F429451

General Info

Members Datasets Scaffolds Average Seq Length
382 343 764 396

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2871435913|2871443863
Length 386
Sequence ALYETFARAPLAFDHGEGTWLVTDKGERYLDFAGGIAVNSLGHSHPHLVAALTEQAAKLWHVSNLYEIPGQSRLXXXXFFTNSGAEALECAIKTARRYHFVKGNPERFRVITFEGAFHGRTLATIAAGGQYKYLEGFGPKVEGFDQVGFDDIDAAEKAITPETAAILIEPVQGEGGIRPVPTQSLKRLRQLCEQHGLLLIYDEVQCGIGRTGKLFAHEWSGVTPDIMAIAKGIGGGFPMGACLATDEAAVGMTAGVHGTTFGGNPLAMAVGNAVLDVVLEDGFLEDVQRKALLMKQGLASVADEFPEIIEDIRGAGLMLGLKCAMPNTKVNMALRDQHLLAVPAGDNVIRLLPPLTVTDAEIHDALNRIRAGAKGLAEAIASAAAK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
3 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
4 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
7 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
8 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
9 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
10 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
11 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
17 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
18 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
19 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
20 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
21 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
22 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
23 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
24 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
25 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
26 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
27 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
28 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
29 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
30 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
31 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
32 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
33 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
34 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
35 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
36 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
37 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
38 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
39 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
40 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
41 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
42 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
43 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
44 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
45 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
46 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
47 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
48 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
49 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
51 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
53 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
62 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
63 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
64 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
65 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
66 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
67 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
68 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
69 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
70 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
71 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
74 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
75 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
76 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
77 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
78 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
79 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
80 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
81 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
82 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
83 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
84 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
85 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
86 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
87 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
88 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
89 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
90 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
91 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
92 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
93 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
94 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
95 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
96 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
97 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
98 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
99 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
100 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
101 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
102 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
103 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
104 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
105 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
106 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
107 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
108 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
