F429451
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 382 | 343 | 764 | 396 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2871435913|2871443863 |
| Length | 386 |
| Sequence | ALYETFARAPLAFDHGEGTWLVTDKGERYLDFAGGIAVNSLGHSHPHLVAALTEQAAKLWHVSNLYEIPGQSRLXXXXFFTNSGAEALECAIKTARRYHFVKGNPERFRVITFEGAFHGRTLATIAAGGQYKYLEGFGPKVEGFDQVGFDDIDAAEKAITPETAAILIEPVQGEGGIRPVPTQSLKRLRQLCEQHGLLLIYDEVQCGIGRTGKLFAHEWSGVTPDIMAIAKGIGGGFPMGACLATDEAAVGMTAGVHGTTFGGNPLAMAVGNAVLDVVLEDGFLEDVQRKALLMKQGLASVADEFPEIIEDIRGAGLMLGLKCAMPNTKVNMALRDQHLLAVPAGDNVIRLLPPLTVTDAEIHDALNRIRAGAKGLAEAIASAAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 3 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 7 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 8 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 9 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 10 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 11 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 12 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 13 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 14 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 15 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 16 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 17 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 18 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 19 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 20 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 21 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 22 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 23 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 24 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 25 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 26 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 27 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 28 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 29 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 30 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 31 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 32 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 33 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 34 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 35 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 36 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 37 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 38 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 39 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 40 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 41 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 42 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 43 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 44 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 45 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 46 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 47 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 48 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 49 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 50 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 51 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 52 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 53 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 54 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 55 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 56 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 57 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 58 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 59 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 60 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 61 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 62 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 63 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 64 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 65 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 66 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 67 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 68 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 69 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 70 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 71 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 72 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 73 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 74 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 75 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 76 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 77 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 78 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 82 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 83 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 84 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 85 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 86 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 87 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 88 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 89 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 90 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 91 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 92 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 93 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 94 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 95 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 96 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 97 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 98 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 99 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 100 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 101 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 102 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 103 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 104 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 105 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 106 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 107 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 108 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 109 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 110 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 111 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 112 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 113 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 114 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 115 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 116 