F429470

General Info

Members Datasets Scaffolds Average Seq Length
383 239 316 261

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10036297|rootH1_100362974
Length 290
Sequence MAVRPEGTPCWADAMFGDVEGAKSFYGDVLGWTFGESSSEYGNYTQAYAAGKAVAAVVPPMPGQEGQSQWCLYLASPDAAATAARIREHGGEVLMEPMQVGDFGTMCLGRDPGGVVFGVWQAGVHEGFEAPPEQPGAFCWAEVYTREPGKSDAFFPAVFGYTAKQMEGEAMDFRMFNVGDDTVLGRMKMGEEFPPEVPAYINVYFTVDDCDGAVARATGHGGVLRFGPMDTPFGRFAALSDPQGASFSVIDVTRTQGEIPQISSDIGHRTSAAVVAAGAAVRSWHDRAHA

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221578 Streptomyces sp. Root63 Isolate Unclassified
9 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
10 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
11 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
12 2643221647 Streptomyces sp. Root369 Isolate Unclassified
13 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
14 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
15 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
16 2643221714 Streptomyces sp. Root264 Isolate Unclassified
17 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
18 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
19 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
20 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
21 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
22 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
23 2808606448 Streptomyces sp. 193411 Isolate Unclassified
24 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
25 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
26 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
27 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
28 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
29 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
30 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
31 2862574272 Streptomyces sp. AcE210 Isolate Nodule
32 2867428634 Streptomyces sp. RP5T Isolate Unclassified
33 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
34 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
35 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
36 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
37 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
38 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
39 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
40 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
41 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
42 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
43 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
44 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
45 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
46 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
47 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
48 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
49 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
50 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
51 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
52 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
53 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
54 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
55 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
56 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
57 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
58 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
59 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
60 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
61 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
62 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
63 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
64 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
65 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
66 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
67 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
116 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
117 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
118 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
119 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
120 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
121 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
205 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
229 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
230 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
231 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
234 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
235 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
236 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
237 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
238 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
239 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.72
Metatranscriptomes 0.78
Isolates 17.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 1.04
Rhizoplane 0.78
Rhizosphere 77.02
Stem 0
Stem Tuber 0
Unclassified 16.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10033929 3300001990 Bacteria 1584
2 rootH1_10058454 3300003316 Bacteria 2432
3 rootH2_10022648 3300003320 Bacteria 4219
4 rootH1_10036297 3300003323 Bacteria 6291
5 rootH1_10098056 3300003323 Bacteria 1655
6 Ga0070709_10129905 3300005434 Bacteria 1718
7 Ga0070714_100276760 3300005435 Bacteria 1558
8 Ga0070713_100178181 3300005436 Bacteria 1908
9 Ga0068853_100102166 3300005539 Bacteria 2537