109 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
110 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
111 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
112 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
113 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
114 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
115 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
116 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
117 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
118 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
119 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
120 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
121 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
122 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
123 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
124 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
125 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
126 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
127 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
128 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
129 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
130 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
131 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
132 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
133 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
134 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
135 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
136 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
137 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
138 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
139 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
140 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
141 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
142 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
143 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
144 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
145 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
146 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
147 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
148 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
149 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
150 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
151 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
152 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
153 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
154 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
155 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
156 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
157 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
158 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
159 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
160 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
161 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
162 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
163 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
164 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
165 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
166 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
167 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
168 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
169 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
170 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
171 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
172 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
173 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
174 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
175 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
176 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
177 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
178 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
179 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
180 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
181 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
182 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
183 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
184 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
185 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
186 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
187 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
188 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
189 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
190 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
191 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
192 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
193 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
194 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
195 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
196 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
197 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
198 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
199 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
200 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
201 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
202 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
203 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
204 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
205 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
206 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
207 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
208 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
209 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
210 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
211 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
212 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
213 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
214 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
215 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
216 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
217 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
218 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
219 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
220 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
221 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
222 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
223 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
224 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
225 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
226 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
227 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
228 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
229 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
230 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
231 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
232 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
233 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
234 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
235 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
236 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
237 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
238 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
239 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
240 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
241 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
242 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
243 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
244 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
245 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
246 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
247 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
248 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
249 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
250 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
251 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
252 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
253 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
254 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
255 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
256 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
257 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
258 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
259 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
260 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
261 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
262 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
263 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
264 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
265 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
266 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
267 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
268 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
269 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
270 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
271 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
272 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
273 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
274 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
275 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
276 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
277 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
278 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
279 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
280 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
281 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
282 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
283 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
284 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
285 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
286 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
287 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
288 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
289 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
290 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
291 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
292 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
293 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
294 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
295 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
296 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
297 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
298 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
299 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
300 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
301 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