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 117 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 118 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 119 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 120 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 121 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 122 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 123 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 124 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 125 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 126 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 127 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 128 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 129 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 130 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 131 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 132 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 133 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 134 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 135 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 136 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 137 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 138 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 139 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 140 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 141 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 142 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 143 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 144 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 145 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 146 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 147 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 148 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 149 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 150 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 151 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 152 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 153 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 154 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 155 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 156 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 157 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 158 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 159 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 160 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 161 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 162 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 163 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 164 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 165 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 166 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 167 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 168 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 169 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 170 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 171 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 172 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 173 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 174 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 175 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 176 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 177 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 178 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 179 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 180 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 181 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 182 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 183 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 184 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 185 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 186 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 187 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 188 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 189 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 190 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 191 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 192 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 193 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 194 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 195 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 196 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 197 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 198 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 199 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 200 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 201 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 202 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 203 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 204 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 205 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 206 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 207 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 208 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 209 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 210 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 211 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 212 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 213 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 214 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 215 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 216 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 217 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 218 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 219 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 220 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 221 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 222 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 223 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 224 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 225 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 226 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 227 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 228 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 229 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 230 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 231 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 232 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 233 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 234 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 235 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 236 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 237 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 238 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 239 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 240 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 241 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 242 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 243 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 244 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 245 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 246 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 247 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 248 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 249 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 250 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 251 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 252 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 253 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 254 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 255 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 256 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 257 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 258 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 259 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 260 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 261 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 262 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 263 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 264 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 265 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 266 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 267 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 268 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 269 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 270 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 271 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 272 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 273 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 274 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 275 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 276 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 277 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 278 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 279 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 280 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 281 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 282 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 283 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 284 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 285 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 286 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 287 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 288 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 289 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 290 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 291 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 292 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 293 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 294 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 295 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 296 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 297 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 298 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 299 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 300 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 301 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 302 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 303 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 304 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 305 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 306 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 307 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 308 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 309 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 310 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 311 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 312 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 313 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 314 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 315 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 316 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 317 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 318 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 319 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 320 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 321 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 322 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 323 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 324 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 325 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 326 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 327 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 328 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 329 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 330 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 331 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 332 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 333 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 334 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 335 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 336 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 337 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 338 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 339 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 340 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 341 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 342 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 343 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 32.98 |
| Metatranscriptomes | 0 |
| Isolates | 67.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.36 |
| Nodule | 57.07 |
| Rhizoplane | 0.52 |
| Rhizosphere | 30.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10002159 | 3300003203 | Bacteria | 9302 |