10 Ga0070665_100304787 3300005548 Bacteria 1596
11 Ga0068855_100330478 3300005563 Bacteria 1683
12 Ga0068856_100637700 3300005614 Bacteria 1086
13 Ga0081455_10070627 3300005937 Bacteria 2898
14 Ga0070717_10175774 3300006028 Bacteria 1864
15 Ga0075365_10099804 3300006038 Bacteria 1987
16 Ga0075368_10003569 3300006042 Bacteria 5212
17 Ga0075363_100021728 3300006048 Bacteria 3237
18 Ga0075363_100051039 3300006048 Bacteria 2205
19 Ga0075367_10000753 3300006178 Bacteria 12627
20 Ga0075370_10158644 3300006353 Bacteria 1327
21 Ga0099826_10092834 3300006948 Bacteria 1841
22 Ga0105251_10075851 3300009011 Bacteria 1561
23 Ga0105243_10259389 3300009148 Bacteria 1555
24 Ga0182008_10001515 3300014497 Bacteria 15517
25 Ga0182007_10000291 3300015262 Bacteria 32565
26 Ga0182005_1020492 3300015265 Bacteria 1819
27 Ga0183367_1003 3300015688 Bacteria 814276
28 Ga0213876_10054175 3300021384 Bacteria 2118
29 Ga0224712_10143455 3300022467 Bacteria 1053
30 Ga0256743_102822 3300023436 Bacteria 992
31 Ga0207426_1019088 3300025302 Bacteria 2403
32 Ga0207647_10012458 3300025904 Bacteria 5918
33 Ga0207699_10094148 3300025906 Bacteria 1887
34 Ga0207667_10228218 3300025949 Bacteria 1907
35 Ga0207702_10259232 3300026078 Bacteria 1636
36 Ga0209813_10015502 3300027866 Bacteria 2066
37 Ga0268266_10178717 3300028379 Bacteria 1931
38 Ga0307517_10025008 3300028786 Bacteria 7328
39 Ga0307515_10000106 3300028794 Bacteria 197218
40 Ga0307515_10051551 3300028794 Bacteria 6132
41 Ga0307511_10002051 3300030521 Bacteria 21091
42 Ga0307511_10012524 3300030521 Bacteria 8319
43 Ga0307512_10034435 3300030522 Bacteria 4332
44 Ga0307512_10104615 3300030522 Bacteria 1898
45 Ga0307513_10006435 3300031456 Bacteria 15350
46 Ga0307513_10163077 3300031456 Bacteria 2118
47 Ga0307509_10004141 3300031507 Bacteria 21188
48 Ga0307509_10007222 3300031507 Bacteria 14623
49 Ga0307509_10021254 3300031507 Bacteria 7343
50 Ga0307508_10036246 3300031616 Bacteria 4441
51 Ga0307508_10056418 3300031616 Bacteria 3478
52 Ga0307508_10064584 3300031616 Bacteria 3227
53 Ga0307514_10005418 3300031649 Bacteria 11402
54 Ga0307514_10101564 3300031649 Bacteria 2063
55 Ga0307516_10000711 3300031730 Bacteria 45216
56 Ga0307516_10009394 3300031730 Bacteria 10908
57 Ga0307516_10281774 3300031730 Bacteria 1344
58 Ga0307518_10036585 3300031838 Bacteria 3568
59 Ga0307518_10088112 3300031838 Bacteria 2236
60 Ga0307518_10156973 3300031838 Bacteria 1568
61 Ga0307507_10005664 3300033179 Bacteria 20263
62 Ga0307507_10005887 3300033179 Bacteria 19529
63 Ga0307510_10010384 3300033180 Bacteria 11060
64 Ga0307510_10033747 3300033180 Bacteria 5742
65 Ga0307510_10039953 3300033180 Bacteria 5159
66 Ga0307510_10042962 3300033180 Bacteria 4918
67 Ga0395898_0010345 3300037466 Bacteria 9758
68 Ga0395898_0036638 3300037466 Bacteria 4870
69 Ga0395901_0100094 3300038443 Bacteria 3040
70 Ga0436365_0763918 3300039437 Bacteria 2315
71 Ga0439436_0012047 3300041404 Bacteria 2626
72 Ga0439439_0009341 3300041406 Bacteria 2331
73 Ga0451853_0845322 3300041512 Bacteria 11189
74 Ga0451853_2707819 3300041512 Bacteria 7620
75 Ga0451853_3767289 3300041512 Bacteria 1745
76 Ga0439448_0007614 3300042005 Bacteria 3145
77 Ga0439449_0001497 3300042007 Bacteria 9157
78 Ga0439449_0052691 3300042007 Bacteria 1504
79 Ga0439457_005218 3300042014 Bacteria 3291
80 Ga0439462_0021541 3300042015 Bacteria 1684
81 Ga0450896_004852 3300042133 Bacteria 1831
82 Ga0450898_002555 3300042134 Bacteria 2549
83 Ga0450898_016029 3300042134 Bacteria 1275
84 Ga0450903_000037 3300042138 Bacteria 26562
85 Ga0439458_0001846 3300042157 Bacteria 5267
86 Ga0439458_0007973 3300042157 Bacteria 2355
87 Ga0466972_0001948 3300044658 Bacteria 10127
88 Ga0466972_0018433 3300044658 Bacteria 3490
89 Ga0466965_0000305 3300044683 Bacteria 16342
90 Ga0466965_0117064 3300044683 Bacteria 1374
91 Ga0466966_0014786 3300044684 Bacteria 5163
92 Ga0466961_0024482 3300044693 Bacteria 3882
93 Ga0466961_0342448 3300044693 Bacteria 911
94 Ga0466963_0000682 3300044694 Bacteria 16496
95 Ga0466963_0010728 3300044694 Bacteria 5559
96 Ga0466963_0016306 3300044694 Bacteria 4618
97 Ga0466971_0069542 3300044719 Bacteria 1597
98 Ga0466971_0076119 3300044719 Bacteria 1527
99 Ga0466970_0000323 3300044765 Bacteria 23219
100 Ga0466970_0003928 3300044765 Bacteria 7284
101 Ga0466960_0130730 3300044901 Bacteria 1324
102 Ga0466958_0189687 3300045836 Bacteria 1306
103 Ga0466967_0001305 3300045976 Bacteria 14233
104 Ga0466967_0009824 3300045976 Bacteria 7136
105 Ga0495627_048250 3300046453 Bacteria 1289
106 Ga0495592_0001777 3300046454 Bacteria 15168
107 Ga0495592_0008890 3300046454 Bacteria 7542
108 Ga0495603_0000870 3300046455 Bacteria 17328
109 Ga0495603_0002388 3300046455 Bacteria 11041
110 Ga0495603_0004469 3300046455 Bacteria 8343
111 Ga0495603_0014207 3300046455 Bacteria 4817
112 Ga0495603_0014721 3300046455 Bacteria 4730
113 Ga0495603_0024420 3300046455 Bacteria 3656
114 Ga0495603_0178191 3300046455 Bacteria 1230
115 Ga0495629_0001850 3300046459 Bacteria 16580
116 Ga0495629_0003509 3300046459 Bacteria 11855
117 Ga0495629_0007584 3300046459 Bacteria 7993
118 Ga0495629_0011108 3300046459 Bacteria 6543
119 Ga0495629_0014976 3300046459 Bacteria 5572
120 Ga0495629_0015654 3300046459 Bacteria 5445
121 Ga0495629_0020104 3300046459 Bacteria 4767
122 Ga0495629_0049973 3300046459 Bacteria 2930
123 Ga0495629_0050682 3300046459 Bacteria 2907
124 Ga0495629_0051688 3300046459 Bacteria 2876
125 Ga0495638_0057407 3300046460 Bacteria 2414
126 Ga0495638_0191815 3300046460 Bacteria 1159
127 Ga0495651_0040747 3300046462 Bacteria 3610