302 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
303 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
304 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
305 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
306 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
307 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
308 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
309 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
310 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
311 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
312 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
313 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
314 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
315 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
316 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
317 3004167301 Mesorhizobium loti 582 Isolate Unclassified
318 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
319 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
320 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
321 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
322 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
323 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
324 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
325 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
326 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
327 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
328 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
329 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
330 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
331 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
332 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
333 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
334 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
335 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
336 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
337 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
338 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
339 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
340 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
341 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
342 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
343 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 32.98
Metatranscriptomes 0
Isolates 67.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.36
Nodule 57.07
Rhizoplane 0.52
Rhizosphere 30.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002159 3300003203 Bacteria 9302
2 Ga0070698_100044679 3300005471 Bacteria 4534
3 Ga0070679_100008641 3300005530 Bacteria 9598
4 Ga0081540_1006065 3300005983 Bacteria 8886
5 Ga0081539_10003188 3300005985 Bacteria 20756
6 Ga0075365_10044286 3300006038 Bacteria 2915
7 Ga0075431_100014499 3300006847 Bacteria 7974
8 Ga0075434_100445586 3300006871 Bacteria 1316
9 Ga0114129_10037925 3300009147 Bacteria 6799
10 Ga0157369_10164758 3300013105 Bacteria 2338
11 Ga0209676_1009037 3300025292 Bacteria 4353
12 Ga0207707_10237738 3300025912 Bacteria 1584
13 Ga0207671_10028017 3300025914 Bacteria 4210
14 Ga0207667_10205938 3300025949 Bacteria 2017
15 Ga0268266_10093957 3300028379 Bacteria 2632
16 Ga0265338_10163854 3300028800 Bacteria 1714
17 Ga0265328_10003167 3300031239 Bacteria 7310
18 Ga0265328_10003368 3300031239 Bacteria 7066
19 Ga0265320_10001543 3300031240 Bacteria 16648
20 Ga0265320_10002449 3300031240 Bacteria 12925
21 Ga0265340_10019100 3300031247 Bacteria 3529
22 Ga0265331_10000019 3300031250 Bacteria 258837
23 Ga0265327_10011547 3300031251 Bacteria 6065
24 Ga0265316_10124243 3300031344 Bacteria 1947
25 Ga0307513_10019071 3300031456 Bacteria 8176
26 Ga0265313_10000045 3300031595 Bacteria 114646
27 Ga0265313_10000265 3300031595 Bacteria 57291
28 Ga0265313_10003982 3300031595 Bacteria 11601
29 Ga0265313_10058100 3300031595 Bacteria 1824
30 Ga0265314_10001952 3300031711 Bacteria 21949
31 Ga0265342_10008292 3300031712 Bacteria 7477
32 Ga0316576_10084860 3300031727 Bacteria 2354
33 Ga0316578_10048582 3300031728 Bacteria 2478
34 Ga0307510_10117227 3300033180 Bacteria 2381
35 Ga0316582_0028572 3300036647 Bacteria 3380
36 Ga0316584_0045962 3300036712 Bacteria 3260
37 Ga0395899_0000014 3300037312 Bacteria 488813
38 Ga0395900_0000007 3300037418 Bacteria 488860
39 Ga0395898_0000011 3300037466 Bacteria 488860
40 Ga0395905_0000008 3300037471 Bacteria 488860
41 Ga0395901_0000020 3300038443 Bacteria 314918
42 Ga0453684_0028732 3300044712 Bacteria 7920
43 Ga0453684_0065463 3300044712 Bacteria 4635
44 Ga0453684_0067875 3300044712 Bacteria 4532
45 Ga0453684_0129325 3300044712 Bacteria 3032
46 Ga0466959_0001203 3300045049 Bacteria 15629
47 Ga0495643_0050682 3300046522 Bacteria 2235
48 Ga0495675_0141705 3300047444 Bacteria 1490
49 Ga0495686_0044304 3300047472 Bacteria 2817
50 Ga0495602_0207963 3300048088 Bacteria 1488
51 Ga0496112_0026649 3300048915 Bacteria 5567
52 Ga0496122_0056154 3300048925 Bacteria 2938
53 Ga0496126_0241796 3300048929 Bacteria 1508
54 Ga0501031_0000003 3300049568 Bacteria 206821
55 Ga0501031_0002943 3300049568 Bacteria 10896
56 Ga0501031_0007990 3300049568 Bacteria 6887
57 Ga0501032_0000001 3300049569 Bacteria 422097
58 Ga0501032_0000010 3300049569 Bacteria 206795
59 Ga0501033_0000017 3300049570 Bacteria 206819
60 Ga0501033_0000198 3300049570 Bacteria 57365
61 Ga0501033_0018963 3300049570 Bacteria 5199
62 Ga0501034_0000036 3300049571 Bacteria 239274
63 Ga0501034_0000053 3300049571 Bacteria 206821