| 2 | Ga0070698_100044679 | 3300005471 | Bacteria | 4534 |
| 3 | Ga0070679_100008641 | 3300005530 | Bacteria | 9598 |
| 4 | Ga0081540_1006065 | 3300005983 | Bacteria | 8886 |
| 5 | Ga0081539_10003188 | 3300005985 | Bacteria | 20756 |
| 6 | Ga0075365_10044286 | 3300006038 | Bacteria | 2915 |
| 7 | Ga0075431_100014499 | 3300006847 | Bacteria | 7974 |
| 8 | Ga0075434_100445586 | 3300006871 | Bacteria | 1316 |
| 9 | Ga0114129_10037925 | 3300009147 | Bacteria | 6799 |
| 10 | Ga0157369_10164758 | 3300013105 | Bacteria | 2338 |
| 11 | Ga0209676_1009037 | 3300025292 | Bacteria | 4353 |
| 12 | Ga0207707_10237738 | 3300025912 | Bacteria | 1584 |
| 13 | Ga0207671_10028017 | 3300025914 | Bacteria | 4210 |
| 14 | Ga0207667_10205938 | 3300025949 | Bacteria | 2017 |
| 15 | Ga0268266_10093957 | 3300028379 | Bacteria | 2632 |
| 16 | Ga0265338_10163854 | 3300028800 | Bacteria | 1714 |
| 17 | Ga0265328_10003167 | 3300031239 | Bacteria | 7310 |
| 18 | Ga0265328_10003368 | 3300031239 | Bacteria | 7066 |
| 19 | Ga0265320_10001543 | 3300031240 | Bacteria | 16648 |
| 20 | Ga0265320_10002449 | 3300031240 | Bacteria | 12925 |
| 21 | Ga0265340_10019100 | 3300031247 | Bacteria | 3529 |
| 22 | Ga0265331_10000019 | 3300031250 | Bacteria | 258837 |
| 23 | Ga0265327_10011547 | 3300031251 | Bacteria | 6065 |
| 24 | Ga0265316_10124243 | 3300031344 | Bacteria | 1947 |
| 25 | Ga0307513_10019071 | 3300031456 | Bacteria | 8176 |
| 26 | Ga0265313_10000045 | 3300031595 | Bacteria | 114646 |
| 27 | Ga0265313_10000265 | 3300031595 | Bacteria | 57291 |
| 28 | Ga0265313_10003982 | 3300031595 | Bacteria | 11601 |
| 29 | Ga0265313_10058100 | 3300031595 | Bacteria | 1824 |
| 30 | Ga0265314_10001952 | 3300031711 | Bacteria | 21949 |
| 31 | Ga0265342_10008292 | 3300031712 | Bacteria | 7477 |
| 32 | Ga0316576_10084860 | 3300031727 | Bacteria | 2354 |
| 33 | Ga0316578_10048582 | 3300031728 | Bacteria | 2478 |
| 34 | Ga0307510_10117227 | 3300033180 | Bacteria | 2381 |
| 35 | Ga0316582_0028572 | 3300036647 | Bacteria | 3380 |
| 36 | Ga0316584_0045962 | 3300036712 | Bacteria | 3260 |
| 37 | Ga0395899_0000014 | 3300037312 | Bacteria | 488813 |
| 38 | Ga0395900_0000007 | 3300037418 | Bacteria | 488860 |
| 39 | Ga0395898_0000011 | 3300037466 | Bacteria | 488860 |
| 40 | Ga0395905_0000008 | 3300037471 | Bacteria | 488860 |
| 41 | Ga0395901_0000020 | 3300038443 | Bacteria | 314918 |
| 42 | Ga0453684_0028732 | 3300044712 | Bacteria | 7920 |
| 43 | Ga0453684_0065463 | 3300044712 | Bacteria | 4635 |
| 44 | Ga0453684_0067875 | 3300044712 | Bacteria | 4532 |
| 45 | Ga0453684_0129325 | 3300044712 | Bacteria | 3032 |
| 46 | Ga0466959_0001203 | 3300045049 | Bacteria | 15629 |
| 47 | Ga0495643_0050682 | 3300046522 | Bacteria | 2235 |
| 48 | Ga0495675_0141705 | 3300047444 | Bacteria | 1490 |
| 49 | Ga0495686_0044304 | 3300047472 | Bacteria | 2817 |
| 50 | Ga0495602_0207963 | 3300048088 | Bacteria | 1488 |
| 51 | Ga0496112_0026649 | 3300048915 | Bacteria | 5567 |
| 52 | Ga0496122_0056154 | 3300048925 | Bacteria | 2938 |
| 53 | Ga0496126_0241796 | 3300048929 | Bacteria | 1508 |
| 54 | Ga0501031_0000003 | 3300049568 | Bacteria | 206821 |
| 55 | Ga0501031_0002943 | 3300049568 | Bacteria | 10896 |
| 56 | Ga0501031_0007990 | 3300049568 | Bacteria | 6887 |
| 57 | Ga0501032_0000001 | 3300049569 | Bacteria | 422097 |
| 58 | Ga0501032_0000010 | 3300049569 | Bacteria | 206795 |
| 59 | Ga0501033_0000017 | 3300049570 | Bacteria | 206819 |
| 60 | Ga0501033_0000198 | 3300049570 | Bacteria | 57365 |
| 61 | Ga0501033_0018963 | 3300049570 | Bacteria | 5199 |
| 62 | Ga0501034_0000036 | 3300049571 | Bacteria | 239274 |
| 63 | Ga0501034_0000053 | 3300049571 | Bacteria | 206821 |
| 64 | Ga0501034_0024750 | 3300049571 | Bacteria | 6107 |
| 65 | Ga0501034_0061842 | 3300049571 | Bacteria | 3760 |
| 66 | Ga0501036_0000009 | 3300049572 | Bacteria | 206821 |
| 67 | Ga0501036_0000046 | 3300049572 | Bacteria | 76444 |
| 68 | Ga0501036_0017430 | 3300049572 | Bacteria | 6004 |
| 69 | Ga0501036_0036804 | 3300049572 | Bacteria | 4140 |
| 70 | Ga0501036_0059444 | 3300049572 | Bacteria | 3239 |
| 71 | Ga0501037_0000008 | 3300049573 | Bacteria | 206812 |
| 72 | Ga0501037_0000017 | 3300049573 | Bacteria | 157276 |
| 73 | Ga0501038_0000008 | 3300049574 | Bacteria | 206821 |
| 74 | Ga0501038_0000153 | 3300049574 | Bacteria | 59196 |
| 75 | Ga0501038_0057734 | 3300049574 | Bacteria | 3331 |
| 76 | Ga0501039_0000011 | 3300049575 | Bacteria | 245124 |
| 77 | Ga0501039_0000021 | 3300049575 | Bacteria | 162552 |
| 78 | Ga0501039_0005545 | 3300049575 | Bacteria | 9548 |
| 79 | Ga0501039_0031625 | 3300049575 | Bacteria | 4080 |
| 80 | Ga0501040_0071601 | 3300049576 | Bacteria | 2393 |
| 81 | Ga0501041_0026319 | 3300049577 | Bacteria | 3499 |
| 82 | Ga0501042_0009424 | 3300049578 | Bacteria | 6507 |
| 83 | Ga0501043_0000016 | 3300049579 | Bacteria | 170869 |
| 84 | Ga0501043_0000279 | 3300049579 | Bacteria | 46075 |
| 85 | Ga0501043_0086923 | 3300049579 | Bacteria | 2457 |
| 86 | Ga0501046_0102316 | 3300049580 | Bacteria | 2196 |
| 87 | Ga0501047_0000126 | 3300049581 | Bacteria | 93841 |
| 88 | Ga0501047_0061415 | 3300049581 | Bacteria | 3626 |
| 89 | Ga0501047_0072597 | 3300049581 | Bacteria | 3312 |
| 90 | Ga0501047_0174808 | 3300049581 | Bacteria | 2015 |
| 91 | Ga0501048_0001737 | 3300049582 | Bacteria | 16586 |
| 92 | Ga0501070_0022835 | 3300049586 | Bacteria | 5236 |
| 93 | Ga0501071_0005968 | 3300049587 | Bacteria | 7889 |
| 94 | Ga0501072_0002106 | 3300049588 | Bacteria | 14823 |
| 95 | Ga0501073_0202643 | 3300049589 | Bacteria | 1372 |
| 96 | Ga0501074_0011270 | 3300049590 | Bacteria | 6499 |
| 97 | Ga0501074_0066609 | 3300049590 | Bacteria | 2590 |
| 98 | Ga0501076_0073871 | 3300049592 | Bacteria | 2730 |
| 99 | Ga0501077_0135106 | 3300049593 | Bacteria | 1564 |
| 100 | Ga0501079_0017771 | 3300049741 | Bacteria | 5434 |
| 101 | Ga0501080_0066765 | 3300049742 | Bacteria | 3345 |
| 102 | Ga0501083_0031677 | 3300049744 | Bacteria | 3629 |
| 103 | Ga0501083_0117179 | 3300049744 | Bacteria | 1748 |
| 104 | Ga0501035_0000023 | 3300049822 | Bacteria | 206821 |
| 105 | Ga0501035_0000028 | 3300049822 | Bacteria | 179195 |
| 106 | Ga0501035_0010550 | 3300049822 | Bacteria | 8560 |
| 107 | Ga0501044_0000021 | 3300049823 | Bacteria | 206821 |
| 108 | Ga0501044_0038117 | 3300049823 | Bacteria | 5019 |
| 109 | Ga0501044_0042037 | 3300049823 | Bacteria | 4757 |
| 110 | Ga0501045_0008298 | 3300049824 | Bacteria | 7231 |
| 111 | nmdc:mga06z11_24835_c1 | 3300050494 | Bacteria | 2833 |
| 112 | nmdc:mga05p37_63210_c1 | 3300050507 | Bacteria | 4555 |
| 113 | nmdc:mga0qj67_48728_c1 | 3300050509 | Bacteria | 3347 |
| 114 | nmdc:mga06r32_5391_c1 | 3300050510 | Bacteria | 11510 |
| 115 | Ga0495601_0062267 | 3300053077 | Bacteria | 2369 |