128 Ga0495651_0051010 3300046462 Bacteria 3191
129 Ga0495582_0029969 3300046473 Bacteria 2986
130 Ga0495582_0078545 3300046473 Bacteria 1831
131 Ga0495605_0002758 3300046474 Bacteria 10722
132 Ga0495605_0040540 3300046474 Bacteria 2324
133 Ga0495639_0092817 3300046475 Bacteria 1418
134 Ga0495662_0002022 3300046476 Bacteria 10146
135 Ga0495662_0015210 3300046476 Bacteria 3738
136 Ga0495662_0067866 3300046476 Bacteria 1726
137 Ga0495664_0007333 3300046477 Bacteria 6122
138 Ga0495664_0018929 3300046477 Bacteria 3953
139 Ga0495585_0054620 3300046492 Bacteria 2208
140 Ga0495585_0201179 3300046492 Bacteria 1014
141 Ga0495594_0003383 3300046499 Bacteria 8244
142 Ga0495594_0009553 3300046499 Bacteria 5014
143 Ga0495594_0035749 3300046499 Bacteria 2707
144 Ga0495594_0058261 3300046499 Bacteria 2133
145 Ga0495594_0061067 3300046499 Bacteria 2085
146 Ga0495594_0122088 3300046499 Bacteria 1473
147 Ga0495594_0125270 3300046499 Bacteria 1453
148 Ga0495594_0305910 3300046499 Bacteria 906
149 Ga0495596_0093845 3300046500 Bacteria 1165
150 Ga0495607_0026586 3300046501 Bacteria 3590
151 Ga0495583_0069262 3300046506 Bacteria 1554
152 Ga0495583_0069947 3300046506 Bacteria 1544
153 Ga0495606_0032536 3300046507 Bacteria 3611
154 Ga0495606_0103986 3300046507 Bacteria 1724
155 Ga0495608_0230375 3300046511 Bacteria 1160
156 Ga0495610_0030475 3300046512 Bacteria 2827
157 Ga0495618_0115532 3300046514 Bacteria 1718
158 Ga0495628_0009467 3300046516 Bacteria 8317
159 Ga0495628_0026929 3300046516 Bacteria 4680
160 Ga0495630_0184173 3300046517 Bacteria 1593
161 Ga0495630_0362596 3300046517 Bacteria 1109
162 Ga0495631_0040130 3300046518 Bacteria 2074
163 Ga0495631_0227760 3300046518 Bacteria 795
164 Ga0495648_0057485 3300046524 Bacteria 2332
165 Ga0495648_0073775 3300046524 Bacteria 1968
166 Ga0495666_0134466 3300046526 Bacteria 1154
167 Ga0495666_0167788 3300046526 Bacteria 1016
168 Ga0495652_0009693 3300046529 Bacteria 8736
169 Ga0495652_0288953 3300046529 Bacteria 1197
170 Ga0495654_0069961 3300046530 Bacteria 1665
171 Ga0495640_0001026 3300046533 Bacteria 21652
172 Ga0495640_0005875 3300046533 Bacteria 9737
173 Ga0495586_0126612 3300046535 Bacteria 1429
174 Ga0495587_0025959 3300046536 Bacteria 3575
175 Ga0495609_0010921 3300046538 Bacteria 4339
176 Ga0495622_0001462 3300046557 Bacteria 11884
177 Ga0495622_0024633 3300046557 Bacteria 2810
178 Ga0495622_0093101 3300046557 Bacteria 1384
179 Ga0495633_0128897 3300046558 Bacteria 1170
180 Ga0495667_0071170 3300046559 Bacteria 2269
181 Ga0495667_0144064 3300046559 Bacteria 1535
182 Ga0495667_0239449 3300046559 Bacteria 1156
183 Ga0495668_0028737 3300046616 Bacteria 3143
184 Ga0495634_0003255 3300046642 Bacteria 13117
185 Ga0495634_0148380 3300046642 Bacteria 1484
186 Ga0495634_0195366 3300046642 Bacteria 1259
187 Ga0495634_0359530 3300046642 Bacteria 870
188 Ga0495611_0012252 3300046648 Bacteria 3646
189 Ga0495625_0007997 3300046660 Bacteria 9081
190 Ga0495625_0065775 3300046660 Bacteria 2555
191 Ga0495625_0195284 3300046660 Bacteria 1338
192 Ga0495635_0001628 3300046663 Bacteria 15131
193 Ga0495635_0022724 3300046663 Bacteria 4372
194 Ga0495661_0059492 3300046665 Bacteria 2274
195 Ga0495588_0012621 3300046674 Bacteria 3999
196 Ga0495588_0012852 3300046674 Bacteria 3969
197 Ga0495588_0039977 3300046674 Bacteria 2390
198 Ga0495588_0040550 3300046674 Bacteria 2375
199 Ga0495588_0121574 3300046674 Bacteria 1376
200 Ga0495657_0000602 3300046675 Bacteria 32915
201 Ga0495657_0007427 3300046675 Bacteria 8469
202 Ga0495657_0017427 3300046675 Bacteria 5215
203 Ga0495657_0029058 3300046675 Bacteria 3880
204 Ga0495623_0007754 3300046679 Bacteria 6977
205 Ga0495646_0002903 3300046680 Bacteria 10621
206 Ga0495646_0113483 3300046680 Bacteria 1541
207 Ga0495658_0221233 3300046683 Bacteria 1185
208 Ga0495613_0000692 3300046689 Bacteria 26583
209 Ga0495613_0001291 3300046689 Bacteria 19116
210 Ga0495613_0008083 3300046689 Bacteria 7819
211 Ga0495613_0017739 3300046689 Bacteria 5303
212 Ga0495613_0044906 3300046689 Bacteria 3268
213 Ga0495624_0023297 3300046690 Bacteria 4084
214 Ga0495670_0029114 3300046691 Bacteria 2740
215 Ga0495671_0019594 3300046692 Bacteria 3574
216 Ga0495649_0028597 3300046694 Bacteria 3089
217 Ga0495589_0009682 3300046794 Bacteria 5007
218 Ga0495589_0034464 3300046794 Bacteria 2541
219 Ga0495589_0052379 3300046794 Bacteria 2016
220 Ga0495589_0081377 3300046794 Bacteria 1575
221 Ga0495600_0004965 3300046809 Bacteria 7987
222 Ga0495600_0097511 3300046809 Bacteria 1916
223 Ga0495600_0197604 3300046809 Bacteria 1292
224 Ga0495600_0335675 3300046809 Bacteria 948
225 Ga0495660_0087327 3300046810 Bacteria 1626
226 Ga0495581_0011453 3300047315 Bacteria 5134
227 Ga0495581_0021503 3300047315 Bacteria 3738
228 Ga0495581_0028167 3300047315 Bacteria 3257
229 Ga0495604_0000721 3300047317 Bacteria 27964
230 Ga0495604_0006293 3300047317 Bacteria 9420
231 Ga0495604_0075800 3300047317 Bacteria 2531
232 Ga0495636_0003684 3300047318 Bacteria 5959
233 Ga0495636_0010711 3300047318 Bacteria 3625
234 Ga0495636_0042959 3300047318 Bacteria 1879
235 Ga0495636_0312841 3300047318 Bacteria 736
236 Ga0495674_0219753 3300047319 Bacteria 1571
237 Ga0495676_0003652 3300047321 Bacteria 13953
238 Ga0495676_0008112 3300047321 Bacteria 9635
239 Ga0495676_0010424 3300047321 Bacteria 8429
240 Ga0495676_0011930 3300047321 Bacteria 7839
241 Ga0495676_0018216 3300047321 Bacteria 6193
242 Ga0495676_0024527 3300047321 Bacteria 5219
243 Ga0495676_0047530 3300047321 Bacteria 3468
244 Ga0495676_0052568 3300047321 Bacteria 3250
