F429474

General Info

Members Datasets Scaffolds Average Seq Length
383 299 225 362

Family's Representative Sequence

Representative Sequence 3300003758|Ga0055532_1001864|Ga0055532_10018645
Length 432
Sequence LRYSASFCRVARSYFVSKANEIKRFHGCSSFGTTLAKKWIWNYVFSPASGPNANRRTKQRLNDTREVSSLSIFDYMQKYDYEQLVFCQDQNSGLKAIICIHDTTLGPALGGTRMWPYKTEEEAIIDVLRLARGMTYKNAAAGLNIGGGKAVIIGDPRQHKSEELFRAFGRYIQGLNGRYITAEDVGTSVDDMDLIHLETDFVTGVSPAFGSSGNPSPVTAYGVYRGMKAAAKMAYGTDDLSGRVVAVQGVGNVAYNLCRHLHEEGAHLIVTDINEENVNRAVNDFGAKAVGVNEIFGVECDIFSPCALGAVINDDTIPLLKAKVIAGAANNQLKEDRHGDQIHEMGLFYAPDYVINAGGVINVADELQGYNRERALKKVETVYDNILRVFEIAQRDGVPSYKAADRMAEERIASVAKSRNTFLQNGKTVYHR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
3 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
4 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
5 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
6 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
7 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
8 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
9 2554235283 Bacillus safensis VK Isolate Rhizosphere
10 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
11 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
12 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
13 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
14 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
15 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
16 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
17 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
18 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
19 2643221729 Bacillus sp. Root11 Isolate Unclassified
20 2643221730 Bacillus sp. Root131 Isolate Unclassified
21 2643221731 Bacillus sp. Root147 Isolate Unclassified
22 2643221732 Bacillus sp. Root239 Isolate Unclassified
23 2643221735 Bacillus sp. Root920 Isolate Unclassified
24 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
25 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
26 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
27 2684622632 Bacillus cereus 905 Isolate Unclassified
28 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
29 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
30 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
31 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
32 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
33 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
34 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
35 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
36 2738541295 Bacillus sp. OK085 Isolate Unclassified
37 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
38 2738541358 Bacillus sp. OV752 Isolate Unclassified
39 2738543006 Bacillus sp. OK077 Isolate Unclassified
40 2738543017 Bacillus sp. OV186 Isolate Unclassified
41 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
42 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
43 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
44 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
45 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
46 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
47 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
48 2811994870 Bacillus sp. JB4 Isolate Unclassified
49 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
50 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
51 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
52 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
53 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
54 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
55 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
56 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
57 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
58 2842682962 Bacillus sp. R-72492 Isolate Unclassified
59 2842882022 Bacillus sp. R-71893 Isolate Unclassified
60 2849139964 Bacillus sp. R-71875 Isolate Unclassified
61 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
62 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
63 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
64 2857581216 Bacillus sp. R-71922 Isolate Unclassified
65 2857586860 Bacillus sp. R-71935 Isolate Unclassified
66 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
67 2860837431 Bacillus sp. WR11 Isolate Unclassified
68 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
69 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
70 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
71 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
72 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
73 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
74 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
75 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
76 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