| 116 | Ga0495595_0052400 | 3300053084 | Bacteria | 1893 |
| 117 | Ga0495619_0053508 | 3300053085 | Bacteria | 2670 |
| 118 | Ga0500643_005923 | 3300053087 | Bacteria | 5186 |
| 119 | Ga0500644_0024829 | 3300053088 | Bacteria | 1837 |
| 120 | Ga0500642_0004989 | 3300053130 | Bacteria | 4230 |
| 121 | Ga0500604_0025014 | 3300053151 | Bacteria | 1714 |
| 122 | Ga0500616_0071406 | 3300053153 | Bacteria | 1768 |
| 123 | Ga0500627_0046477 | 3300053158 | Bacteria | 1881 |
| 124 | Ga0501084_0057718 | 3300054114 | Bacteria | 3247 |
| 125 | Ga0466962_0025410 | 3300061719 | Bacteria | 2844 |
| 126 | Ga0530510_0138494 | 3300061734 | Bacteria | 1792 |
| 127 | 2871443863 | 2871435913 | Bacteria | 6880295 |
| 128 | 2503204695 | 2503198000 | Bacteria | 6884444 |
| 129 | 2509113537 | 2508501123 | Bacteria | 6283661 |
| 130 | 2509370223 | 2509276018 | Bacteria | 6910194 |
| 131 | 2509398954 | 2509276022 | Bacteria | 6200534 |
| 132 | 2510314294 | 2510065059 | Bacteria | 6847884 |
| 133 | 2512032205 | 2511231221 | Bacteria | 6846400 |
| 134 | 2512934570 | 2512875016 | Bacteria | 6529530 |
| 135 | 2513613542 | 2513237090 | Bacteria | 7096802 |
| 136 | 2514416942 | 2513237305 | Bacteria | 7293571 |
| 137 | 2523105390 | 2522572158 | Bacteria | 6514390 |
| 138 | 2588514177 | 2588253730 | Bacteria | 6881675 |
| 139 | 2599102239 | 2597490356 | Bacteria | 7030811 |
| 140 | 2599935856 | 2599185301 | Bacteria | 6161860 |
| 141 | 2643772248 | 2643221550 | Bacteria | 4619371 |
| 142 | 2643836604 | 2643221564 | Bacteria | 4193379 |
| 143 | 2643984907 | 2643221595 | Bacteria | 6565519 |
| 144 | 2644155520 | 2643221627 | Bacteria | 6761570 |
| 145 | 2688601324 | 2687453392 | Bacteria | 6880454 |
| 146 | 2694630446 | 2693429783 | Bacteria | 7019804 |
| 147 | 2694637769 | 2693429784 | Bacteria | 7241525 |
| 148 | 2723578489 | 2721755686 | Bacteria | 7343952 |
| 149 | 2756674668 | 2756170246 | Bacteria | 7451806 |
| 150 | 2792746459 | 2791355123 | Bacteria | 8049106 |
| 151 | 2844004226 | 2844002411 | Bacteria | 7168230 |
| 152 | 2844009984 | 2844009547 | Bacteria | 6728125 |
| 153 | 2846956902 | 2846952575 | Bacteria | 6587527 |
| 154 | 2847672854 | 2847670302 | Bacteria | 6165597 |
| 155 | 2847689328 | 2847686936 | Bacteria | 6278406 |
| 156 | 2848861407 | 2848858292 | Bacteria | 7391279 |
| 157 | 2856314804 | 2856314179 | Bacteria | 6477897 |
| 158 | 2856327972 | 2856320880 | Bacteria | 7263508 |
| 159 | 2856332147 | 2856328259 | Bacteria | 6528202 |
| 160 | 2856335135 | 2856334872 | Bacteria | 7037011 |
| 161 | 2856360696 | 2856356410 | Bacteria | 6297484 |
| 162 | 2856371135 | 2856364286 | Bacteria | 6939991 |
| 163 | 2857372841 | 2857367948 | Bacteria | 6965560 |
| 164 | 2869164634 | 2869162929 | Bacteria | 6399702 |
| 165 | 2869174867 | 2869169390 | Bacteria | 6659796 |
| 166 | 2869242110 | 2869234852 | Bacteria | 6654993 |
| 167 | 2869253920 | 2869249662 | Bacteria | 6868783 |
| 168 | 2869263683 | 2869256925 | Bacteria | 6981691 |
| 169 | 2869270311 | 2869264136 | Bacteria | 6880765 |
| 170 | 2869275907 | 2869271264 | Bacteria | 6908218 |
| 171 | 2869279923 | 2869278585 | Bacteria | 7077053 |
| 172 | 2869292358 | 2869285874 | Bacteria | 6901219 |
| 173 | 2871429173 | 2871429161 | Bacteria | 6547891 |
| 174 | 2871445372 | 2871444079 | Bacteria | 6423508 |
| 175 | 2871455307 | 2871451962 | Bacteria | 7336357 |
| 176 | 2871460787 | 2871459585 | Bacteria | 6866887 |
| 177 | 2871470948 | 2871466892 | Bacteria | 6923287 |
| 178 | 2871485429 | 2871481445 | Bacteria | 6700002 |
| 179 | 2871490696 | 2871488783 | Bacteria | 6929816 |
| 180 | 2871499271 | 2871495908 | Bacteria | 6935695 |
| 181 | 2874108921 | 2874102143 | Bacteria | 6342645 |
| 182 | 2874114365 | 2874109183 | Bacteria | 6517025 |
| 183 | 2874121851 | 2874116593 | Bacteria | 6674494 |
| 184 | 2874129621 | 2874123672 | Bacteria | 7238285 |
| 185 | 2874132429 | 2874131515 | Bacteria | 6820270 |
| 186 | 2874145583 | 2874139085 | Bacteria | 7021506 |
| 187 | 2874154079 | 2874146452 | Bacteria | 7533118 |
| 188 | 2874161581 | 2874155637 | Bacteria | 6724144 |
| 189 | 2874162673 | 2874162495 | Bacteria | 6174670 |
| 190 | 2874171649 | 2874168670 | Bacteria | 8062617 |
| 191 | 2876363168 | 2876363079 | Bacteria | 6544991 |
| 192 | 2876376360 | 2876369609 | Bacteria | 6807521 |
| 193 | 2876385077 | 2876377896 | Bacteria | 6565995 |
| 194 | 2876388497 | 2876386047 | Bacteria | 6698674 |
| 195 | 2876393036 | 2876392853 | Bacteria | 6660880 |
| 196 | 2876404321 | 2876399893 | Bacteria | 6927900 |
| 197 | 2876419763 | 2876413966 | Bacteria | 6831344 |
| 198 | 2876427610 | 2876420981 | Bacteria | 6687741 |
| 199 | 2878036115 | 2878035449 | Bacteria | 6555736 |
| 200 | 2878738729 | 2878730984 | Bacteria | 6380721 |
| 201 | 2878740235 | 2878738818 | Bacteria | 7136951 |
| 202 | 2878752701 | 2878745973 | Bacteria | 6867388 |
| 203 | 2878755099 | 2878753008 | Bacteria | 6922523 |
| 204 | 2878763461 | 2878760144 | Bacteria | 6823465 |
| 205 | 2878770459 | 2878767105 | Bacteria | 6898628 |
| 206 | 2878776579 | 2878774303 | Bacteria | 6108671 |
| 207 | 2878784418 | 2878781027 | Bacteria | 6834456 |
| 208 | 2881147504 | 2881147464 | Bacteria | 7779814 |
| 209 | 2881164280 | 2881161766 | Bacteria | 7127907 |
| 210 | 2881853068 | 2881845957 | Bacteria | 6611900 |
| 211 | 2881859210 | 2881853255 | Bacteria | 6698367 |
| 212 | 2881868861 | 2881861095 | Bacteria | 7128710 |
| 213 | 2882632877 | 2882632389 | Bacteria | 8154593 |
| 214 | 2882917596 | 2882912400 | Bacteria | 6801539 |
| 215 | 2885306144 | 2885305155 | Bacteria | 7348390 |
| 216 | 2885314800 | 2885312484 | Bacteria | 6415165 |
| 217 | 2885320303 | 2885318864 | Bacteria | 6729568 |
| 218 | 2885331223 | 2885326080 | Bacteria | 7134805 |
| 219 | 2885337707 | 2885334103 | Bacteria | 7216818 |
| 220 | 2885346798 | 2885342637 | Bacteria | 7011821 |
| 221 | 2885353847 | 2885350715 | Bacteria | 6787678 |
| 222 | 2888342595 | 2888337043 | Bacteria | 6629336 |
| 223 | 2888352161 | 2888350351 | Bacteria | 7372807 |
| 224 | 2889014151 | 2889010040 | Bacteria | 6749192 |
| 225 | 2889021143 | 2889016732 | Bacteria | 6700763 |
| 226 | 2897804114 | 2897803580 | Bacteria | 7000062 |
| 227 | 2903454758 | 2903448605 | Bacteria | 7357801 |
| 228 | 2903494800 | 2903492973 | Bacteria | 13473544 |
| 229 | 2903499419 | 2903492973 | Bacteria | 13473544 |
| 230 | 2903525118 | 2903521522 | Bacteria | 6525694 |
| 231 | 2903532138 | 2903528002 | Bacteria | 6586099 |
| 232 | 2903544076 | 2903540706 | Bacteria | 7062119 |
| 233 | 2904659742 | 2904659560 | Bacteria | 6685615 |
| 234 | 2906315092 | 2906308376 | Bacteria | 6841989 |
| 235 | 2906321348 | 2906321335 | Bacteria | 6579571 |
| 236 | 2906334661 | 2906328253 | Bacteria | 6585166 |
| 237 | 2906362884 | 2906354277 | Bacteria | 6991324 |
