153
604 2881160388
605 2881165987
606 2881857049
607 2882638341
608 2885307468
609 2885313493
610 2885328429
611 2885338256
612 2885350562
613 2888337683
614 2888354199
615 2889015911
616 2889019037
617 2903454999
618 2903493836
619 2903514382
620 2903523461
621 2903529167
622 2903542584
623 2904663271
624 2906310645
625 2906324708
626 2906333513
627 2906354497
628 2906369456
629 2906372083
630 2906381858
631 2906388047
632 2906401149
633 2906407375
634 2906413034
635 2906417766
636 2906434420
637 2922131030
638 2922152517
639 2922159820
640 2922174852
641 2922183674
642 2922189140
643 2924716770
644 2924720984
645 2924726882
646 2924740111
647 2924747844
648 2924751213
649 2924766691
650 2924779117
651 2937817472
652 2937828110
653 2937841109
654 2937849396
655 2937868474
656 2937883231
657 2937897863
658 2937979155
659 2937986609
660 2937996437
661 2938019297
662 2958041076
663 2958046014
664 2958057570
665 2958070037
666 2958073322
667 2958090397
668 2958103366
669 2958113785
670 2958115921
671 2958129125
672 2958132498
673 2958142913
674 2958151440
675 2958159937
676 2958166907
677 2958173824
678 2958182312
679 2961080157
680 2961118298
681 2961143542
682 2961165377
683 2961185354
684 2963645933
685 2965020199
686 2965030763
687 2965034465
688 2965047149
689 2965052567
690 2965070133
691 2965089860
692 2965104889
693 2965115765
694 2968022670
695 2968089443
696 2968091662
697 2968097682
698 2968114359
699 2968133367
700 2968143558
701 2968173778
702 2970475254
703 2970491151
704 2970511950
705 2970537511
706 2970549216
707 2970556864
708 2970599987
709 2970624477
710 2970629078
711 2977847759
712 2977852133
713 2977858655
714 2977876982
715 2977910040
716 2977920447
717 2977923675
718 2977937645
719 2977950039
720 2977955866
721 2977959666
722 2977973106
723 2977988422
724 2979714419
725 2979744953
726 2979764819
727 2979773339
728 2979782278
729 2979793692
730 2987644107
731 2987651894
732 2987652500
733 2987661384
734 2987670964
735 2996315449
736 2996337315
737 2996343216
738 2996353319
739 2996393499
740 3000141603
741 3004173959
742 3004190433
743 3004196661
744 3004208256
745 3004212984
746 3004220663
747 3004233341
748 3004246248
749 3004255185
750 3004272789
751 3004280001
752 3004336511
753 637076352
754 649871170
755 8004304484
756 8004318702
757 8004362253
758 8004389883
759 8004445570
760 8004634866
761 8004645744
762 8004704287
763 8004718280
764 8004732197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13505

OMP_b-brl

Outer membrane protein beta-barrel domain

27

309

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x9z-assembly1.cif.gz_A de novo design of transmembrane beta-barrels 0.7531 43 256
6x9z-assembly1.cif.gz_A de novo design of transmembrane beta-barrels 0.7298 43 256
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.6947 45 256
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.6861 45 256
6x1k-assembly1.cif.gz_A solution nmr structure of de novo designed tmb2.3 0.666 45 257
ID Description Score Start End Superfamily
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.6947 45 256 2.40.160.20
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.6861 45 256 2.40.160.20
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.6481 46 257 2.40.160.20
4rlcA00 Mainly Beta;Beta Barrel;Porin; 0.6463 51 256 2.40.160.20
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.6264 46 257 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A101KM53-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8396 16 257
AF-A0A101KM53-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.7893 16 257
AF-A0A1L3SXM4-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.7882 17 257
AF-A0A1L3SXM4-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.7378 17 257
AF-A0A2P5KSW8-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.7253 84 257

Map