77 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
78 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
79 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
80 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
81 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
82 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
83 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
84 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
85 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
86 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
87 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
88 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
89 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
90 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
91 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
92 2919720352 Priestia megaterium 4340 Isolate Unclassified
93 2919726948 Bacillus pumilus 4489 Isolate Unclassified
94 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
95 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
96 2929004312 Priestia megaterium 1104 Isolate Unclassified
97 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
98 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
99 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
100 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
101 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
102 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
103 2938917290 Bacillus sp. CR71 Isolate Unclassified
104 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
105 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
106 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
107 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
108 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
109 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
110 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
111 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
112 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
113 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
114 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
115 2965761152 Bacillus sp. COPE52 Isolate Unclassified
116 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
117 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
118 2969141011 Bacillus velezensis MH25 Isolate Unclassified
119 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
120 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
121 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
122 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
123 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
124 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
125 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
126 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
127 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
128 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
129 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
130 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
131 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
132 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
133 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
134 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
135 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
136 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
137 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
138 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
139 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
140 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
141 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
142 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
143 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
144 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
145 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
146 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
147 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
148 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
149 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
150 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
151 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
152 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
153 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
154 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
155 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
156 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
157 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
158 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
159 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
160 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
161 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
162 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
163 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
164 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
165 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
166 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
167 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
168 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
169 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
170 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
171 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
172 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
173 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
174 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
175 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
199 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
204 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
207 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
210 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
266 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
267 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
268 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
269 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
283 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere
284 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
285 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
286 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
287 8022653035 Bacillus sp. Rc4 Isolate Unclassified
288 8022792930 Bacillus sp. Xin Isolate Rhizosphere
289 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
290 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
291 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
292 8023438354 Bacillus sp. BH2 Isolate Unclassified
293 8023444577 Bacillus sp. BH32 Isolate Unclassified
294 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
295 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
296 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
297 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
298 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
299 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 57.7
Metatranscriptomes 1.04
Isolates 41.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 0.52
Rhizoplane 4.96
Rhizosphere 62.92
Stem 0
Stem Tuber 0
Unclassified 24.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2693654 2162886007 Bacteria 123938
2 JGI25151J46595_10000006 3300003187 Bacteria 419711
3 JGI25151J46595_10001830 3300003187 Bacteria 13710
4 JGI25151J46595_10003274 3300003187 Bacteria 9007
5 rootH1_10000511 3300003316 Bacteria 11547
6 rootL2_10035059 3300003322 Bacteria 12352
7 rootH1_10328621 3300003323 Bacteria 3732
8 Ga0006562J51391_1000410 3300003578 Bacteria 19180
9 Ga0006562J51391_1000825 3300003578 Bacteria 7550
10 Ga0006562J51391_1017154 3300003578 Bacteria 1212
11 Ga0055538_1000272 3300003751 Bacteria 26908
12 Ga0055532_1000046 3300003758 Bacteria 182389
13 Ga0055532_1001864 3300003758 Bacteria 5150
14 Ga0055528_1001363 3300003790 Bacteria 15051
15 Ga0065704_10070132 3300005289 Bacteria 1955461
16 Ga0070670_100069554 3300005331 Bacteria 3022
17 Ga0070668_100149513 3300005347 Bacteria 1887
18 Ga0070675_100331210 3300005354 Bacteria 1347
19 Ga0070671_100024067 3300005355 Bacteria 4984
20 Ga0070673_100320257 3300005364 Bacteria 1369
21 Ga0070672_100259665 3300005543 Bacteria 1465
22 Ga0070665_100059715 3300005548 Bacteria 3822
23 Ga0068855_100366583 3300005563 Bacteria 1584
24 Ga0081538_10034734 3300005981 Bacteria 3327
25 Ga0070712_100019413 3300006175 Bacteria 4434
26 Ga0075430_100037824 3300006846 Bacteria 4090
27 Ga0075434_100080082 3300006871 Bacteria 3263
28 Ga0075429_100098558 3300006880 Bacteria 2550
29 Ga0105244_10022052 3300009036 Bacteria 3511
30 Ga0105244_10031252 3300009036 Bacteria 2826
31 Ga0105244_10072296 3300009036 Bacteria 1718
32 Ga0105250_10001573 3300009092 Bacteria 12266
33 Ga0105245_10033570 3300009098 Bacteria 4549
34 Ga0105247_10008355 3300009101 Bacteria 6311
35 Ga0114129_10069496 3300009147 Bacteria 4909
36 Ga0114129_10119778 3300009147 Bacteria 3625
37 Ga0114129_10559482 3300009147 Bacteria 1486
38 Ga0105243_10058873 3300009148 Bacteria 3063
39 Ga0105242_10005264 3300009176 Bacteria 9990
40 Ga0105246_10005141 3300011119 Bacteria 7955
41 Ga0157371_10009994 3300013102 Bacteria 7426
42 Ga0157374_10009592 3300013296 Bacteria 8313
43 Ga0157378_10023403 3300013297 Bacteria 5437
44 Ga0163162_10115157 3300013306 Bacteria 2788
45 Ga0157377_10016747 3300014745 Bacteria 3776
46 Ga0157379_10169154 3300014968 Bacteria 1973
47 Ga0163161_10085434 3300017792 Bacteria 2328
48 Ga0209147_100014 3300025229 Bacteria 597841
49 Ga0209147_100139 3300025229 Bacteria 116694