245 Ga0495680_0013028 3300047322 Bacteria 7274
246 Ga0495683_0052296 3300047323 Bacteria 2039
247 Ga0495687_001141 3300047443 Bacteria 25731
248 Ga0495687_010165 3300047443 Bacteria 5180
249 Ga0495675_0039557 3300047444 Bacteria 3003
250 Ga0495675_0072231 3300047444 Bacteria 2177
251 Ga0495675_0306287 3300047444 Bacteria 942
252 Ga0495677_0075769 3300047445 Bacteria 1257
253 Ga0495685_001020 3300047447 Bacteria 8539
254 Ga0495685_001222 3300047447 Bacteria 7885
255 Ga0495685_019421 3300047447 Bacteria 2335
256 Ga0495681_0007280 3300047470 Bacteria 7104
257 Ga0495593_0106111 3300047673 Bacteria 1437
258 Ga0495593_0142599 3300047673 Bacteria 1213
259 Ga0495602_0043267 3300048088 Bacteria 4097
260 Ga0495614_0000431 3300048089 Bacteria 17235
261 Ga0495614_0026727 3300048089 Bacteria 2487
262 Ga0495614_0033515 3300048089 Bacteria 2209
263 Ga0495614_0176235 3300048089 Bacteria 961
264 Ga0495626_0028351 3300048091 Bacteria 2716
265 Ga0496105_0445546 3300048908 Bacteria 1023
266 Ga0496109_0023826 3300048912 Bacteria 5434
267 Ga0496113_0326140 3300048916 Bacteria 1231
268 Ga0495678_040311 3300049459 Bacteria 1878
269 Ga0495678_059895 3300049459 Bacteria 1434
270 Ga0495682_0078857 3300049460 Bacteria 1185
271 Ga0501031_0054293 3300049568 Bacteria 2611
272 Ga0501032_0027569 3300049569 Bacteria 3903
273 Ga0501033_0005759 3300049570 Bacteria 9756
274 Ga0501033_0056191 3300049570 Bacteria 2910
275 Ga0501033_0059425 3300049570 Bacteria 2823
276 Ga0501034_0015003 3300049571 Bacteria 7969
277 Ga0501034_0047157 3300049571 Bacteria 4352
278 Ga0501034_0061900 3300049571 Bacteria 3758
279 Ga0501036_0013461 3300049572 Bacteria 6799
280 Ga0501036_0066881 3300049572 Bacteria 3041
281 Ga0501037_0119743 3300049573 Bacteria 1893
282 Ga0501038_0022820 3300049574 Bacteria 5601
283 Ga0501038_0033542 3300049574 Bacteria 4522
284 Ga0501038_0063785 3300049574 Bacteria 3144
285 Ga0501038_0097028 3300049574 Bacteria 2459
286 Ga0501039_0043957 3300049575 Bacteria 3451
287 Ga0501043_0016594 3300049579 Bacteria 5771
288 Ga0501043_0049731 3300049579 Bacteria 3296
289 Ga0501047_0026580 3300049581 Bacteria 5569
290 Ga0501047_0037314 3300049581 Bacteria 4699
291 Ga0501047_0038843 3300049581 Bacteria 4604
292 Ga0501047_0079603 3300049581 Bacteria 3150
293 Ga0501048_0010085 3300049582 Bacteria 7066
294 Ga0501070_0306033 3300049586 Bacteria 1294
295 Ga0501079_0308148 3300049741 Bacteria 1239
296 Ga0501080_0191483 3300049742 Bacteria 1879
297 Ga0501035_0016972 3300049822 Bacteria 6709
298 Ga0501035_0020015 3300049822 Bacteria 6148
299 Ga0501035_0023644 3300049822 Bacteria 5638
300 Ga0501035_0152662 3300049822 Bacteria 2003
301 Ga0501044_0006941 3300049823 Bacteria 12464
302 Ga0501044_0031794 3300049823 Bacteria 5550
303 Ga0501044_0137228 3300049823 Bacteria 2436
304 Ga0501044_0214526 3300049823 Bacteria 1877
305 nmdc:mga0yw44_317976_c1 3300050492 Bacteria 1045
306 nmdc:mga06z11_9367_c1 3300050494 Bacteria 4126
307 nmdc:mga04h51_17603_c1 3300050495 Bacteria 2093
308 nmdc:mga0sz30_158010_c1 3300050516 Bacteria 1004
309 Ga0495612_0008854 3300053078 Bacteria 4078
310 Ga0500644_0022985 3300053088 Bacteria 1888
311 Ga0500640_000618 3300053095 Bacteria 9237
312 Ga0500560_017140 3300053107 Bacteria 1993
313 Ga0500600_0094579 3300053149 Bacteria 1589
314 Ga0500600_0101671 3300053149 Bacteria 1515
315 Ga0587080_036131 3300059503 Bacteria 882
316 Ga0466962_0001570 3300061719 Bacteria 10683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047318 Ga0495636_0312841 Ga0495636_0312841_10_726 236
2 3300047444 Ga0495675_0039557 Ga0495675_0039557_1147_1902 238
3 3300003316 rootH1_10058454 rootH1_100584542 239
4 3300044719 Ga0466971_0069542 Ga0466971_0069542_360_1112 239
5 3300045836 Ga0466958_0189687 Ga0466958_0189687_313_1065 239
6 3300049570 Ga0501033_0005759 Ga0501033_0005759_4751_5503 239
7 3300049822 Ga0501035_0152662 Ga0501035_0152662_77_829 239
8 iso_pu_bacteria 2862281513 2862282354 242
9 3300044765 Ga0466970_0003928 Ga0466970_0003928_3299_4063 244
10 iso_pu_bacteria 2547132111 2547408893 246
11 iso_pu_bacteria 2784746768 2785366214 246
12 iso_pu_bacteria 2875391855 2875394995 246
13 3300046518 Ga0495631_0227760 Ga0495631_0227760_31_780 248
14 3300005434 Ga0070709_10129905 Ga0070709_101299051 249
15 3300005435 Ga0070714_100276760 Ga0070714_1002767601 249
16 3300005436 Ga0070713_100178181 Ga0070713_1001781812 249
17 3300006028 Ga0070717_10175774 Ga0070717_101757742 249
18 3300022467 Ga0224712_10143455 Ga0224712_101434551 249
19 3300025906 Ga0207699_10094148 Ga0207699_100941482 249
20 3300006948 Ga0099826_10092834 Ga0099826_100928342 250
21 3300009011 Ga0105251_10075851 Ga0105251_100758512 250
22 3300014497 Ga0182008_10001515 Ga0182008_1000151517 250
23 3300015262 Ga0182007_10000291 Ga0182007_1000029116 250
24 3300015265 Ga0182005_1020492 Ga0182005_10204922 250
25 3300037466 Ga0395898_0010345 Ga0395898_0010345_6084_6842 250
26 3300037466 Ga0395898_0036638 Ga0395898_0036638_517_1269 250
27 3300038443 Ga0395901_0100094 Ga0395901_0100094_465_1217 250
28 3300041406 Ga0439439_0009341 Ga0439439_0009341_274_1038 250
29 3300041512 Ga0451853_0845322 Ga0451853_0845322_679_1446 250
30 3300041512 Ga0451853_2707819 Ga0451853_2707819_2873_3631 250
31 3300041512 Ga0451853_3767289 Ga0451853_3767289_106_864 250
32 3300042005 Ga0439448_0007614 Ga0439448_0007614_95_853 250
33 3300042007 Ga0439449_0001497 Ga0439449_0001497_3275_4030 250
34 3300042133 Ga0450896_004852 Ga0450896_004852_773_1540 250
35 3300042134 Ga0450898_016029 Ga0450898_016029_359_1123 250
36 3300042138 Ga0450903_000037 Ga0450903_000037_13386_14144 250