| 238 | 2906366212 | 2906363423 | Bacteria | 6856682 |
| 239 | 2906376183 | 2906370794 | Bacteria | 6881062 |
| 240 | 2906383118 | 2906378014 | Bacteria | 6911440 |
| 241 | 2906392359 | 2906386501 | Bacteria | 5977019 |
| 242 | 2906407555 | 2906401398 | Bacteria | 6693206 |
| 243 | 2906411521 | 2906408224 | Bacteria | 6162342 |
| 244 | 2906414993 | 2906414383 | Bacteria | 6580790 |
| 245 | 2906433185 | 2906427513 | Bacteria | 6375796 |
| 246 | 2922133932 | 2922130491 | Bacteria | 7173936 |
| 247 | 2922154220 | 2922151315 | Bacteria | 6902399 |
| 248 | 2922164389 | 2922158528 | Bacteria | 6573167 |
| 249 | 2922174070 | 2922172374 | Bacteria | 6167644 |
| 250 | 2922179149 | 2922178524 | Bacteria | 6025201 |
| 251 | 2924723442 | 2924718760 | Bacteria | 6331356 |
| 252 | 2924729892 | 2924726620 | Bacteria | 6271473 |
| 253 | 2924735769 | 2924733363 | Bacteria | 7574837 |
| 254 | 2924750236 | 2924748358 | Bacteria | 6154725 |
| 255 | 2924767586 | 2924762789 | Bacteria | 6561353 |
| 256 | 2924777835 | 2924776078 | Bacteria | 7492003 |
| 257 | 2924791318 | 2924784321 | Bacteria | 7416538 |
| 258 | 2937821633 | 2937813078 | Bacteria | 7783518 |
| 259 | 2937825904 | 2937822353 | Bacteria | 7290551 |
| 260 | 2937853360 | 2937848649 | Bacteria | 6983481 |
| 261 | 2937865388 | 2937861824 | Bacteria | 6660327 |
| 262 | 2937877073 | 2937868953 | Bacteria | 6639878 |
| 263 | 2937884397 | 2937877337 | Bacteria | 7246526 |
| 264 | 2937892357 | 2937891427 | Bacteria | 6357007 |
| 265 | 2937980420 | 2937972304 | Bacteria | 7532020 |
| 266 | 2937981538 | 2937980651 | Bacteria | 6517427 |
| 267 | 2937997921 | 2937994558 | Bacteria | 7036190 |
| 268 | 2938017252 | 2938014810 | Bacteria | 6700592 |
| 269 | 2958035790 | 2958034702 | Bacteria | 6989922 |
| 270 | 2958044821 | 2958041894 | Bacteria | 13082850 |
| 271 | 2958052177 | 2958041894 | Bacteria | 13082850 |
| 272 | 2958066624 | 2958064165 | Bacteria | 7158582 |
| 273 | 2958091708 | 2958084443 | Bacteria | 7312792 |
| 274 | 2958101403 | 2958100919 | Bacteria | 6800575 |
| 275 | 2958112134 | 2958108152 | Bacteria | 6681128 |
| 276 | 2958119782 | 2958115193 | Bacteria | 6923548 |
| 277 | 2958125223 | 2958122699 | Bacteria | 7280457 |
| 278 | 2958136758 | 2958130278 | Bacteria | 6897202 |
| 279 | 2958144031 | 2958137437 | Bacteria | 6050276 |
| 280 | 2958145655 | 2958144490 | Bacteria | 6677056 |
| 281 | 2958161627 | 2958158011 | Bacteria | 6058449 |
| 282 | 2958168396 | 2958165035 | Bacteria | 6906348 |
| 283 | 2958179454 | 2958172287 | Bacteria | 6716688 |
| 284 | 2958186641 | 2958179912 | Bacteria | 6874908 |
| 285 | 2961085142 | 2961077736 | Bacteria | 7079850 |
| 286 | 2961115066 | 2961114664 | Bacteria | 6680456 |
| 287 | 2961128275 | 2961127735 | Bacteria | 7196641 |
| 288 | 2961137045 | 2961136820 | Bacteria | 6775228 |
| 289 | 2961166860 | 2961163497 | Bacteria | 6901077 |
| 290 | 2961176859 | 2961170736 | Bacteria | 7072258 |
| 291 | 2961190607 | 2961183825 | Bacteria | 6688536 |
| 292 | 2963651047 | 2963644680 | Bacteria | 6530403 |
| 293 | 2965021684 | 2965018300 | Bacteria | 6883036 |
| 294 | 2965028954 | 2965025482 | Bacteria | 6532201 |
| 295 | 2965034490 | 2965032056 | Bacteria | 6887443 |
| 296 | 2965044163 | 2965040258 | Bacteria | 6855979 |
| 297 | 2965055050 | 2965047637 | Bacteria | 6623551 |
| 298 | 2965068113 | 2965062239 | Bacteria | 7412989 |
| 299 | 2965090088 | 2965089291 | Bacteria | 6866420 |
| 300 | 2965103141 | 2965102966 | Bacteria | 6800987 |
| 301 | 2965114363 | 2965110997 | Bacteria | 6693150 |
| 302 | 2965121617 | 2965119406 | Bacteria | 6956431 |
| 303 | 2968001034 | 2967996073 | Bacteria | 6787468 |
| 304 | 2968007087 | 2968003550 | Bacteria | 6929263 |
| 305 | 2968021520 | 2968016561 | Bacteria | 7022047 |
| 306 | 2968089097 | 2968083720 | Bacteria | 7351627 |
| 307 | 2968093037 | 2968091066 | Bacteria | 6052692 |
| 308 | 2968102675 | 2968097103 | Bacteria | 6107094 |
| 309 | 2968110794 | 2968110612 | Bacteria | 6814636 |
| 310 | 2968121479 | 2968117919 | Bacteria | 6536078 |
| 311 | 2968131488 | 2968128360 | Bacteria | 6270294 |
| 312 | 2968143413 | 2968138860 | Bacteria | 6605449 |
| 313 | 2968175266 | 2968171901 | Bacteria | 6894245 |
| 314 | 2970476801 | 2970469710 | Bacteria | 6969209 |
| 315 | 2970494259 | 2970489779 | Bacteria | 6517260 |
| 316 | 2970509531 | 2970503327 | Bacteria | 7099517 |
| 317 | 2970515061 | 2970510686 | Bacteria | 7006402 |
| 318 | 2970537569 | 2970532167 | Bacteria | 6553173 |
| 319 | 2970552259 | 2970547951 | Bacteria | 6931819 |
| 320 | 2970558304 | 2970554993 | Bacteria | 6814252 |
| 321 | 2970594522 | 2970593180 | Bacteria | 7073582 |
| 322 | 2970633989 | 2970627176 | Bacteria | 6680862 |
| 323 | 2977824239 | 2977821940 | Bacteria | 6906439 |
| 324 | 2977834639 | 2977828996 | Bacteria | 7007971 |
| 325 | 2977850141 | 2977843712 | Bacteria | 6753583 |
| 326 | 2977852387 | 2977851361 | Bacteria | 6694324 |
| 327 | 2977860876 | 2977858184 | Bacteria | 6215359 |
| 328 | 2977868432 | 2977864932 | Bacteria | 7534097 |
| 329 | 2977875266 | 2977872689 | Bacteria | 7270173 |
| 330 | 2977904140 | 2977898635 | Bacteria | 6675551 |
| 331 | 2977915918 | 2977915119 | Bacteria | 6829656 |
| 332 | 2977927275 | 2977922695 | Bacteria | 6956781 |
| 333 | 2977940011 | 2977935797 | Bacteria | 6252826 |
| 334 | 2977949612 | 2977942078 | Bacteria | 7570577 |
| 335 | 2977952984 | 2977950692 | Bacteria | 6893264 |
| 336 | 2977957817 | 2977957713 | Bacteria | 6877875 |
| 337 | 2977991395 | 2977986579 | Bacteria | 6581278 |
| 338 | 2979715155 | 2979710463 | Bacteria | 6785254 |
| 339 | 2979766289 | 2979764755 | Bacteria | 6610066 |
| 340 | 2979774416 | 2979772303 | Bacteria | 6618277 |
| 341 | 2979785713 | 2979779861 | Bacteria | 6219781 |
| 342 | 2979800514 | 2979793036 | Bacteria | 6808957 |
| 343 | 2979814319 | 2979808191 | Bacteria | 7179355 |
| 344 | 2987642363 | 2987636660 | Bacteria | 8088555 |
| 345 | 2987646704 | 2987645492 | Bacteria | 6117018 |
| 346 | 2987654357 | 2987652177 | Bacteria | 6969023 |
| 347 | 2987662872 | 2987659509 | Bacteria | 6966464 |
| 348 | 2987668058 | 2987666974 | Bacteria | 6509233 |
| 349 | 2987677401 | 2987673487 | Bacteria | 6884027 |
| 350 | 2995396069 | 2995392953 | Bacteria | 4539380 |
| 351 | 2996312748 | 2996310559 | Bacteria | 6357320 |
| 352 | 2996346386 | 2996341866 | Bacteria | 6643098 |
| 353 | 2996356226 | 2996348954 | Bacteria | 7239054 |
| 354 | 2996393608 | 2996386984 | Bacteria | 6978667 |
| 355 | 3000135829 | 3000135777 | Bacteria | 6891109 |
| 356 | 3004172431 | 3004167301 | Bacteria | 8330599 |
| 357 | 3004191924 | 3004188549 | Bacteria | 6952365 |
| 358 | 3004201024 | 3004195979 | Bacteria | 6776956 |
| 359 | 3004210444 | 3004203850 | Bacteria | 7307914 |
| 360 | 3004216800 | 3004211236 | Bacteria | 7417683 |