50 Ga0209147_100421 3300025229 Bacteria 27840
51 Ga0209147_101106 3300025229 Bacteria 11228
52 Ga0209437_100662 3300025233 Bacteria 19091
53 Ga0209130_1002466 3300025284 Bacteria 9238
54 Ga0209130_1018144 3300025284 Bacteria 1658
55 Ga0209675_1018236 3300025291 Bacteria 1971
56 Ga0209676_1000489 3300025292 Bacteria 63909
57 Ga0209025_1000001 3300025294 Bacteria 1888151
58 Ga0209025_1000041 3300025294 Bacteria 373694
59 Ga0209025_1000560 3300025294 Bacteria 68223
60 Ga0209025_1004724 3300025294 Bacteria 11614
61 Ga0209025_1010172 3300025294 Bacteria 6418
62 Ga0209025_1010175 3300025294 Bacteria 6418
63 Ga0209025_1011552 3300025294 Bacteria 5798
64 Ga0209025_1012005 3300025294 Bacteria 5617
65 Ga0209025_1025188 3300025294 Bacteria 3037
66 Ga0207426_1010153 3300025302 Bacteria 3674
67 Ga0207696_1004861 3300025711 Bacteria 5693
68 Ga0207696_1007050 3300025711 Bacteria 4447
69 Ga0207655_1002590 3300025728 Bacteria 14401
70 Ga0207655_1006256 3300025728 Bacteria 7917
71 Ga0207713_1001934 3300025735 Bacteria 15679
72 Ga0207645_10076039 3300025907 Bacteria 2150
73 Ga0207659_10080345 3300025926 Bacteria 2408
74 Ga0207659_10186543 3300025926 Bacteria 1647
75 Ga0207706_10232802 3300025933 Bacteria 1611
76 Ga0207686_10095770 3300025934 Bacteria 1970
77 Ga0207691_10070706 3300025940 Bacteria 3151
78 Ga0207675_100036339 3300026118 Bacteria 4596
79 Ga0207675_100240774 3300026118 Bacteria 1748
80 Ga0268266_10044452 3300028379 Bacteria 3797
81 Ga0237817_10054 3300030083 Bacteria 38618
82 Ga0307408_100003918 3300031548 Bacteria 10144
83 Ga0316579_10035369 3300031691 Bacteria 2302
84 Ga0316576_10008004 3300031727 Bacteria 6703
85 Ga0316576_10293564 3300031727 Bacteria 1216
86 Ga0316578_10001640 3300031728 Bacteria 9287
87 Ga0316578_10002294 3300031728 Bacteria 8311
88 Ga0316578_10019605 3300031728 Bacteria 3726
89 Ga0316577_10003664 3300031733 Bacteria 7808
90 Ga0316577_10005103 3300031733 Bacteria 6855
91 Ga0316577_10005387 3300031733 Bacteria 6708
92 Ga0307412_10026882 3300031911 Bacteria 3582
93 Ga0307412_10144253 3300031911 Bacteria 1748
94 Ga0307416_100012025 3300032002 Bacteria 5809
95 Ga0307414_10000078 3300032004 Bacteria 90911
96 Ga0316580_10005954 3300032139 Bacteria 3579
97 Ga0316574_0001866 3300035398 Bacteria 10295
98 Ga0316574_0018413 3300035398 Bacteria 4103
99 Ga0316574_0026620 3300035398 Bacteria 3479
100 Ga0316574_0040951 3300035398 Bacteria 2854
101 Ga0316574_0050432 3300035398 Bacteria 2590
102 Ga0316574_0167715 3300035398 Bacteria 1414
103 Ga0373924_0060480 3300035410 Unclassified 1584
104 Ga0316582_0012607 3300036647 Bacteria 4725
105 Ga0316584_0000315 3300036712 Bacteria 24865
106 Ga0316584_0032665 3300036712 Bacteria 3853
107 Ga0316584_0213243 3300036712 Bacteria 1420
108 Ga0395905_0000397 3300037471 Bacteria 61701
109 Ga0316581_0002249 3300037588 Bacteria 4570
110 Ga0237819_00085 3300038705 Bacteria 34209
111 Ga0451577_0000001 3300042876 Bacteria 2461803
112 Ga0451577_0003340 3300042876 Bacteria 17977
113 Ga0466972_0049572 3300044658 Bacteria 2028
114 Ga0466960_0051320 3300044901 Bacteria 1992
115 Ga0451576_0147175 3300045051 Bacteria 2456
116 Ga0466967_0002151 3300045976 Bacteria 12095
117 Ga0495603_0028112 3300046455 Bacteria 3392
118 Ga0495603_0055995 3300046455 Bacteria 2335
119 Ga0495654_0058667 3300046530 Bacteria 1856
120 Ga0495586_0005464 3300046535 Bacteria 6796
121 Ga0495598_0001137 3300046537 Bacteria 5122
122 Ga0495636_0014571 3300047318 Unclassified 3127
123 Ga0495636_0040729 3300047318 Bacteria 1926
124 Ga0495683_0016200 3300047323 Bacteria 3871
125 Ga0496101_0004006 3300048904 Bacteria 9211
126 Ga0496102_0021951 3300048905 Bacteria 5652
127 Ga0496102_0049416 3300048905 Bacteria 3827
128 Ga0496103_0002081 3300048906 Bacteria 12786
129 Ga0496103_0128664 3300048906 Bacteria 1616
130 Ga0496104_0002047 3300048907 Bacteria 17512
131 Ga0496105_0001200 3300048908 Bacteria 18053
132 Ga0496106_0000104 3300048909 Bacteria 64967
133 Ga0496107_0000186 3300048910 Bacteria 32292
134 Ga0496108_0001707 3300048911 Bacteria 17406
135 Ga0496109_0002162 3300048912 Bacteria 16340
136 Ga0496110_0035890 3300048913 Bacteria 4304
137 Ga0496110_0184036 3300048913 Bacteria 1897
138 Ga0496110_0250761 3300048913 Bacteria 1611
139 Ga0496111_0128707 3300048914 Bacteria 1872
140 Ga0496112_0046413 3300048915 Bacteria 4260
141 Ga0496113_0024927 3300048916 Bacteria 4258
142 Ga0496117_0008625 3300048920 Bacteria 9650
143 Ga0496118_0051015 3300048921 Bacteria 3169
144 Ga0496119_0006826 3300048922 Bacteria 10466
145 Ga0496121_0103291 3300048924 Bacteria 2193
146 Ga0496122_0021835 3300048925 Bacteria 5712
147 Ga0496122_0068409 3300048925 Bacteria 2550
148 Ga0496122_0069800 3300048925 Bacteria 2514
149 Ga0496123_0033653 3300048926 Bacteria 3684
150 Ga0496124_0000003 3300048927 Bacteria 1300161
151 Ga0496124_0071599 3300048927 Bacteria 2873
152 Ga0496124_0180958 3300048927 Bacteria 1622