37 3300042157 Ga0439458_0001846 Ga0439458_0001846_345_1103 250
38 3300042157 Ga0439458_0007973 Ga0439458_0007973_1238_1996 250
39 3300044658 Ga0466972_0001948 Ga0466972_0001948_154_912 250
40 3300044658 Ga0466972_0018433 Ga0466972_0018433_1139_1894 250
41 3300044683 Ga0466965_0000305 Ga0466965_0000305_3233_3988 250
42 3300044683 Ga0466965_0117064 Ga0466965_0117064_98_850 250
43 3300044684 Ga0466966_0014786 Ga0466966_0014786_3817_4572 250
44 3300044693 Ga0466961_0024482 Ga0466961_0024482_2080_2835 250
45 3300044693 Ga0466961_0342448 Ga0466961_0342448_44_802 250
46 3300044694 Ga0466963_0000682 Ga0466963_0000682_4727_5482 250
47 3300044694 Ga0466963_0016306 Ga0466963_0016306_2383_3138 250
48 3300044719 Ga0466971_0076119 Ga0466971_0076119_279_1034 250
49 3300044765 Ga0466970_0000323 Ga0466970_0000323_1622_2377 250
50 3300044901 Ga0466960_0130730 Ga0466960_0130730_126_884 250
51 3300045976 Ga0466967_0001305 Ga0466967_0001305_7403_8158 250
52 3300045976 Ga0466967_0009824 Ga0466967_0009824_460_1215 250
53 3300046454 Ga0495592_0001777 Ga0495592_0001777_7674_8426 250
54 3300046455 Ga0495603_0002388 Ga0495603_0002388_3919_4674 250
55 3300046455 Ga0495603_0004469 Ga0495603_0004469_4824_5582 250
56 3300046455 Ga0495603_0178191 Ga0495603_0178191_364_1119 250
57 3300046459 Ga0495629_0007584 Ga0495629_0007584_4361_5113 250
58 3300046459 Ga0495629_0011108 Ga0495629_0011108_2622_3380 250
59 3300046459 Ga0495629_0014976 Ga0495629_0014976_195_950 250
60 3300046459 Ga0495629_0020104 Ga0495629_0020104_2839_3591 250
61 3300046459 Ga0495629_0051688 Ga0495629_0051688_731_1486 250
62 3300046460 Ga0495638_0057407 Ga0495638_0057407_1607_2362 250
63 3300046473 Ga0495582_0029969 Ga0495582_0029969_1032_1784 250
64 3300046474 Ga0495605_0040540 Ga0495605_0040540_915_1670 250
65 3300046475 Ga0495639_0092817 Ga0495639_0092817_223_978 250
66 3300046476 Ga0495662_0002022 Ga0495662_0002022_1785_2537 250
67 3300046476 Ga0495662_0015210 Ga0495662_0015210_2482_3237 250
68 3300046476 Ga0495662_0067866 Ga0495662_0067866_76_831 250
69 3300046477 Ga0495664_0007333 Ga0495664_0007333_4194_4946 250
70 3300046492 Ga0495585_0201179 Ga0495585_0201179_228_986 250
71 3300046499 Ga0495594_0003383 Ga0495594_0003383_7165_7923 250
72 3300046499 Ga0495594_0009553 Ga0495594_0009553_1242_1997 250
73 3300046499 Ga0495594_0035749 Ga0495594_0035749_1546_2298 250
74 3300046499 Ga0495594_0305910 Ga0495594_0305910_99_854 250
75 3300046506 Ga0495583_0069262 Ga0495583_0069262_303_1058 250
76 3300046507 Ga0495606_0103986 Ga0495606_0103986_329_1084 250
77 3300046511 Ga0495608_0230375 Ga0495608_0230375_44_799 250
78 3300046517 Ga0495630_0362596 Ga0495630_0362596_46_798 250
79 3300046524 Ga0495648_0073775 Ga0495648_0073775_288_1043 250
80 3300046526 Ga0495666_0167788 Ga0495666_0167788_228_980 250
81 3300046529 Ga0495652_0009693 Ga0495652_0009693_1279_2031 250
82 3300046530 Ga0495654_0069961 Ga0495654_0069961_18_773 250
83 3300046536 Ga0495587_0025959 Ga0495587_0025959_1785_2537 250
84 3300046557 Ga0495622_0001462 Ga0495622_0001462_7434_8192 250
85 3300046557 Ga0495622_0093101 Ga0495622_0093101_551_1306 250
86 3300046559 Ga0495667_0071170 Ga0495667_0071170_940_1692 250
87 3300046559 Ga0495667_0144064 Ga0495667_0144064_742_1497 250
88 3300046559 Ga0495667_0239449 Ga0495667_0239449_56_811 250
89 3300046642 Ga0495634_0003255 Ga0495634_0003255_6677_7429 250
90 3300046648 Ga0495611_0012252 Ga0495611_0012252_814_1572 250
91 3300046660 Ga0495625_0007997 Ga0495625_0007997_8063_8815 250
92 3300046663 Ga0495635_0001628 Ga0495635_0001628_9889_10641 250
93 3300046674 Ga0495588_0012621 Ga0495588_0012621_205_960 250
94 3300046674 Ga0495588_0012852 Ga0495588_0012852_3053_3811 250
95 3300046674 Ga0495588_0039977 Ga0495588_0039977_218_970 250
96 3300046674 Ga0495588_0040550 Ga0495588_0040550_881_1636 250
97 3300046675 Ga0495657_0000602 Ga0495657_0000602_18710_19462 250
98 3300046675 Ga0495657_0007427 Ga0495657_0007427_5049_5804 250
99 3300046680 Ga0495646_0002903 Ga0495646_0002903_8729_9481 250
100 3300046683 Ga0495658_0221233 Ga0495658_0221233_60_812 250
101 3300046689 Ga0495613_0000692 Ga0495613_0000692_11442_12194 250
102 3300046689 Ga0495613_0044906 Ga0495613_0044906_753_1508 250
103 3300046692 Ga0495671_0019594 Ga0495671_0019594_1828_2580 250
104 3300046794 Ga0495589_0052379 Ga0495589_0052379_39_794 250
105 3300046809 Ga0495600_0004965 Ga0495600_0004965_3510_4262 250
106 3300047315 Ga0495581_0021503 Ga0495581_0021503_1639_2391 250
107 3300047315 Ga0495581_0028167 Ga0495581_0028167_597_1352 250
108 3300047317 Ga0495604_0000721 Ga0495604_0000721_4976_5728 250
109 3300047318 Ga0495636_0003684 Ga0495636_0003684_3233_3985 250
110 3300047318 Ga0495636_0010711 Ga0495636_0010711_2721_3476 250
111 3300047319 Ga0495674_0219753 Ga0495674_0219753_357_1109 250
112 3300047321 Ga0495676_0008112 Ga0495676_0008112_1272_2024 250
113 3300047321 Ga0495676_0024527 Ga0495676_0024527_2634_3392 250
114 3300047443 Ga0495687_001141 Ga0495687_001141_24179_24931 250
115 3300047443 Ga0495687_010165 Ga0495687_010165_2756_3508 250
116 3300047445 Ga0495677_0075769 Ga0495677_0075769_163_918 250
117 3300047447 Ga0495685_001020 Ga0495685_001020_2711_3463 250
118 3300047470 Ga0495681_0007280 Ga0495681_0007280_6171_6923 250
119 3300048088 Ga0495602_0043267 Ga0495602_0043267_1246_1998 250
120 3300048089 Ga0495614_0026727 Ga0495614_0026727_1512_2264 250
121 3300048089 Ga0495614_0176235 Ga0495614_0176235_111_866 250
122 3300048908 Ga0496105_0445546 Ga0496105_0445546_14_769 250