64 Ga0501034_0024750 3300049571 Bacteria 6107
65 Ga0501034_0061842 3300049571 Bacteria 3760
66 Ga0501036_0000009 3300049572 Bacteria 206821
67 Ga0501036_0000046 3300049572 Bacteria 76444
68 Ga0501036_0017430 3300049572 Bacteria 6004
69 Ga0501036_0036804 3300049572 Bacteria 4140
70 Ga0501036_0059444 3300049572 Bacteria 3239
71 Ga0501037_0000008 3300049573 Bacteria 206812
72 Ga0501037_0000017 3300049573 Bacteria 157276
73 Ga0501038_0000008 3300049574 Bacteria 206821
74 Ga0501038_0000153 3300049574 Bacteria 59196
75 Ga0501038_0057734 3300049574 Bacteria 3331
76 Ga0501039_0000011 3300049575 Bacteria 245124
77 Ga0501039_0000021 3300049575 Bacteria 162552
78 Ga0501039_0005545 3300049575 Bacteria 9548
79 Ga0501039_0031625 3300049575 Bacteria 4080
80 Ga0501040_0071601 3300049576 Bacteria 2393
81 Ga0501041_0026319 3300049577 Bacteria 3499
82 Ga0501042_0009424 3300049578 Bacteria 6507
83 Ga0501043_0000016 3300049579 Bacteria 170869
84 Ga0501043_0000279 3300049579 Bacteria 46075
85 Ga0501043_0086923 3300049579 Bacteria 2457
86 Ga0501046_0102316 3300049580 Bacteria 2196
87 Ga0501047_0000126 3300049581 Bacteria 93841
88 Ga0501047_0061415 3300049581 Bacteria 3626
89 Ga0501047_0072597 3300049581 Bacteria 3312
90 Ga0501047_0174808 3300049581 Bacteria 2015
91 Ga0501048_0001737 3300049582 Bacteria 16586
92 Ga0501070_0022835 3300049586 Bacteria 5236
93 Ga0501071_0005968 3300049587 Bacteria 7889
94 Ga0501072_0002106 3300049588 Bacteria 14823
95 Ga0501073_0202643 3300049589 Bacteria 1372
96 Ga0501074_0011270 3300049590 Bacteria 6499
97 Ga0501074_0066609 3300049590 Bacteria 2590
98 Ga0501076_0073871 3300049592 Bacteria 2730
99 Ga0501077_0135106 3300049593 Bacteria 1564
100 Ga0501079_0017771 3300049741 Bacteria 5434
101 Ga0501080_0066765 3300049742 Bacteria 3345
102 Ga0501083_0031677 3300049744 Bacteria 3629
103 Ga0501083_0117179 3300049744 Bacteria 1748
104 Ga0501035_0000023 3300049822 Bacteria 206821
105 Ga0501035_0000028 3300049822 Bacteria 179195
106 Ga0501035_0010550 3300049822 Bacteria 8560
107 Ga0501044_0000021 3300049823 Bacteria 206821
108 Ga0501044_0038117 3300049823 Bacteria 5019
109 Ga0501044_0042037 3300049823 Bacteria 4757
110 Ga0501045_0008298 3300049824 Bacteria 7231
111 nmdc:mga06z11_24835_c1 3300050494 Bacteria 2833
112 nmdc:mga05p37_63210_c1 3300050507 Bacteria 4555
113 nmdc:mga0qj67_48728_c1 3300050509 Bacteria 3347
114 nmdc:mga06r32_5391_c1 3300050510 Bacteria 11510
115 Ga0495601_0062267 3300053077 Bacteria 2369
116 Ga0495595_0052400 3300053084 Bacteria 1893
117 Ga0495619_0053508 3300053085 Bacteria 2670
118 Ga0500643_005923 3300053087 Bacteria 5186
119 Ga0500644_0024829 3300053088 Bacteria 1837
120 Ga0500642_0004989 3300053130 Bacteria 4230
121 Ga0500604_0025014 3300053151 Bacteria 1714
122 Ga0500616_0071406 3300053153 Bacteria 1768
123 Ga0500627_0046477 3300053158 Bacteria 1881
124 Ga0501084_0057718 3300054114 Bacteria 3247
125 Ga0466962_0025410 3300061719 Bacteria 2844
126 Ga0530510_0138494 3300061734 Bacteria 1792
127 2871443863 2871435913 Bacteria 6880295
128 2503204695 2503198000 Bacteria 6884444
129 2509113537 2508501123 Bacteria 6283661
130 2509370223 2509276018 Bacteria 6910194
131 2509398954 2509276022 Bacteria 6200534
132 2510314294 2510065059 Bacteria 6847884
133 2512032205 2511231221 Bacteria 6846400
134 2512934570 2512875016 Bacteria 6529530
135 2513613542 2513237090 Bacteria 7096802
136 2514416942 2513237305 Bacteria 7293571
137 2523105390 2522572158 Bacteria 6514390
138 2588514177 2588253730 Bacteria 6881675
139 2599102239 2597490356 Bacteria 7030811
140 2599935856 2599185301 Bacteria 6161860
141 2643772248 2643221550 Bacteria 4619371
142 2643836604 2643221564 Bacteria 4193379
143 2643984907 2643221595 Bacteria 6565519
144 2644155520 2643221627 Bacteria 6761570
145 2688601324 2687453392 Bacteria 6880454
146 2694630446 2693429783 Bacteria 7019804
147 2694637769 2693429784 Bacteria 7241525
148 2723578489 2721755686 Bacteria 7343952
149 2756674668 2756170246 Bacteria 7451806
150 2792746459 2791355123 Bacteria 8049106
151 2844004226 2844002411 Bacteria 7168230
152 2844009984 2844009547 Bacteria 6728125
153 2846956902 2846952575 Bacteria 6587527
154 2847672854 2847670302 Bacteria 6165597
155 2847689328 2847686936 Bacteria 6278406
156 2848861407 2848858292 Bacteria 7391279
157 2856314804 2856314179 Bacteria 6477897
158 2856327972 2856320880 Bacteria 7263508
159 2856332147 2856328259 Bacteria 6528202
160 2856335135 2856334872 Bacteria 7037011
161 2856360696 2856356410 Bacteria 6297484
162 2856371135 2856364286 Bacteria 6939991
163 2857372841 2857367948 Bacteria 6965560
164 2869164634 2869162929 Bacteria 6399702
165 2869174867 2869169390 Bacteria 6659796
166 2869242110 2869234852 Bacteria 6654993
167 2869253920 2869249662 Bacteria 6868783
168 2869263683 2869256925 Bacteria 6981691
169 2869270311 2869264136 Bacteria 6880765
170 2869275907 2869271264 Bacteria 6908218
171 2869279923 2869278585 Bacteria 7077053
172 2869292358 2869285874 Bacteria 6901219
173 2871429173 2871429161 Bacteria 6547891
174 2871445372 2871444079 Bacteria 6423508
175 2871455307 2871451962 Bacteria 7336357
176 2871460787 2871459585 Bacteria 6866887
177 2871470948 2871466892 Bacteria 6923287
178 2871485429 2871481445 Bacteria 6700002
179 2871490696 2871488783 Bacteria 6929816
180 2871499271 2871495908 Bacteria 6935695
181 2874108921 2874102143 Bacteria 6342645
182 2874114365 2874109183 Bacteria 6517025
183 2874121851 2874116593 Bacteria 6674494
184 2874129621 2874123672 Bacteria 7238285
185 2874132429 2874131515 Bacteria 6820270
186 2874145583 2874139085 Bacteria 7021506
187 2874154079 2874146452 Bacteria 7533118