153 Ga0496125_0003173 3300048928 Bacteria 20377
154 Ga0496125_0009749 3300048928 Bacteria 9804
155 Ga0496125_0017280 3300048928 Bacteria 6888
156 Ga0496125_0020429 3300048928 Bacteria 6215
157 Ga0496125_0087700 3300048928 Bacteria 2349
158 Ga0496125_0156809 3300048928 Bacteria 1554
159 Ga0496126_0004279 3300048929 Bacteria 17164
160 Ga0496126_0048553 3300048929 Bacteria 3878
161 Ga0501305_004096 3300049161 Bacteria 1694
162 Ga0501031_0365044 3300049568 Bacteria 934
163 Ga0501034_0016997 3300049571 Bacteria 7457
164 Ga0501034_0038541 3300049571 Bacteria 4839
165 Ga0501036_0136469 3300049572 Bacteria 2071
166 Ga0501036_0163598 3300049572 Bacteria 1876
167 Ga0501038_0072256 3300049574 Bacteria 2924
168 Ga0501039_0055360 3300049575 Bacteria 3072
169 Ga0501039_0134413 3300049575 Bacteria 1941
170 Ga0501040_0019026 3300049576 Bacteria 4564
171 Ga0501040_0029697 3300049576 Bacteria 3691
172 Ga0501043_0178771 3300049579 Bacteria 1654
173 Ga0501046_0125913 3300049580 Bacteria 1946
174 Ga0501048_0041653 3300049582 Bacteria 3289
175 Ga0501048_0050644 3300049582 Bacteria 2957
176 Ga0501067_0000476 3300049583 Bacteria 21831
177 Ga0501067_0001132 3300049583 Bacteria 14430
178 Ga0501068_0001154 3300049584 Bacteria 14006
179 Ga0501068_0002248 3300049584 Bacteria 10274
180 Ga0501069_0000816 3300049585 Bacteria 14687
181 Ga0501069_0019710 3300049585 Bacteria 3649
182 Ga0501070_0004311 3300049586 Bacteria 12224
183 Ga0501071_0000262 3300049587 Bacteria 24709
184 Ga0501071_0001293 3300049587 Bacteria 14247
185 Ga0501072_0006241 3300049588 Bacteria 9083
186 Ga0501073_0005195 3300049589 Bacteria 9761
187 Ga0501074_0005457 3300049590 Bacteria 9149
188 Ga0501075_0011943 3300049591 Bacteria 6162
189 Ga0501075_0088127 3300049591 Bacteria 2353
190 Ga0501075_0118894 3300049591 Bacteria 2010
191 Ga0501075_0221559 3300049591 Bacteria 1443
192 Ga0501076_0076855 3300049592 Bacteria 2678
193 Ga0501076_0152292 3300049592 Bacteria 1881
194 Ga0501077_0003994 3300049593 Bacteria 8903
195 Ga0501077_0075755 3300049593 Bacteria 2131
196 Ga0501077_0098041 3300049593 Bacteria 1858
197 Ga0501206_003001 3300049653 Bacteria 2139
198 Ga0501217_008469 3300049661 Bacteria 2222
199 Ga0501242_002078 3300049674 Unclassified 2087
200 Ga0501257_000567 3300049686 Bacteria 7340
201 Ga0501221_021185 3300049704 Bacteria 1277
202 Ga0501079_0021696 3300049741 Bacteria 4915
203 Ga0501079_0069776 3300049741 Bacteria 2713
204 Ga0501079_0115235 3300049741 Bacteria 2089
205 Ga0501080_0009961 3300049742 Bacteria 8685
206 Ga0501080_0133956 3300049742 Bacteria 2293
207 Ga0501081_0094555 3300049743 Bacteria 2106
208 Ga0501083_0000939 3300049744 Bacteria 19248
209 Ga0501083_0006607 3300049744 Bacteria 8230
210 Ga0501045_0292302 3300049824 Bacteria 1212
211 nmdc:mga05p37_479990_c1 3300050507 Bacteria 1432
212 nmdc:mga0n895_331450_c1 3300050512 Bacteria 1542
213 Ga0501084_0002412 3300054114 Bacteria 15027
214 Ga0501084_0005595 3300054114 Bacteria 10317
215 Ga0501084_0154574 3300054114 Bacteria 1934
216 Ga0501084_0212691 3300054114 Bacteria 1631
217 Ga0590071_001961 3300059421 Bacteria 5260
218 Ga0590074_005022 3300059423 Bacteria 2188
219 Ga0590075_022653 3300059424 Bacteria 1573
220 Ga0501082_0020281 3300060353 Bacteria 5730
221 Ga0501082_0032034 3300060353 Bacteria 4534
222 Ga0501082_0143195 3300060353 Bacteria 2075
223 Ga0501082_0184648 3300060353 Bacteria 1814
224 Ga0530510_0101071 3300061734 Bacteria 2109
225 Ga0530510_0111537 3300061734 Bacteria 2003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0060480 Ga0373924_0060480_669_1556 285
2 3300046455 Ga0495603_0028112 Ga0495603_0028112_2499_3365 288
3 3300049568 Ga0501031_0365044 Ga0501031_0365044_33_908 291
4 3300045051 Ga0451576_0147175 Ga0451576_0147175_1447_2403 315
5 3300005548 Ga0070665_100059715 Ga0070665_1000597153 319
6 3300028379 Ga0268266_10044452 Ga0268266_100444525 319
7 3300006175 Ga0070712_100019413 Ga0070712_1000194134 342
8 iso_pu_bacteria 2939647034 2939649215 342
9 iso_pu_bacteria 2600254943 2600402537 346
10 3300006871 Ga0075434_100080082 Ga0075434_1000800823 347
11 3300006880 Ga0075429_100098558 Ga0075429_1000985582 347
12 3300009147 Ga0114129_10069496 Ga0114129_100694964 347
13 3300050512 nmdc:mga0n895_331450_c1 nmdc:mga0n895_331450_c1_436_1509 347
14 3300044658 Ga0466972_0049572 Ga0466972_0049572_128_1228 348
15 3300044901 Ga0466960_0051320 Ga0466960_0051320_748_1824 348
16 iso_pu_bacteria 2864733723 2864738075 348
17 3300005981 Ga0081538_10034734 Ga0081538_100347343 349
18 3300046535 Ga0495586_0005464 Ga0495586_0005464_2756_3835 349
19 3300049572 Ga0501036_0136469 Ga0501036_0136469_927_1976 349
20 3300049576 Ga0501040_0019026 Ga0501040_0019026_2959_4059 349
21 3300049580 Ga0501046_0125913 Ga0501046_0125913_723_1772 349
22 3300049591 Ga0501075_0221559 Ga0501075_0221559_347_1396 349
23 3300049592 Ga0501076_0152292 Ga0501076_0152292_543_1592 349