123 3300048912 Ga0496109_0023826 Ga0496109_0023826_995_1750 250
124 3300048916 Ga0496113_0326140 Ga0496113_0326140_163_918 250
125 3300049459 Ga0495678_059895 Ga0495678_059895_151_906 250
126 3300049568 Ga0501031_0054293 Ga0501031_0054293_245_1003 250
127 3300049570 Ga0501033_0059425 Ga0501033_0059425_2045_2806 250
128 3300049571 Ga0501034_0015003 Ga0501034_0015003_2891_3649 250
129 3300049572 Ga0501036_0066881 Ga0501036_0066881_1321_2079 250
130 3300049574 Ga0501038_0022820 Ga0501038_0022820_2764_3522 250
131 3300049574 Ga0501038_0063785 Ga0501038_0063785_249_1001 250
132 3300049575 Ga0501039_0043957 Ga0501039_0043957_509_1267 250
133 3300049581 Ga0501047_0037314 Ga0501047_0037314_2152_2910 250
134 3300049586 Ga0501070_0306033 Ga0501070_0306033_471_1223 250
135 3300049742 Ga0501080_0191483 Ga0501080_0191483_1100_1858 250
136 3300049822 Ga0501035_0023644 Ga0501035_0023644_182_940 250
137 3300049823 Ga0501044_0006941 Ga0501044_0006941_8795_9547 250
138 3300049823 Ga0501044_0031794 Ga0501044_0031794_542_1300 250
139 3300050492 nmdc:mga0yw44_317976_c1 nmdc:mga0yw44_317976_c1_153_911 250
140 3300050494 nmdc:mga06z11_9367_c1 nmdc:mga06z11_9367_c1_445_1200 250
141 3300050495 nmdc:mga04h51_17603_c1 nmdc:mga04h51_17603_c1_890_1645 250
142 3300050516 nmdc:mga0sz30_158010_c1 nmdc:mga0sz30_158010_c1_41_793 250
143 3300053078 Ga0495612_0008854 Ga0495612_0008854_1812_2564 250
144 3300053088 Ga0500644_0022985 Ga0500644_0022985_673_1425 250
145 3300053095 Ga0500640_000618 Ga0500640_000618_3649_4401 250
146 3300053107 Ga0500560_017140 Ga0500560_017140_217_969 250
147 3300053149 Ga0500600_0094579 Ga0500600_0094579_505_1263 250
148 3300053149 Ga0500600_0101671 Ga0500600_0101671_266_1021 250
149 3300061719 Ga0466962_0001570 Ga0466962_0001570_9410_10165 250
150 3300021384 Ga0213876_10054175 Ga0213876_100541752 251
151 3300039437 Ga0436365_0763918 Ga0436365_0763918_1383_2156 251
152 iso_pu_bacteria 2643221587 2643944303 258
153 iso_pu_bacteria 2643221677 2644431148 258
154 iso_pu_bacteria 2862507626 2862512830 258
155 iso_pu_bacteria 2862574272 2862580569 258
156 iso_pu_bacteria 2918501144 2918508138 258
157 3300046809 Ga0495600_0335675 Ga0495600_0335675_39_836 259
158 3300047317 Ga0495604_0075800 Ga0495604_0075800_499_1296 259
159 iso_pu_bacteria 2808606982 2811845594 259
160 iso_pu_bacteria 2811994917 2812477189 259
161 iso_pu_bacteria 2554235005 2554257646 260
162 iso_pu_bacteria 2582581312 2585301046 260
163 iso_pu_bacteria 2582581313 2585306020 260
164 iso_pu_bacteria 2582581314 2585316432 260
165 iso_pu_bacteria 2616644814 2616693778 260
166 iso_pu_bacteria 2616644941 2616904424 260
167 iso_pu_bacteria 2643221578 2643900373 260
168 iso_pu_bacteria 2643221601 2644015810 260
169 iso_pu_bacteria 2643221631 2644175075 260
170 iso_pu_bacteria 2643221647 2644265114 260
171 iso_pu_bacteria 2643221673 2644405403 260
172 iso_pu_bacteria 2643221678 2644441795 260
173 iso_pu_bacteria 2643221714 2644630812 260
174 iso_pu_bacteria 2784132148 2784586005 260
175 iso_pu_bacteria 2784746763 2785346954 260
176 iso_pu_bacteria 2786546132 2786667185 260
177 iso_pu_bacteria 2808606359 2808846814 260
178 iso_pu_bacteria 2808606448 2809229506 260
179 iso_pu_bacteria 2811994879 2812361575 260
180 iso_pu_bacteria 2852635781 2852641708 260
181 iso_pu_bacteria 2862382967 2862391040 260
182 iso_pu_bacteria 2867428634 2867430503 260
183 iso_pu_bacteria 2877676314 2877684299 260
184 iso_pu_bacteria 2912715099 2912723395 260
185 iso_pu_bacteria 2912723979 2912726813 260
186 iso_pu_bacteria 2919468124 2919473837 260
187 iso_pu_bacteria 2946045630 2946049289 260
188 iso_pu_bacteria 2946064051 2946064588 260
189 iso_pu_bacteria 2947224130 2947224531 260
190 iso_pu_bacteria 2954380949 2954389639 260
191 iso_pu_bacteria 2954673503 2954682272 260
192 iso_pu_bacteria 2954682443 2954690651 260
193 iso_pu_bacteria 2954691527 2954700479 260
194 iso_pu_bacteria 2954701450 2954701749 260
195 iso_pu_bacteria 2954711539 2954719152 260
196 iso_pu_bacteria 2954721474 2954729123 260
197 iso_pu_bacteria 2954731030 2954732687 260
198 iso_pu_bacteria 2954740390 2954748023 260
199 iso_pu_bacteria 2954749733 2954751566 260
200 iso_pu_bacteria 2954759201 2954767148 260
201 iso_pu_bacteria 2990059506 2990063277 260
202 iso_pu_bacteria 2997451912 2997459251 260
203 iso_pu_bacteria 3006393351 3006398651 260
204 iso_pu_bacteria 3006486233 3006488620 260
205 iso_pu_bacteria 3006493962 3006498630 260
206 iso_pu_bacteria 8008558824 8008560177 260
207 iso_pu_bacteria 8008574985 8008581425 260
208 iso_pu_bacteria 8023623736 8023624555 260
209 iso_pu_bacteria 8025478263 8025483648 260
210 iso_pu_bacteria 8048406513 8048414157 260
211 iso_pu_bacteria 8056667051 8056673497 260
212 iso_pu_bacteria 8056829672 8056834976 260
213 3300046455 Ga0495603_0014207 Ga0495603_0014207_399_1187 262
214 3300046459 Ga0495629_0003509 Ga0495629_0003509_2737_3525 262
215 3300046460 Ga0495638_0191815 Ga0495638_0191815_315_1106 262
216 3300046492 Ga0495585_0054620 Ga0495585_0054620_1385_2176 262
217 3300046499 Ga0495594_0061067 Ga0495594_0061067_1267_2055 262
218 3300046674 Ga0495588_0121574 Ga0495588_0121574_530_1318 262
219 3300046691 Ga0495670_0029114 Ga0495670_0029114_683_1474 262
220 3300046794 Ga0495589_0009682 Ga0495589_0009682_1653_2444 262
221 3300046794 Ga0495589_0034464 Ga0495589_0034464_1087_1878 262
222 3300047318 Ga0495636_0042959 Ga0495636_0042959_596_1387 262
223 3300047321 Ga0495676_0011930 Ga0495676_0011930_3964_4755 262
224 3300047321 Ga0495676_0018216 Ga0495676_0018216_1845_2633 262
225 3300047447 Ga0495685_001222 Ga0495685_001222_4508_5299 262