188 2874161581 2874155637 Bacteria 6724144
189 2874162673 2874162495 Bacteria 6174670
190 2874171649 2874168670 Bacteria 8062617
191 2876363168 2876363079 Bacteria 6544991
192 2876376360 2876369609 Bacteria 6807521
193 2876385077 2876377896 Bacteria 6565995
194 2876388497 2876386047 Bacteria 6698674
195 2876393036 2876392853 Bacteria 6660880
196 2876404321 2876399893 Bacteria 6927900
197 2876419763 2876413966 Bacteria 6831344
198 2876427610 2876420981 Bacteria 6687741
199 2878036115 2878035449 Bacteria 6555736
200 2878738729 2878730984 Bacteria 6380721
201 2878740235 2878738818 Bacteria 7136951
202 2878752701 2878745973 Bacteria 6867388
203 2878755099 2878753008 Bacteria 6922523
204 2878763461 2878760144 Bacteria 6823465
205 2878770459 2878767105 Bacteria 6898628
206 2878776579 2878774303 Bacteria 6108671
207 2878784418 2878781027 Bacteria 6834456
208 2881147504 2881147464 Bacteria 7779814
209 2881164280 2881161766 Bacteria 7127907
210 2881853068 2881845957 Bacteria 6611900
211 2881859210 2881853255 Bacteria 6698367
212 2881868861 2881861095 Bacteria 7128710
213 2882632877 2882632389 Bacteria 8154593
214 2882917596 2882912400 Bacteria 6801539
215 2885306144 2885305155 Bacteria 7348390
216 2885314800 2885312484 Bacteria 6415165
217 2885320303 2885318864 Bacteria 6729568
218 2885331223 2885326080 Bacteria 7134805
219 2885337707 2885334103 Bacteria 7216818
220 2885346798 2885342637 Bacteria 7011821
221 2885353847 2885350715 Bacteria 6787678
222 2888342595 2888337043 Bacteria 6629336
223 2888352161 2888350351 Bacteria 7372807
224 2889014151 2889010040 Bacteria 6749192
225 2889021143 2889016732 Bacteria 6700763
226 2897804114 2897803580 Bacteria 7000062
227 2903454758 2903448605 Bacteria 7357801
228 2903494800 2903492973 Bacteria 13473544
229 2903499419 2903492973 Bacteria 13473544
230 2903525118 2903521522 Bacteria 6525694
231 2903532138 2903528002 Bacteria 6586099
232 2903544076 2903540706 Bacteria 7062119
233 2904659742 2904659560 Bacteria 6685615
234 2906315092 2906308376 Bacteria 6841989
235 2906321348 2906321335 Bacteria 6579571
236 2906334661 2906328253 Bacteria 6585166
237 2906362884 2906354277 Bacteria 6991324
238 2906366212 2906363423 Bacteria 6856682
239 2906376183 2906370794 Bacteria 6881062
240 2906383118 2906378014 Bacteria 6911440
241 2906392359 2906386501 Bacteria 5977019
242 2906407555 2906401398 Bacteria 6693206
243 2906411521 2906408224 Bacteria 6162342
244 2906414993 2906414383 Bacteria 6580790
245 2906433185 2906427513 Bacteria 6375796
246 2922133932 2922130491 Bacteria 7173936
247 2922154220 2922151315 Bacteria 6902399
248 2922164389 2922158528 Bacteria 6573167
249 2922174070 2922172374 Bacteria 6167644
250 2922179149 2922178524 Bacteria 6025201
251 2924723442 2924718760 Bacteria 6331356
252 2924729892 2924726620 Bacteria 6271473
253 2924735769 2924733363 Bacteria 7574837
254 2924750236 2924748358 Bacteria 6154725
255 2924767586 2924762789 Bacteria 6561353
256 2924777835 2924776078 Bacteria 7492003
257 2924791318 2924784321 Bacteria 7416538
258 2937821633 2937813078 Bacteria 7783518
259 2937825904 2937822353 Bacteria 7290551
260 2937853360 2937848649 Bacteria 6983481
261 2937865388 2937861824 Bacteria 6660327
262 2937877073 2937868953 Bacteria 6639878
263 2937884397 2937877337 Bacteria 7246526
264 2937892357 2937891427 Bacteria 6357007
265 2937980420 2937972304 Bacteria 7532020
266 2937981538 2937980651 Bacteria 6517427
267 2937997921 2937994558 Bacteria 7036190
268 2938017252 2938014810 Bacteria 6700592
269 2958035790 2958034702 Bacteria 6989922
270 2958044821 2958041894 Bacteria 13082850
271 2958052177 2958041894 Bacteria 13082850
272 2958066624 2958064165 Bacteria 7158582
273 2958091708 2958084443 Bacteria 7312792
274 2958101403 2958100919 Bacteria 6800575
275 2958112134 2958108152 Bacteria 6681128
276 2958119782 2958115193 Bacteria 6923548
277 2958125223 2958122699 Bacteria 7280457
278 2958136758 2958130278 Bacteria 6897202
279 2958144031 2958137437 Bacteria 6050276
280 2958145655 2958144490 Bacteria 6677056
281 2958161627 2958158011 Bacteria 6058449
282 2958168396 2958165035 Bacteria 6906348
283 2958179454 2958172287 Bacteria 6716688
284 2958186641 2958179912 Bacteria 6874908
285 2961085142 2961077736 Bacteria 7079850
286 2961115066 2961114664 Bacteria 6680456
287 2961128275 2961127735 Bacteria 7196641
288 2961137045 2961136820 Bacteria 6775228
289 2961166860 2961163497 Bacteria 6901077
290 2961176859 2961170736 Bacteria 7072258
291 2961190607 2961183825 Bacteria 6688536
292 2963651047 2963644680 Bacteria 6530403
293 2965021684 2965018300 Bacteria 6883036
294 2965028954 2965025482 Bacteria 6532201
295 2965034490 2965032056 Bacteria 6887443
296 2965044163 2965040258 Bacteria 6855979
297 2965055050 2965047637 Bacteria 6623551
298 2965068113 2965062239 Bacteria 7412989
299 2965090088 2965089291 Bacteria 6866420
300 2965103141 2965102966 Bacteria 6800987
301 2965114363 2965110997 Bacteria 6693150
302 2965121617 2965119406 Bacteria 6956431
303 2968001034 2967996073 Bacteria 6787468
304 2968007087 2968003550 Bacteria 6929263
305 2968021520 2968016561 Bacteria 7022047
306 2968089097 2968083720 Bacteria 7351627
307 2968093037 2968091066 Bacteria 6052692
308 2968102675 2968097103 Bacteria 6107094
309 2968110794 2968110612 Bacteria 6814636
310 2968121479 2968117919 Bacteria 6536078
311 2968131488 2968128360 Bacteria 6270294
312 2968143413 2968138860 Bacteria 6605449
313 2968175266 2968171901 Bacteria 6894245
314 2970476801 2970469710 Bacteria 6969209
315 2970494259 2970489779 Bacteria 6517260
316 2970509531 2970503327 Bacteria 7099517
317 2970515061 2970510686 Bacteria 7006402