24 3300049593 Ga0501077_0098041 Ga0501077_0098041_285_1334 349
25 3300049741 Ga0501079_0115235 Ga0501079_0115235_11_1060 349
26 3300050507 nmdc:mga05p37_479990_c1 nmdc:mga05p37_479990_c1_304_1353 349
27 3300054114 Ga0501084_0154574 Ga0501084_0154574_829_1878 349
28 3300054114 Ga0501084_0212691 Ga0501084_0212691_394_1443 349
29 3300031728 Ga0316578_10001640 Ga0316578_100016402 351
30 3300031728 Ga0316578_10019605 Ga0316578_100196052 351
31 3300031733 Ga0316577_10005387 Ga0316577_100053872 351
32 3300035398 Ga0316574_0040951 Ga0316574_0040951_676_1785 351
33 3300036712 Ga0316584_0000315 Ga0316584_0000315_19711_20811 351
34 iso_pu_bacteria 8018127388 8018132985 351
35 3300005354 Ga0070675_100331210 Ga0070675_1003312102 352
36 3300005364 Ga0070673_100320257 Ga0070673_1003202572 352
37 3300005543 Ga0070672_100259665 Ga0070672_1002596652 352
38 3300014968 Ga0157379_10169154 Ga0157379_101691542 352
39 3300025926 Ga0207659_10186543 Ga0207659_101865432 352
40 3300025933 Ga0207706_10232802 Ga0207706_102328022 352
41 3300025940 Ga0207691_10070706 Ga0207691_100707062 352
42 3300026118 Ga0207675_100240774 Ga0207675_1002407742 352
43 3300032004 Ga0307414_10000078 Ga0307414_1000007861 352
44 3300048928 Ga0496125_0017280 Ga0496125_0017280_5703_6761 352
45 3300049576 Ga0501040_0029697 Ga0501040_0029697_2528_3586 352
46 3300049591 Ga0501075_0011943 Ga0501075_0011943_3635_4693 352
47 3300049593 Ga0501077_0003994 Ga0501077_0003994_2606_3664 352
48 3300049653 Ga0501206_003001 Ga0501206_003001_57_1154 352
49 3300049674 Ga0501242_002078 Ga0501242_002078_414_1511 352
50 3300049686 Ga0501257_000567 Ga0501257_000567_4805_5902 352
51 3300049743 Ga0501081_0094555 Ga0501081_0094555_1026_2084 352
52 3300060353 Ga0501082_0184648 Ga0501082_0184648_447_1505 352
53 3300061734 Ga0530510_0101071 Ga0530510_0101071_224_1294 352
54 3300061734 Ga0530510_0111537 Ga0530510_0111537_511_1569 352
55 iso_pu_bacteria 2919692658 2919693918 352
56 3300031733 Ga0316577_10005103 Ga0316577_100051033 354
57 3300032139 Ga0316580_10005954 Ga0316580_100059543 354
58 3300035398 Ga0316574_0018413 Ga0316574_0018413_2806_3882 354
59 3300036647 Ga0316582_0012607 Ga0316582_0012607_206_1282 354
60 3300049575 Ga0501039_0055360 Ga0501039_0055360_1338_2402 354
61 3300009147 Ga0114129_10119778 Ga0114129_101197783 355
62 3300009147 Ga0114129_10559482 Ga0114129_105594822 355
63 3300042876 Ga0451577_0000001 Ga0451577_0000001_333174_334241 355
64 3300048925 Ga0496122_0021835 Ga0496122_0021835_2537_3613 355
65 3300049571 Ga0501034_0016997 Ga0501034_0016997_357_1424 355
66 3300049572 Ga0501036_0163598 Ga0501036_0163598_601_1668 355
67 3300049574 Ga0501038_0072256 Ga0501038_0072256_1763_2830 355
68 3300049575 Ga0501039_0134413 Ga0501039_0134413_839_1906 355
69 3300049579 Ga0501043_0178771 Ga0501043_0178771_491_1558 355
70 3300049582 Ga0501048_0041653 Ga0501048_0041653_114_1181 355
71 3300049582 Ga0501048_0050644 Ga0501048_0050644_45_1112 355
72 3300049583 Ga0501067_0000476 Ga0501067_0000476_8877_9950 355
73 3300049583 Ga0501067_0001132 Ga0501067_0001132_3847_4914 355
74 3300049584 Ga0501068_0001154 Ga0501068_0001154_7845_8918 355
75 3300049584 Ga0501068_0002248 Ga0501068_0002248_4758_5825 355
76 3300049585 Ga0501069_0000816 Ga0501069_0000816_9348_10421 355
77 3300049585 Ga0501069_0019710 Ga0501069_0019710_25_1092 355
78 3300049586 Ga0501070_0004311 Ga0501070_0004311_8027_9100 355
79 3300049587 Ga0501071_0000262 Ga0501071_0000262_9659_10732 355
80 3300049587 Ga0501071_0001293 Ga0501071_0001293_5752_6819 355
81 3300049588 Ga0501072_0006241 Ga0501072_0006241_1542_2609 355
82 3300049589 Ga0501073_0005195 Ga0501073_0005195_4422_5495 355
83 3300049590 Ga0501074_0005457 Ga0501074_0005457_5647_6720 355
84 3300049591 Ga0501075_0088127 Ga0501075_0088127_1083_2150 355
85 3300049591 Ga0501075_0118894 Ga0501075_0118894_195_1262 355
86 3300049592 Ga0501076_0076855 Ga0501076_0076855_1531_2598 355
87 3300049593 Ga0501077_0075755 Ga0501077_0075755_860_1927 355
88 3300049741 Ga0501079_0021696 Ga0501079_0021696_225_1292 355
89 3300049741 Ga0501079_0069776 Ga0501079_0069776_723_1790 355
90 3300049742 Ga0501080_0009961 Ga0501080_0009961_5631_6704 355
91 3300049742 Ga0501080_0133956 Ga0501080_0133956_515_1582 355
92 3300049744 Ga0501083_0000939 Ga0501083_0000939_7490_8563 355
93 3300049744 Ga0501083_0006607 Ga0501083_0006607_4401_5468 355
94 3300049824 Ga0501045_0292302 Ga0501045_0292302_59_1126 355
95 3300054114 Ga0501084_0002412 Ga0501084_0002412_5800_6873 355
96 3300054114 Ga0501084_0005595 Ga0501084_0005595_2662_3729 355
97 3300059421 Ga0590071_001961 Ga0590071_001961_112_1194 355
98 3300059423 Ga0590074_005022 Ga0590074_005022_245_1327 355
99 3300059424 Ga0590075_022653 Ga0590075_022653_437_1504 355
100 3300060353 Ga0501082_0020281 Ga0501082_0020281_1307_2374 355
101 3300060353 Ga0501082_0032034 Ga0501082_0032034_1055_2128 355
102 3300060353 Ga0501082_0143195 Ga0501082_0143195_164_1231 355