226 3300047447 Ga0495685_019421 Ga0495685_019421_1253_2044 262
227 iso_pu_bacteria 2808606375 2808917448 262
228 iso_pu_bacteria 2935390628 2935390928 262
229 3300049822 Ga0501035_0020015 Ga0501035_0020015_140_934 263
230 3300001990 JGI24737J22298_10033929 JGI24737J22298_100339292 264
231 3300003320 rootH2_10022648 rootH2_100226484 264
232 3300003323 rootH1_10036297 rootH1_100362974 264
233 3300003323 rootH1_10098056 rootH1_100980562 264
234 3300005539 Ga0068853_100102166 Ga0068853_1001021662 264
235 3300005548 Ga0070665_100304787 Ga0070665_1003047872 264
236 3300005563 Ga0068855_100330478 Ga0068855_1003304782 264
237 3300005614 Ga0068856_100637700 Ga0068856_1006377002 264
238 3300005937 Ga0081455_10070627 Ga0081455_100706272 264
239 3300006038 Ga0075365_10099804 Ga0075365_100998042 264
240 3300006042 Ga0075368_10003569 Ga0075368_100035696 264
241 3300006048 Ga0075363_100021728 Ga0075363_1000217282 264
242 3300006048 Ga0075363_100051039 Ga0075363_1000510393 264
243 3300006178 Ga0075367_10000753 Ga0075367_1000075313 264
244 3300006353 Ga0075370_10158644 Ga0075370_101586442 264
245 3300009148 Ga0105243_10259389 Ga0105243_102593892 264
246 3300015688 Ga0183367_1003 Ga0183367_1003685 264
247 3300023436 Ga0256743_102822 Ga0256743_1028222 264
248 3300025302 Ga0207426_1019088 Ga0207426_10190882 264
249 3300025904 Ga0207647_10012458 Ga0207647_100124586 264
250 3300025949 Ga0207667_10228218 Ga0207667_102282182 264
251 3300026078 Ga0207702_10259232 Ga0207702_102592322 264
252 3300027866 Ga0209813_10015502 Ga0209813_100155022 264
253 3300028379 Ga0268266_10178717 Ga0268266_101787172 264
254 3300028786 Ga0307517_10025008 Ga0307517_100250087 264
255 3300028794 Ga0307515_10000106 Ga0307515_1000010670 264
256 3300028794 Ga0307515_10051551 Ga0307515_100515511 264
257 3300030521 Ga0307511_10002051 Ga0307511_100020516 264
258 3300030521 Ga0307511_10012524 Ga0307511_100125243 264
259 3300030522 Ga0307512_10034435 Ga0307512_100344353 264
260 3300030522 Ga0307512_10104615 Ga0307512_101046152 264
261 3300031456 Ga0307513_10006435 Ga0307513_100064359 264
262 3300031456 Ga0307513_10163077 Ga0307513_101630771 264
263 3300031507 Ga0307509_10004141 Ga0307509_1000414116 264
264 3300031507 Ga0307509_10007222 Ga0307509_100072222 264
265 3300031507 Ga0307509_10021254 Ga0307509_1002125410 264
266 3300031616 Ga0307508_10036246 Ga0307508_100362462 264
267 3300031616 Ga0307508_10056418 Ga0307508_100564183 264
268 3300031616 Ga0307508_10064584 Ga0307508_100645843 264
269 3300031649 Ga0307514_10005418 Ga0307514_1000541813 264
270 3300031649 Ga0307514_10101564 Ga0307514_101015643 264
271 3300031730 Ga0307516_10000711 Ga0307516_1000071136 264
272 3300031730 Ga0307516_10009394 Ga0307516_100093947 264
273 3300031730 Ga0307516_10281774 Ga0307516_102817742 264
274 3300031838 Ga0307518_10036585 Ga0307518_100365854 264
275 3300031838 Ga0307518_10088112 Ga0307518_100881123 264
276 3300031838 Ga0307518_10156973 Ga0307518_101569732 264
277 3300033179 Ga0307507_10005664 Ga0307507_100056646 264
278 3300033179 Ga0307507_10005887 Ga0307507_100058878 264
279 3300033180 Ga0307510_10010384 Ga0307510_100103845 264
280 3300033180 Ga0307510_10033747 Ga0307510_100337471 264
281 3300033180 Ga0307510_10039953 Ga0307510_100399535 264
282 3300033180 Ga0307510_10042962 Ga0307510_100429623 264
283 3300041404 Ga0439436_0012047 Ga0439436_0012047_1808_2605 264
284 3300042007 Ga0439449_0052691 Ga0439449_0052691_50_847 264
285 3300042014 Ga0439457_005218 Ga0439457_005218_143_940 264
286 3300042015 Ga0439462_0021541 Ga0439462_0021541_628_1425 264
287 3300042134 Ga0450898_002555 Ga0450898_002555_1540_2349 264
288 3300044694 Ga0466963_0010728 Ga0466963_0010728_869_1672 264
289 3300046453 Ga0495627_048250 Ga0495627_048250_100_936 264
290 3300046454 Ga0495592_0008890 Ga0495592_0008890_6381_7181 264
291 3300046455 Ga0495603_0000870 Ga0495603_0000870_7185_7985 264
292 3300046455 Ga0495603_0014721 Ga0495603_0014721_1009_1845 264
293 3300046455 Ga0495603_0024420 Ga0495603_0024420_928_1728 264
294 3300046459 Ga0495629_0001850 Ga0495629_0001850_9257_10057 264
295 3300046459 Ga0495629_0015654 Ga0495629_0015654_4160_4960 264
296 3300046459 Ga0495629_0049973 Ga0495629_0049973_685_1521 264
297 3300046459 Ga0495629_0050682 Ga0495629_0050682_1680_2501 264
298 3300046462 Ga0495651_0040747 Ga0495651_0040747_1716_2540 264
299 3300046462 Ga0495651_0051010 Ga0495651_0051010_1939_2739 264
300 3300046473 Ga0495582_0078545 Ga0495582_0078545_41_877 264
301 3300046474 Ga0495605_0002758 Ga0495605_0002758_3018_3854 264
302 3300046477 Ga0495664_0018929 Ga0495664_0018929_2399_3199 264
303 3300046499 Ga0495594_0058261 Ga0495594_0058261_654_1490 264
304 3300046499 Ga0495594_0122088 Ga0495594_0122088_537_1337 264
305 3300046499 Ga0495594_0125270 Ga0495594_0125270_646_1443 264
306 3300046500 Ga0495596_0093845 Ga0495596_0093845_43_879 264
307 3300046501 Ga0495607_0026586 Ga0495607_0026586_595_1431 264
308 3300046506 Ga0495583_0069947 Ga0495583_0069947_197_1033 264
309 3300046507 Ga0495606_0032536 Ga0495606_0032536_2707_3543 264
310 3300046512 Ga0495610_0030475 Ga0495610_0030475_223_1059 264
311 3300046514 Ga0495618_0115532 Ga0495618_0115532_528_1328 264
312 3300046516 Ga0495628_0009467 Ga0495628_0009467_3706_4506 264
313 3300046516 Ga0495628_0026929 Ga0495628_0026929_2419_3243 264
314 3300046517 Ga0495630_0184173 Ga0495630_0184173_588_1385 264
315 3300046518 Ga0495631_0040130 Ga0495631_0040130_608_1444 264
316 3300046524 Ga0495648_0057485 Ga0495648_0057485_448_1284 264