318 2970537569 2970532167 Bacteria 6553173
319 2970552259 2970547951 Bacteria 6931819
320 2970558304 2970554993 Bacteria 6814252
321 2970594522 2970593180 Bacteria 7073582
322 2970633989 2970627176 Bacteria 6680862
323 2977824239 2977821940 Bacteria 6906439
324 2977834639 2977828996 Bacteria 7007971
325 2977850141 2977843712 Bacteria 6753583
326 2977852387 2977851361 Bacteria 6694324
327 2977860876 2977858184 Bacteria 6215359
328 2977868432 2977864932 Bacteria 7534097
329 2977875266 2977872689 Bacteria 7270173
330 2977904140 2977898635 Bacteria 6675551
331 2977915918 2977915119 Bacteria 6829656
332 2977927275 2977922695 Bacteria 6956781
333 2977940011 2977935797 Bacteria 6252826
334 2977949612 2977942078 Bacteria 7570577
335 2977952984 2977950692 Bacteria 6893264
336 2977957817 2977957713 Bacteria 6877875
337 2977991395 2977986579 Bacteria 6581278
338 2979715155 2979710463 Bacteria 6785254
339 2979766289 2979764755 Bacteria 6610066
340 2979774416 2979772303 Bacteria 6618277
341 2979785713 2979779861 Bacteria 6219781
342 2979800514 2979793036 Bacteria 6808957
343 2979814319 2979808191 Bacteria 7179355
344 2987642363 2987636660 Bacteria 8088555
345 2987646704 2987645492 Bacteria 6117018
346 2987654357 2987652177 Bacteria 6969023
347 2987662872 2987659509 Bacteria 6966464
348 2987668058 2987666974 Bacteria 6509233
349 2987677401 2987673487 Bacteria 6884027
350 2995396069 2995392953 Bacteria 4539380
351 2996312748 2996310559 Bacteria 6357320
352 2996346386 2996341866 Bacteria 6643098
353 2996356226 2996348954 Bacteria 7239054
354 2996393608 2996386984 Bacteria 6978667
355 3000135829 3000135777 Bacteria 6891109
356 3004172431 3004167301 Bacteria 8330599
357 3004191924 3004188549 Bacteria 6952365
358 3004201024 3004195979 Bacteria 6776956
359 3004210444 3004203850 Bacteria 7307914
360 3004216800 3004211236 Bacteria 7417683
361 3004219833 3004218560 Bacteria 7421728
362 3004235201 3004232784 Bacteria 6662140
363 3004244937 3004239961 Bacteria 6892290
364 3004254556 3004248173 Bacteria 6563236
365 3004269623 3004268573 Bacteria 7043476
366 3004282540 3004275668 Bacteria 7114440
367 3004338175 3004334049 Bacteria 8449246
368 637077741 637000159 Bacteria 7596297
369 649875753 649633066 Bacteria 6690028
370 8002288479 8002285264 Bacteria 6717907
371 8004306329 8004300914 Bacteria 6132239
372 8004315956 8004312739 Bacteria 7444653
373 8004364514 8004361976 Bacteria 6858373
374 8004376678 8004374579 Bacteria 6898112
375 8004395032 8004387939 Bacteria 7049250
376 8004447747 8004445564 Bacteria 6322258
377 8004647026 8004640170 Bacteria 6723001
378 8004695629 8004695233 Bacteria 6731676
379 8004707366 8004703790 Bacteria 8006957
380 8004721353 8004714634 Bacteria 6776161
381 8004732821 8004727605 Bacteria 6643904
382 8054004089 8054002106 Bacteria 7987183
383 JGI25406J46586_10002159
384 Ga0070698_100044679
385 Ga0070679_100008641
386 Ga0081540_1006065
387 Ga0081539_10003188
388 Ga0075365_10044286
389 Ga0075431_100014499
390 Ga0075434_100445586
391 Ga0114129_10037925
392 Ga0157369_10164758
393 Ga0209676_1009037
394 Ga0207707_10237738
395 Ga0207671_10028017
396 Ga0207667_10205938
397 Ga0268266_10093957
398 Ga0265338_10163854
399 Ga0265328_10003167
400 Ga0265328_10003368
401 Ga0265320_10001543
402 Ga0265320_10002449
403 Ga0265340_10019100
404 Ga0265331_10000019
405 Ga0265327_10011547
406 Ga0265316_10124243
407 Ga0307513_10019071
408 Ga0265313_10000045
409 Ga0265313_10000265
410 Ga0265313_10003982
411 Ga0265313_10058100
412 Ga0265314_10001952
413 Ga0265342_10008292
414 Ga0316576_10084860
415 Ga0316578_10048582
416 Ga0307510_10117227
417 Ga0316582_0028572
418 Ga0316584_0045962
419 Ga0395899_0000014
420 Ga0395900_0000007
421 Ga0395898_0000011
422 Ga0395905_0000008
423 Ga0395901_0000020
424 Ga0453684_0028732
425 Ga0453684_0065463
426 Ga0453684_0067875
427 Ga0453684_0129325
428 Ga0466959_0001203
429 Ga0495643_0050682
430 Ga0495675_0141705
431 Ga0495686_0044304
432 Ga0495602_0207963
433 Ga0496112_0026649
434 Ga0496122_0056154
435 Ga0496126_0241796
436 Ga0501031_0000003
437 Ga0501031_0002943
438 Ga0501031_0007990
439 Ga0501032_0000001
440 Ga0501032_0000010
441 Ga0501033_0000017
442 Ga0501033_0000198
443 Ga0501033_0018963
444 Ga0501034_0000036
445 Ga0501034_0000053
446 Ga0501034_0024750
447 Ga0501034_0061842
448 Ga0501036_0000009
449 Ga0501036_0000046
450 Ga0501036_0017430
451 Ga0501036_0036804
452 Ga0501036_0059444
453 Ga0501037_0000008
454 Ga0501037_0000017
455 Ga0501038_0000008
456 Ga0501038_0000153
457 Ga0501038_0057734
458 Ga0501039_0000011
459 Ga0501039_0000021
460 Ga0501039_0005545
461 Ga0501039_0031625
462 Ga0501040_0071601
463 Ga0501041_0026319
464 Ga0501042_0009424
465 Ga0501043_0000016
466 Ga0501043_0000279
467 Ga0501043_0086923
468 Ga0501046_0102316
469 Ga0501047_0000126
470 Ga0501047_0061415
471 Ga0501047_0072597
472 Ga0501047_0174808
473 Ga0501048_0001737
474 Ga0501070_0022835
475 Ga0501071_0005968
476 Ga0501072_0002106
477 Ga0501073_0202643
478 Ga0501074_0011270
479 Ga0501074_0066609
480 Ga0501076_0073871
481 Ga0501077_0135106
482 Ga0501079_0017771
483 Ga0501080_0066765
484 Ga0501083_0031677
485 Ga0501083_0117179
486 Ga0501035_0000023
487 Ga0501035_0000028
488 Ga0501035_0010550
489 Ga0501044_0000021
490 Ga0501044_0038117
491 Ga0501044_0042037
492 Ga0501045_0008298
493 nmdc:mga06z11_24835_c1
494 nmdc:mga05p37_63210_c1
495 nmdc:mga0qj67_48728_c1
496 nmdc:mga06r32_5391_c1
497 Ga0495601_0062267
498 Ga0495595_0052400
499 Ga0495619_0053508
500 Ga0500643_005923
501 Ga0500644_0024829
502 Ga0500642_0004989
503 Ga0500604_0025014
504 Ga0500616_0071406
505 Ga0500627_0046477
506 Ga0501084_0057718