| 361 | 3004219833 | 3004218560 | Bacteria | 7421728 |
| 362 | 3004235201 | 3004232784 | Bacteria | 6662140 |
| 363 | 3004244937 | 3004239961 | Bacteria | 6892290 |
| 364 | 3004254556 | 3004248173 | Bacteria | 6563236 |
| 365 | 3004269623 | 3004268573 | Bacteria | 7043476 |
| 366 | 3004282540 | 3004275668 | Bacteria | 7114440 |
| 367 | 3004338175 | 3004334049 | Bacteria | 8449246 |
| 368 | 637077741 | 637000159 | Bacteria | 7596297 |
| 369 | 649875753 | 649633066 | Bacteria | 6690028 |
| 370 | 8002288479 | 8002285264 | Bacteria | 6717907 |
| 371 | 8004306329 | 8004300914 | Bacteria | 6132239 |
| 372 | 8004315956 | 8004312739 | Bacteria | 7444653 |
| 373 | 8004364514 | 8004361976 | Bacteria | 6858373 |
| 374 | 8004376678 | 8004374579 | Bacteria | 6898112 |
| 375 | 8004395032 | 8004387939 | Bacteria | 7049250 |
| 376 | 8004447747 | 8004445564 | Bacteria | 6322258 |
| 377 | 8004647026 | 8004640170 | Bacteria | 6723001 |
| 378 | 8004695629 | 8004695233 | Bacteria | 6731676 |
| 379 | 8004707366 | 8004703790 | Bacteria | 8006957 |
| 380 | 8004721353 | 8004714634 | Bacteria | 6776161 |
| 381 | 8004732821 | 8004727605 | Bacteria | 6643904 |
| 382 | 8054004089 | 8054002106 | Bacteria | 7987183 |
| 383 | JGI25406J46586_10002159 | |||
| 384 | Ga0070698_100044679 | |||
| 385 | Ga0070679_100008641 | |||
| 386 | Ga0081540_1006065 | |||
| 387 | Ga0081539_10003188 | |||
| 388 | Ga0075365_10044286 | |||
| 389 | Ga0075431_100014499 | |||
| 390 | Ga0075434_100445586 | |||
| 391 | Ga0114129_10037925 | |||
| 392 | Ga0157369_10164758 | |||
| 393 | Ga0209676_1009037 | |||
| 394 | Ga0207707_10237738 | |||
| 395 | Ga0207671_10028017 | |||
| 396 | Ga0207667_10205938 | |||
| 397 | Ga0268266_10093957 | |||
| 398 | Ga0265338_10163854 | |||
| 399 | Ga0265328_10003167 | |||
| 400 | Ga0265328_10003368 | |||
| 401 | Ga0265320_10001543 | |||
| 402 | Ga0265320_10002449 | |||
| 403 | Ga0265340_10019100 | |||
| 404 | Ga0265331_10000019 | |||
| 405 | Ga0265327_10011547 | |||
| 406 | Ga0265316_10124243 | |||
| 407 | Ga0307513_10019071 | |||
| 408 | Ga0265313_10000045 | |||
| 409 | Ga0265313_10000265 | |||
| 410 | Ga0265313_10003982 | |||
| 411 | Ga0265313_10058100 | |||
| 412 | Ga0265314_10001952 | |||
| 413 | Ga0265342_10008292 | |||
| 414 | Ga0316576_10084860 | |||
| 415 | Ga0316578_10048582 | |||
| 416 | Ga0307510_10117227 | |||
| 417 | Ga0316582_0028572 | |||
| 418 | Ga0316584_0045962 | |||
| 419 | Ga0395899_0000014 | |||
| 420 | Ga0395900_0000007 | |||
| 421 | Ga0395898_0000011 | |||
| 422 | Ga0395905_0000008 | |||
| 423 | Ga0395901_0000020 | |||
| 424 | Ga0453684_0028732 | |||
| 425 | Ga0453684_0065463 | |||
| 426 | Ga0453684_0067875 | |||
| 427 | Ga0453684_0129325 | |||
| 428 | Ga0466959_0001203 | |||
| 429 | Ga0495643_0050682 | |||
| 430 | Ga0495675_0141705 | |||
| 431 | Ga0495686_0044304 | |||
| 432 | Ga0495602_0207963 | |||
| 433 | Ga0496112_0026649 | |||
| 434 | Ga0496122_0056154 | |||
| 435 | Ga0496126_0241796 | |||
| 436 | Ga0501031_0000003 | |||
| 437 | Ga0501031_0002943 | |||
| 438 | Ga0501031_0007990 | |||
| 439 | Ga0501032_0000001 | |||
| 440 | Ga0501032_0000010 | |||
| 441 | Ga0501033_0000017 | |||
| 442 | Ga0501033_0000198 | |||
| 443 | Ga0501033_0018963 | |||
| 444 | Ga0501034_0000036 | |||
| 445 | Ga0501034_0000053 | |||
| 446 | Ga0501034_0024750 | |||
| 447 | Ga0501034_0061842 | |||
| 448 | Ga0501036_0000009 | |||
| 449 | Ga0501036_0000046 | |||
| 450 | Ga0501036_0017430 | |||
| 451 | Ga0501036_0036804 | |||
| 452 | Ga0501036_0059444 | |||
| 453 | Ga0501037_0000008 | |||
| 454 | Ga0501037_0000017 | |||
| 455 | Ga0501038_0000008 | |||
| 456 | Ga0501038_0000153 | |||
| 457 | Ga0501038_0057734 | |||
| 458 | Ga0501039_0000011 | |||
| 459 | Ga0501039_0000021 | |||
| 460 | Ga0501039_0005545 | |||
| 461 | Ga0501039_0031625 | |||
| 462 | Ga0501040_0071601 | |||
| 463 | Ga0501041_0026319 | |||
| 464 | Ga0501042_0009424 | |||
| 465 | Ga0501043_0000016 | |||
| 466 | Ga0501043_0000279 | |||
| 467 | Ga0501043_0086923 | |||
| 468 | Ga0501046_0102316 | |||
| 469 | Ga0501047_0000126 | |||
| 470 | Ga0501047_0061415 | |||
| 471 | Ga0501047_0072597 | |||
| 472 | Ga0501047_0174808 | |||
| 473 | Ga0501048_0001737 | |||
| 474 | Ga0501070_0022835 | |||
| 475 | Ga0501071_0005968 | |||
| 476 | Ga0501072_0002106 | |||
| 477 | Ga0501073_0202643 | |||
| 478 | Ga0501074_0011270 | |||
| 479 | Ga0501074_0066609 | |||
| 480 | Ga0501076_0073871 | |||
| 481 | Ga0501077_0135106 | |||
| 482 | Ga0501079_0017771 | |||
| 483 | Ga0501080_0066765 | |||
| 484 | Ga0501083_0031677 | |||
| 485 | Ga0501083_0117179 | |||
| 486 | Ga0501035_0000023 | |||
| 487 | Ga0501035_0000028 | |||
| 488 | Ga0501035_0010550 | |||
| 489 | Ga0501044_0000021 | |||
| 490 | Ga0501044_0038117 | |||
| 491 | Ga0501044_0042037 | |||
| 492 | Ga0501045_0008298 | |||
| 493 | nmdc:mga06z11_24835_c1 | |||
| 494 | nmdc:mga05p37_63210_c1 | |||
| 495 | nmdc:mga0qj67_48728_c1 | |||
| 496 | nmdc:mga06r32_5391_c1 | |||
| 497 | Ga0495601_0062267 | |||
| 498 | Ga0495595_0052400 | |||
| 499 | Ga0495619_0053508 | |||
| 500 | Ga0500643_005923 | |||
| 501 | Ga0500644_0024829 | |||
| 502 | Ga0500642_0004989 | |||
| 503 | Ga0500604_0025014 | |||
| 504 | Ga0500616_0071406 | |||
| 505 | Ga0500627_0046477 | |||
| 506 | Ga0501084_0057718 | |||
| 507 | Ga0466962_0025410 | |||
| 508 | Ga0530510_0138494 | |||
| 509 | 2871443863 | |||
| 510 | 2503204695 | |||
| 511 | 2509113537 | |||
| 512 | 2509370223 | |||
| 513 | 2509398954 | |||
| 514 | 2510314294 | |||
| 515 | 2512032205 | |||
| 516 | 2512934570 | |||
| 517 | 2513613542 | |||
| 518 | 2514416942 | |||
| 519 | 2523105390 | |||
| 520 | 2588514177 | |||
| 521 | 2599102239 | |||
| 522 | 2599935856 | |||
| 523 | 2643772248 | |||
| 524 | 2643836604 | |||
| 525 | 2643984907 | |||
| 526 | 2644155520 | |||
| 527 | 2688601324 | |||
| 528 | 2694630446 | |||
| 529 | 2694637769 | |||
| 530 | 2723578489 | |||
| 531 | 2756674668 | |||
| 532 | 2792746459 | |||
| 533 | 2844004226 | |||
| 534 | 2844009984 | |||
| 535 | 2846956902 | |||
| 536 | 2847672854 | |||
| 537 | 2847689328 | |||
| 538 | 2848861407 | |||
| 539 | 2856314804 | |||
| 540 | 2856327972 | |||
| 541 | 2856332147 | |||
| 542 | 2856335135 | |||
| 543 | 2856360696 | |||
| 544 | 2856371135 | |||
| 545 | 2857372841 | |||
| 546 | 2869164634 | |||
| 547 | 2869174867 | |||
| 548 | 2869242110 | |||
| 549 | 2869253920 | |||
| 550 | 2869263683 | |||
| 551 | 2869270311 | |||
| 552 | 2869275907 | |||
| 553 | 2869279923 | |||
| 554 | 2869292358 | |||
| 555 | 2871429173 | |||
| 556 | 2871445372 | |||
| 557 | 2871455307 | |||
| 558 | 2871460787 | |||
| 559 | 2871470948 | |||
| 560 | 2871485429 | |||
| 561 | 2871490696 | |||
| 562 | 2871499271 | |||
| 563 | 2874108921 | |||
| 564 | 2874114365 | |||
| 565 | 2874121851 | |||
| 566 | 2874129621 | |||