317 3300046526 Ga0495666_0134466 Ga0495666_0134466_320_1117 264
318 3300046529 Ga0495652_0288953 Ga0495652_0288953_186_1010 264
319 3300046533 Ga0495640_0001026 Ga0495640_0001026_2340_3140 264
320 3300046533 Ga0495640_0005875 Ga0495640_0005875_7735_8556 264
321 3300046535 Ga0495586_0126612 Ga0495586_0126612_138_935 264
322 3300046538 Ga0495609_0010921 Ga0495609_0010921_1316_2152 264
323 3300046557 Ga0495622_0024633 Ga0495622_0024633_1383_2219 264
324 3300046558 Ga0495633_0128897 Ga0495633_0128897_319_1155 264
325 3300046616 Ga0495668_0028737 Ga0495668_0028737_618_1454 264
326 3300046642 Ga0495634_0148380 Ga0495634_0148380_246_1046 264
327 3300046642 Ga0495634_0195366 Ga0495634_0195366_257_1093 264
328 3300046642 Ga0495634_0359530 Ga0495634_0359530_11_835 264
329 3300046660 Ga0495625_0065775 Ga0495625_0065775_1729_2526 264
330 3300046660 Ga0495625_0195284 Ga0495625_0195284_276_1112 264
331 3300046663 Ga0495635_0022724 Ga0495635_0022724_2281_3105 264
332 3300046665 Ga0495661_0059492 Ga0495661_0059492_819_1655 264
333 3300046675 Ga0495657_0017427 Ga0495657_0017427_1379_2200 264
334 3300046675 Ga0495657_0029058 Ga0495657_0029058_1803_2603 264
335 3300046679 Ga0495623_0007754 Ga0495623_0007754_2143_2940 264
336 3300046680 Ga0495646_0113483 Ga0495646_0113483_263_1084 264
337 3300046689 Ga0495613_0001291 Ga0495613_0001291_9005_9805 264
338 3300046689 Ga0495613_0008083 Ga0495613_0008083_3334_4134 264
339 3300046689 Ga0495613_0017739 Ga0495613_0017739_4160_4981 264
340 3300046690 Ga0495624_0023297 Ga0495624_0023297_2112_2912 264
341 3300046694 Ga0495649_0028597 Ga0495649_0028597_1406_2242 264
342 3300046794 Ga0495589_0081377 Ga0495589_0081377_670_1506 264
343 3300046809 Ga0495600_0097511 Ga0495600_0097511_172_972 264
344 3300046809 Ga0495600_0197604 Ga0495600_0197604_124_945 264
345 3300046810 Ga0495660_0087327 Ga0495660_0087327_564_1400 264
346 3300047315 Ga0495581_0011453 Ga0495581_0011453_3931_4752 264
347 3300047317 Ga0495604_0006293 Ga0495604_0006293_5947_6747 264
348 3300047321 Ga0495676_0003652 Ga0495676_0003652_8769_9569 264
349 3300047321 Ga0495676_0010424 Ga0495676_0010424_5998_6798 264
350 3300047321 Ga0495676_0047530 Ga0495676_0047530_2041_2877 264
351 3300047321 Ga0495676_0052568 Ga0495676_0052568_1531_2355 264
352 3300047322 Ga0495680_0013028 Ga0495680_0013028_4655_5479 264
353 3300047323 Ga0495683_0052296 Ga0495683_0052296_199_1035 264
354 3300047444 Ga0495675_0072231 Ga0495675_0072231_1224_2024 264
355 3300047444 Ga0495675_0306287 Ga0495675_0306287_24_821 264
356 3300047673 Ga0495593_0106111 Ga0495593_0106111_556_1356 264
357 3300047673 Ga0495593_0142599 Ga0495593_0142599_317_1141 264
358 3300048089 Ga0495614_0000431 Ga0495614_0000431_9296_10096 264
359 3300048089 Ga0495614_0033515 Ga0495614_0033515_1360_2184 264
360 3300048091 Ga0495626_0028351 Ga0495626_0028351_501_1337 264
361 3300049459 Ga0495678_040311 Ga0495678_040311_1015_1851 264
362 3300049460 Ga0495682_0078857 Ga0495682_0078857_327_1163 264
363 3300049569 Ga0501032_0027569 Ga0501032_0027569_3042_3845 264
364 3300049570 Ga0501033_0056191 Ga0501033_0056191_572_1375 264
365 3300049571 Ga0501034_0047157 Ga0501034_0047157_2476_3288 264
366 3300049571 Ga0501034_0061900 Ga0501034_0061900_25_849 264
367 3300049572 Ga0501036_0013461 Ga0501036_0013461_1433_2245 264
368 3300049573 Ga0501037_0119743 Ga0501037_0119743_1013_1825 264
369 3300049574 Ga0501038_0033542 Ga0501038_0033542_882_1694 264
370 3300049574 Ga0501038_0097028 Ga0501038_0097028_222_1046 264
371 3300049579 Ga0501043_0016594 Ga0501043_0016594_2290_3102 264
372 3300049579 Ga0501043_0049731 Ga0501043_0049731_279_1103 264
373 3300049581 Ga0501047_0026580 Ga0501047_0026580_1494_2306 264
374 3300049581 Ga0501047_0038843 Ga0501047_0038843_148_951 264
375 3300049581 Ga0501047_0079603 Ga0501047_0079603_2146_2970 264
376 3300049582 Ga0501048_0010085 Ga0501048_0010085_4631_5443 264
377 3300049741 Ga0501079_0308148 Ga0501079_0308148_81_893 264
378 3300049822 Ga0501035_0016972 Ga0501035_0016972_2495_3307 264
379 3300049823 Ga0501044_0137228 Ga0501044_0137228_858_1670 264
380 3300049823 Ga0501044_0214526 Ga0501044_0214526_94_918 264
381 3300059503 Ga0587080_036131 Ga0587080_036131_71_865 264
382 iso_pu_bacteria 2946072368 2946073005 264
383 iso_pu_bacteria 2954002825 2954009144 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

119

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9402 5 251
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.8789 5 251
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8254 4 122
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8101 6 122
2pjs-assembly1.cif.gz_B crystal structure of atu1953, protein of unknown function 0.7846 203 250
ID Description Score Start End Superfamily
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.963 5 125 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9553 5 125 3.10.180.10
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9529 6 130 3.10.180.10
af_I6XA34_134_256_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9098 133 251 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8938 3 122 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A370RWE3-F1-model_v4 deleted 0.9903 98 264
AF-A0A6B3HHJ4-F1-model_v4 VOC family protein 0.9884 18 154
AF-A0A5B7V2Q2-F1-model_v4 27 kDa antigen Cfp30B 0.9864 1 262
AF-A0A1C4QG54-F1-model_v4 VOC domain-containing protein 0.9861 61 264
AF-A0A5B7V2Q2-F1-model_v4 27 kDa antigen Cfp30B 0.979 1 262

Feature Viewer

pLDDT pTM Quality
94.71 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map