103 3300047318 Ga0495636_0014571 Ga0495636_0014571_1420_2499 356
104 3300006846 Ga0075430_100037824 Ga0075430_1000378244 357
105 3300031911 Ga0307412_10144253 Ga0307412_101442532 357
106 3300048928 Ga0496125_0003173 Ga0496125_0003173_9324_10457 357
107 3300031911 Ga0307412_10026882 Ga0307412_100268821 358
108 3300042876 Ga0451577_0003340 Ga0451577_0003340_14404_15492 359
109 iso_pu_bacteria 2510917027 2511180041 359
110 iso_pu_bacteria 2512564013 2512637571 359
111 iso_pu_bacteria 2744054657 2745165905 359
112 iso_pu_bacteria 2816332336 2817618119 359
113 iso_pu_bacteria 2857460504 2857461213 359
114 iso_pu_bacteria 2857465823 2857469998 359
115 iso_pu_bacteria 2857591370 2857591662 359
116 iso_pu_bacteria 2898907183 2898909926 359
117 iso_pu_bacteria 2915597211 2915600998 359
118 iso_pu_bacteria 2915606848 2915607247 359
119 iso_pu_bacteria 2929183550 2929186140 359
120 3300031691 Ga0316579_10035369 Ga0316579_100353691 360
121 3300031727 Ga0316576_10293564 Ga0316576_102935641 360
122 3300031728 Ga0316578_10002294 Ga0316578_100022944 360
123 3300031733 Ga0316577_10003664 Ga0316577_100036643 360
124 3300036712 Ga0316584_0032665 Ga0316584_0032665_1560_2642 360
125 3300036712 Ga0316584_0213243 Ga0316584_0213243_31_1113 360
126 3300037588 Ga0316581_0002249 Ga0316581_0002249_1798_2880 360
127 iso_pu_bacteria 2511231119 2511700196 360
128 iso_pu_bacteria 2540341094 2540607344 360
129 iso_pu_bacteria 2545555800 2545556879 360
130 iso_pu_bacteria 2548877040 2550905481 360
131 iso_pu_bacteria 2554235283 2555467591 360
132 iso_pu_bacteria 2571042143 2571527384 360
133 iso_pu_bacteria 2576861599 2578931130 360
134 iso_pu_bacteria 2593339131 2595091571 360
135 iso_pu_bacteria 2630968484 2631985520 360
136 iso_pu_bacteria 2643221735 2644740760 360
137 iso_pu_bacteria 2648501850 2651531925 360
138 iso_pu_bacteria 2671180844 2674418991 360
139 iso_pu_bacteria 2684623153 2686997415 360
140 iso_pu_bacteria 2687453109 2687498724 360
141 iso_pu_bacteria 2695420354 2695628174 360
142 iso_pu_bacteria 2716884898 2717916119 360
143 iso_pu_bacteria 2728368933 2728529327 360
144 iso_pu_bacteria 2738541295 2738814400 360
145 iso_pu_bacteria 2738541299 2738839869 360
146 iso_pu_bacteria 2738543017 2739270291 360
147 iso_pu_bacteria 2757320391 2757568060 360
148 iso_pu_bacteria 2775507177 2777760936 360
149 iso_pu_bacteria 2775507192 2777835877 360
150 iso_pu_bacteria 2788500588 2791214217 360
151 iso_pu_bacteria 2808606364 2808869346 360
152 iso_pu_bacteria 2808606399 2809055975 360
153 iso_pu_bacteria 2811994870 2812316607 360
154 iso_pu_bacteria 2816332295 2817480693 360
155 iso_pu_bacteria 2818991451 2819626196 360
156 iso_pu_bacteria 2818991468 2819723672 360
157 iso_pu_bacteria 2823526263 2823528591 360
158 iso_pu_bacteria 2831905167 2831905697 360
159 iso_pu_bacteria 2852673933 2852675421 360
160 iso_pu_bacteria 2857586860 2857590486 360
161 iso_pu_bacteria 2860837431 2860840032 360
162 iso_pu_bacteria 2877768649 2877771078 360
163 iso_pu_bacteria 2880169592 2880171943 360
164 iso_pu_bacteria 2881644220 2881644322 360
165 iso_pu_bacteria 2897109615 2897112153 360
166 iso_pu_bacteria 2904560550 2904562033 360
167 iso_pu_bacteria 2904606771 2904608001 360
168 iso_pu_bacteria 2908665501 2908668205 360
169 iso_pu_bacteria 2919093281 2919095974 360
170 iso_pu_bacteria 2919726948 2919728306 360
171 iso_pu_bacteria 2928510474 2928514249 360
172 iso_pu_bacteria 2936340661 2936341341 360
173 iso_pu_bacteria 2938649242 2938654323 360
174 iso_pu_bacteria 2939593269 2939596918 360
175 iso_pu_bacteria 2954773129 2954773890 360
176 iso_pu_bacteria 2956897341 2956901948 360
177 iso_pu_bacteria 2962290636 2962293306 360
178 iso_pu_bacteria 2968558590 2968561558 360
179 iso_pu_bacteria 2969136845 2969139317 360
180 iso_pu_bacteria 2969141011 2969143526 360
181 iso_pu_bacteria 2969765954 2969767284 360
182 iso_pu_bacteria 2969770375 2969773404 360
183 iso_pu_bacteria 2971893375 2971895725 360
184 iso_pu_bacteria 2980492589 2980495071 360
185 iso_pu_bacteria 2988225383 2988229091 360
186 iso_pu_bacteria 2996632988 2996633142 360
187 iso_pu_bacteria 3006858327 3006861040 360
188 iso_pu_bacteria 3006879489 3006881539 360
189 iso_pu_bacteria 8022630665 8022631819 360
190 iso_pu_bacteria 8022653035 8022654197 360
191 iso_pu_bacteria 8051952484 8051955349 360
192 iso_pu_bacteria 8052174270 8052178157 360
193 iso_pu_bacteria 8054465665 8054466326 360
194 iso_pu_bacteria 8055531788 8055535148 360
195 3300025229 Ga0209147_100421 Ga0209147_10042119 361
196 3300025294 Ga0209025_1010172 Ga0209025_10101725 361
197 3300025294 Ga0209025_1010175 Ga0209025_10101755 361
198 3300025302 Ga0207426_1010153 Ga0207426_10101532 361
199 3300025735 Ga0207713_1001934 Ga0207713_10019348 361
200 iso_pu_bacteria 2671180330 2672336875 361
201 iso_pu_bacteria 2816332186 2816862667 361
202 iso_pu_bacteria 2842682962 2842684410 361