507 Ga0466962_0025410
508 Ga0530510_0138494
509 2871443863
510 2503204695
511 2509113537
512 2509370223
513 2509398954
514 2510314294
515 2512032205
516 2512934570
517 2513613542
518 2514416942
519 2523105390
520 2588514177
521 2599102239
522 2599935856
523 2643772248
524 2643836604
525 2643984907
526 2644155520
527 2688601324
528 2694630446
529 2694637769
530 2723578489
531 2756674668
532 2792746459
533 2844004226
534 2844009984
535 2846956902
536 2847672854
537 2847689328
538 2848861407
539 2856314804
540 2856327972
541 2856332147
542 2856335135
543 2856360696
544 2856371135
545 2857372841
546 2869164634
547 2869174867
548 2869242110
549 2869253920
550 2869263683
551 2869270311
552 2869275907
553 2869279923
554 2869292358
555 2871429173
556 2871445372
557 2871455307
558 2871460787
559 2871470948
560 2871485429
561 2871490696
562 2871499271
563 2874108921
564 2874114365
565 2874121851
566 2874129621
567 2874132429
568 2874145583
569 2874154079
570 2874161581
571 2874162673
572 2874171649
573 2876363168
574 2876376360
575 2876385077
576 2876388497
577 2876393036
578 2876404321
579 2876419763
580 2876427610
581 2878036115
582 2878738729
583 2878740235
584 2878752701
585 2878755099
586 2878763461
587 2878770459
588 2878776579
589 2878784418
590 2881147504
591 2881164280
592 2881853068
593 2881859210
594 2881868861
595 2882632877
596 2882917596
597 2885306144
598 2885314800
599 2885320303
600 2885331223
601 2885337707
602 2885346798
603 2885353847
604 2888342595
605 2888352161
606 2889014151
607 2889021143
608 2897804114
609 2903454758
610 2903494800
611 2903499419
612 2903525118
613 2903532138
614 2903544076
615 2904659742
616 2906315092
617 2906321348
618 2906334661
619 2906362884
620 2906366212
621 2906376183
622 2906383118
623 2906392359
624 2906407555
625 2906411521
626 2906414993
627 2906433185
628 2922133932
629 2922154220
630 2922164389
631 2922174070
632 2922179149
633 2924723442
634 2924729892
635 2924735769
636 2924750236
637 2924767586
638 2924777835
639 2924791318
640 2937821633
641 2937825904
642 2937853360
643 2937865388
644 2937877073
645 2937884397
646 2937892357
647 2937980420
648 2937981538
649 2937997921
650 2938017252
651 2958035790
652 2958044821
653 2958052177
654 2958066624
655 2958091708
656 2958101403
657 2958112134
658 2958119782
659 2958125223
660 2958136758
661 2958144031
662 2958145655
663 2958161627
664 2958168396
665 2958179454
666 2958186641
667 2961085142
668 2961115066
669 2961128275
670 2961137045
671 2961166860
672 2961176859
673 2961190607
674 2963651047
675 2965021684
676 2965028954
677 2965034490
678 2965044163
679 2965055050
680 2965068113
681 2965090088
682 2965103141
683 2965114363
684 2965121617
685 2968001034
686 2968007087
687 2968021520
688 2968089097
689 2968093037
690 2968102675
691 2968110794
692 2968121479
693 2968131488
694 2968143413
695 2968175266
696 2970476801
697 2970494259
698 2970509531
699 2970515061
700 2970537569
701 2970552259
702 2970558304
703 2970594522
704 2970633989
705 2977824239
706 2977834639
707 2977850141
708 2977852387
709 2977860876
710 2977868432
711 2977875266
712 2977904140
713 2977915918
714 2977927275
715 2977940011
716 2977949612
717 2977952984
718 2977957817
719 2977991395
720 2979715155
721 2979766289
722 2979774416
723 2979785713
724 2979800514
725 2979814319
726 2987642363
727 2987646704
728 2987654357
729 2987662872
730 2987668058
731 2987677401
732 2995396069
733 2996312748
734 2996346386
735 2996356226
736 2996393608
737 3000135829
738 3004172431
739 3004191924
740 3004201024
741 3004210444
742 3004216800
743 3004219833
744 3004235201
745 3004244937
746 3004254556
747 3004269623
748 3004282540
749 3004338175
750 637077741
751 649875753
752 8002288479
753 8004306329
754 8004315956
755 8004364514
756 8004376678
757 8004395032
758 8004447747
759 8004647026
760 8004695629
761 8004707366
762 8004721353
763 8004732821
764 8054004089

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

4

372

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eh6-assembly1.cif.gz_B crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5 0.9626 4 384
2ord-assembly1.cif.gz_B crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution 0.9621 6 388
4adb-assembly1.cif.gz_A structural and functional study of succinyl-ornithine transaminase from e. coli 0.959 5 389
4ade-assembly2.cif.gz_B-3 structural and functional study of succinyl-ornithine transaminase from e. coli 0.9587 13 389
2pb0-assembly1.cif.gz_B structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding 0.9566 10 390
ID Description Score Start End Superfamily
4adeB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9718 49 291 3.40.640.10
4addA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9619 49 291 3.40.640.10
2eh6A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9592 49 292 3.40.640.10
4adeB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.954 49 291 3.40.640.10
2eh6A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9516 49 292 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A2N3E122-F1-model_v4 Acetylornithine transaminase (EC 2.6.1.11) 0.9941 315 389 GO:0003992
GO:0030170
GO:0042802
AF-A0A2E6CB88-F1-model_v4 Acetylornithine aminotransferase (ACOAT) (EC 2.6.1.11) 0.9745 9 391 GO:0003992
GO:0005737
GO:0006526
GO:0030170
GO:0042802
AF-A0A352GHL9-F1-model_v4 Acetylornithine transaminase (EC 2.6.1.11) 0.9744 122 389 GO:0003992
GO:0030170
GO:0042802
AF-A0A8A8PLS6-F1-model_v4 deleted 0.9742 2 389
AF-A0A7X8K1E8-F1-model_v4 Aspartate aminotransferase family protein 0.9738 42 391 GO:0003992
GO:0005737
GO:0006526
GO:0030170
GO:0042802

Map