| 567 | 2874132429 | |||
| 568 | 2874145583 | |||
| 569 | 2874154079 | |||
| 570 | 2874161581 | |||
| 571 | 2874162673 | |||
| 572 | 2874171649 | |||
| 573 | 2876363168 | |||
| 574 | 2876376360 | |||
| 575 | 2876385077 | |||
| 576 | 2876388497 | |||
| 577 | 2876393036 | |||
| 578 | 2876404321 | |||
| 579 | 2876419763 | |||
| 580 | 2876427610 | |||
| 581 | 2878036115 | |||
| 582 | 2878738729 | |||
| 583 | 2878740235 | |||
| 584 | 2878752701 | |||
| 585 | 2878755099 | |||
| 586 | 2878763461 | |||
| 587 | 2878770459 | |||
| 588 | 2878776579 | |||
| 589 | 2878784418 | |||
| 590 | 2881147504 | |||
| 591 | 2881164280 | |||
| 592 | 2881853068 | |||
| 593 | 2881859210 | |||
| 594 | 2881868861 | |||
| 595 | 2882632877 | |||
| 596 | 2882917596 | |||
| 597 | 2885306144 | |||
| 598 | 2885314800 | |||
| 599 | 2885320303 | |||
| 600 | 2885331223 | |||
| 601 | 2885337707 | |||
| 602 | 2885346798 | |||
| 603 | 2885353847 | |||
| 604 | 2888342595 | |||
| 605 | 2888352161 | |||
| 606 | 2889014151 | |||
| 607 | 2889021143 | |||
| 608 | 2897804114 | |||
| 609 | 2903454758 | |||
| 610 | 2903494800 | |||
| 611 | 2903499419 | |||
| 612 | 2903525118 | |||
| 613 | 2903532138 | |||
| 614 | 2903544076 | |||
| 615 | 2904659742 | |||
| 616 | 2906315092 | |||
| 617 | 2906321348 | |||
| 618 | 2906334661 | |||
| 619 | 2906362884 | |||
| 620 | 2906366212 | |||
| 621 | 2906376183 | |||
| 622 | 2906383118 | |||
| 623 | 2906392359 | |||
| 624 | 2906407555 | |||
| 625 | 2906411521 | |||
| 626 | 2906414993 | |||
| 627 | 2906433185 | |||
| 628 | 2922133932 | |||
| 629 | 2922154220 | |||
| 630 | 2922164389 | |||
| 631 | 2922174070 | |||
| 632 | 2922179149 | |||
| 633 | 2924723442 | |||
| 634 | 2924729892 | |||
| 635 | 2924735769 | |||
| 636 | 2924750236 | |||
| 637 | 2924767586 | |||
| 638 | 2924777835 | |||
| 639 | 2924791318 | |||
| 640 | 2937821633 | |||
| 641 | 2937825904 | |||
| 642 | 2937853360 | |||
| 643 | 2937865388 | |||
| 644 | 2937877073 | |||
| 645 | 2937884397 | |||
| 646 | 2937892357 | |||
| 647 | 2937980420 | |||
| 648 | 2937981538 | |||
| 649 | 2937997921 | |||
| 650 | 2938017252 | |||
| 651 | 2958035790 | |||
| 652 | 2958044821 | |||
| 653 | 2958052177 | |||
| 654 | 2958066624 | |||
| 655 | 2958091708 | |||
| 656 | 2958101403 | |||
| 657 | 2958112134 | |||
| 658 | 2958119782 | |||
| 659 | 2958125223 | |||
| 660 | 2958136758 | |||
| 661 | 2958144031 | |||
| 662 | 2958145655 | |||
| 663 | 2958161627 | |||
| 664 | 2958168396 | |||
| 665 | 2958179454 | |||
| 666 | 2958186641 | |||
| 667 | 2961085142 | |||
| 668 | 2961115066 | |||
| 669 | 2961128275 | |||
| 670 | 2961137045 | |||
| 671 | 2961166860 | |||
| 672 | 2961176859 | |||
| 673 | 2961190607 | |||
| 674 | 2963651047 | |||
| 675 | 2965021684 | |||
| 676 | 2965028954 | |||
| 677 | 2965034490 | |||
| 678 | 2965044163 | |||
| 679 | 2965055050 | |||
| 680 | 2965068113 | |||
| 681 | 2965090088 | |||
| 682 | 2965103141 | |||
| 683 | 2965114363 | |||
| 684 | 2965121617 | |||
| 685 | 2968001034 | |||
| 686 | 2968007087 | |||
| 687 | 2968021520 | |||
| 688 | 2968089097 | |||
| 689 | 2968093037 | |||
| 690 | 2968102675 | |||
| 691 | 2968110794 | |||
| 692 | 2968121479 | |||
| 693 | 2968131488 | |||
| 694 | 2968143413 | |||
| 695 | 2968175266 | |||
| 696 | 2970476801 | |||
| 697 | 2970494259 | |||
| 698 | 2970509531 | |||
| 699 | 2970515061 | |||
| 700 | 2970537569 | |||
| 701 | 2970552259 | |||
| 702 | 2970558304 | |||
| 703 | 2970594522 | |||
| 704 | 2970633989 | |||
| 705 | 2977824239 | |||
| 706 | 2977834639 | |||
| 707 | 2977850141 | |||
| 708 | 2977852387 | |||
| 709 | 2977860876 | |||
| 710 | 2977868432 | |||
| 711 | 2977875266 | |||
| 712 | 2977904140 | |||
| 713 | 2977915918 | |||
| 714 | 2977927275 | |||
| 715 | 2977940011 | |||
| 716 | 2977949612 | |||
| 717 | 2977952984 | |||
| 718 | 2977957817 | |||
| 719 | 2977991395 | |||
| 720 | 2979715155 | |||
| 721 | 2979766289 | |||
| 722 | 2979774416 | |||
| 723 | 2979785713 | |||
| 724 | 2979800514 | |||
| 725 | 2979814319 | |||
| 726 | 2987642363 | |||
| 727 | 2987646704 | |||
| 728 | 2987654357 | |||
| 729 | 2987662872 | |||
| 730 | 2987668058 | |||
| 731 | 2987677401 | |||
| 732 | 2995396069 | |||
| 733 | 2996312748 | |||
| 734 | 2996346386 | |||
| 735 | 2996356226 | |||
| 736 | 2996393608 | |||
| 737 | 3000135829 | |||
| 738 | 3004172431 | |||
| 739 | 3004191924 | |||
| 740 | 3004201024 | |||
| 741 | 3004210444 | |||
| 742 | 3004216800 | |||
| 743 | 3004219833 | |||
| 744 | 3004235201 | |||
| 745 | 3004244937 | |||
| 746 | 3004254556 | |||
| 747 | 3004269623 | |||
| 748 | 3004282540 | |||
| 749 | 3004338175 | |||
| 750 | 637077741 | |||
| 751 | 649875753 | |||
| 752 | 8002288479 | |||
| 753 | 8004306329 | |||
| 754 | 8004315956 | |||
| 755 | 8004364514 | |||
| 756 | 8004376678 | |||
| 757 | 8004395032 | |||
| 758 | 8004447747 | |||
| 759 | 8004647026 | |||
| 760 | 8004695629 | |||
| 761 | 8004707366 | |||
| 762 | 8004721353 | |||
| 763 | 8004732821 | |||
| 764 | 8054004089 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2eh6-assembly1.cif.gz_B | crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5 | 0.9626 | 4 | 384 |
| 2ord-assembly1.cif.gz_B | crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution | 0.9621 | 6 | 388 |
| 4adb-assembly1.cif.gz_A | structural and functional study of succinyl-ornithine transaminase from e. coli | 0.959 | 5 | 389 |
| 4ade-assembly2.cif.gz_B-3 | structural and functional study of succinyl-ornithine transaminase from e. coli | 0.9587 | 13 | 389 |
| 2pb0-assembly1.cif.gz_B | structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding | 0.9566 | 10 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4adeB02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9718 | 49 | 291 | 3.40.640.10 |
| 4addA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9619 | 49 | 291 | 3.40.640.10 |
| 2eh6A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9592 | 49 | 292 | 3.40.640.10 |
| 4adeB02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.954 | 49 | 291 | 3.40.640.10 |
| 2eh6A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9516 | 49 | 292 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3E122-F1-model_v4 | Acetylornithine transaminase (EC 2.6.1.11) | 0.9941 | 315 | 389 |
GO:0003992
GO:0030170 GO:0042802 |
| AF-A0A2E6CB88-F1-model_v4 | Acetylornithine aminotransferase (ACOAT) (EC 2.6.1.11) | 0.9745 | 9 | 391 |
GO:0003992
GO:0005737 GO:0006526 GO:0030170 GO:0042802 |
| AF-A0A352GHL9-F1-model_v4 | Acetylornithine transaminase (EC 2.6.1.11) | 0.9744 | 122 | 389 |
GO:0003992
GO:0030170 GO:0042802 |
| AF-A0A8A8PLS6-F1-model_v4 | deleted | 0.9742 | 2 | 389 |
|
| AF-A0A7X8K1E8-F1-model_v4 | Aspartate aminotransferase family protein | 0.9738 | 42 | 391 |
GO:0003992
GO:0005737 GO:0006526 GO:0030170 GO:0042802 |