203 iso_pu_bacteria 2849139964 2849145610 361
204 iso_pu_bacteria 2857581216 2857582402 361
205 iso_pu_bacteria 2916971899 2916974756 361
206 iso_pu_bacteria 2919414237 2919415352 361
207 iso_pu_bacteria 3001267043 3001268300 361
208 iso_pu_bacteria 3006826541 3006828026 361
209 iso_pu_bacteria 3006969106 3006972832 361
210 iso_pu_bacteria 3006978542 3006981695 361
211 iso_pu_bacteria 3006984091 3006984627 361
212 iso_pu_bacteria 3006988479 3006989035 361
213 iso_pu_bacteria 2551306519 2553393485 362
214 iso_pu_bacteria 2571042588 2573036666 362
215 iso_pu_bacteria 2576861424 2578335479 362
216 iso_pu_bacteria 2579778775 2580933410 362
217 iso_pu_bacteria 2619619294 2621273710 362
218 iso_pu_bacteria 2643221729 2644704933 362
219 iso_pu_bacteria 2643221730 2644709626 362
220 iso_pu_bacteria 2684622632 2685152138 362
221 iso_pu_bacteria 2695420987 2698321026 362
222 iso_pu_bacteria 2703719227 2705996080 362
223 iso_pu_bacteria 2718218445 2721507299 362
224 iso_pu_bacteria 2738541358 2739154658 362
225 iso_pu_bacteria 2738543006 2739207970 362
226 iso_pu_bacteria 2818991443 2819581360 362
227 iso_pu_bacteria 2881636855 2881638173 362
228 iso_pu_bacteria 2929233124 2929237838 362
229 iso_pu_bacteria 2938917290 2938922030 362
230 iso_pu_bacteria 2947426588 2947430923 362
231 iso_pu_bacteria 2965761152 2965765722 362
232 iso_pu_bacteria 2971511577 2971513242 362
233 iso_pu_bacteria 2979083700 2979087822 362
234 iso_pu_bacteria 2980176882 2980178444 362
235 iso_pu_bacteria 3006973921 3006975787 362
236 iso_pu_bacteria 8022621104 8022624062 362
237 iso_pu_bacteria 8022792930 8022796758 362
238 iso_pu_bacteria 8023438354 8023442988 362
239 iso_pu_bacteria 8023444577 8023445032 362
240 iso_pu_bacteria 8054280661 8054281323 362
241 iso_pu_bacteria 8057582654 8057586610 362
242 3300003758 Ga0055532_1001864 Ga0055532_10018645 363
243 3300025229 Ga0209147_100139 Ga0209147_1001396 363
244 3300049571 Ga0501034_0038541 Ga0501034_0038541_1820_3007 363
245 iso_pu_bacteria 2643221731 2644715871 363
246 iso_pu_bacteria 2643221732 2644724258 363
247 iso_pu_bacteria 2818991465 2819709343 363
248 iso_pu_bacteria 2842882022 2842884409 363
249 iso_pu_bacteria 2904524088 2904524561 363
250 iso_pu_bacteria 2919143609 2919146843 363
251 iso_pu_bacteria 2919517244 2919518766 363
252 iso_pu_bacteria 2919720352 2919723133 363
253 iso_pu_bacteria 2928093941 2928096340 363
254 iso_pu_bacteria 2929004312 2929006284 363
255 iso_pu_bacteria 2936361878 2936367303 363
256 iso_pu_bacteria 2960319331 2960319961 363
257 iso_pu_bacteria 2960375949 2960380827 363
258 iso_pu_bacteria 2977254563 2977256690 363
259 iso_pu_bacteria 2990275345 2990277563 363
260 iso_pu_bacteria 3001272096 3001273794 363
261 iso_pu_bacteria 8022893055 8022898081 363
262 iso_pu_bacteria 8022914991 8022917263 363
263 iso_pu_bacteria 8022948649 8022949744 363
264 3300003187 JGI25151J46595_10000006 JGI25151J46595_10000006310 364
265 3300003187 JGI25151J46595_10001830 JGI25151J46595_100018307 364
266 3300003187 JGI25151J46595_10003274 JGI25151J46595_100032745 364
267 3300003578 Ga0006562J51391_1000825 Ga0006562J51391_10008252 364
268 3300003751 Ga0055538_1000272 Ga0055538_100027217 364
269 3300003758 Ga0055532_1000046 Ga0055532_1000046154 364
270 3300009036 Ga0105244_10022052 Ga0105244_100220521 364
271 3300009036 Ga0105244_10031252 Ga0105244_100312522 364
272 3300009092 Ga0105250_10001573 Ga0105250_100015739 364
273 3300009148 Ga0105243_10058873 Ga0105243_100588733 364
274 3300013102 Ga0157371_10009994 Ga0157371_100099945 364
275 3300025229 Ga0209147_100014 Ga0209147_100014214 364
276 3300025229 Ga0209147_101106 Ga0209147_1011068 364
277 3300025284 Ga0209130_1002466 Ga0209130_10024664 364
278 3300025284 Ga0209130_1018144 Ga0209130_10181441 364
279 3300025291 Ga0209675_1018236 Ga0209675_10182361 364
280 3300025292 Ga0209676_1000489 Ga0209676_100048930 364
281 3300025294 Ga0209025_1000001 Ga0209025_1000001687 364
282 3300025294 Ga0209025_1000041 Ga0209025_1000041128 364
283 3300025294 Ga0209025_1000560 Ga0209025_100056026 364
284 3300025294 Ga0209025_1004724 Ga0209025_100472410 364
285 3300025294 Ga0209025_1011552 Ga0209025_10115525 364
286 3300025294 Ga0209025_1012005 Ga0209025_10120052 364
287 3300025294 Ga0209025_1025188 Ga0209025_10251882 364
288 3300025711 Ga0207696_1004861 Ga0207696_10048612 364
289 3300025728 Ga0207655_1002590 Ga0207655_100259010 364
290 3300030083 Ga0237817_10054 Ga0237817_1005441 364
291 3300031548 Ga0307408_100003918 Ga0307408_1000039186 364
292 3300032002 Ga0307416_100012025 Ga0307416_1000120252 364
293 3300038705 Ga0237819_00085 Ga0237819_00085_17672_18772 364
294 3300045976 Ga0466967_0002151 Ga0466967_0002151_10515_11615 364
295 3300048905 Ga0496102_0049416 Ga0496102_0049416_734_1828 364
296 3300048906 Ga0496103_0128664 Ga0496103_0128664_202_1296 364
297 3300049161 Ga0501305_004096 Ga0501305_004096_190_1284 364
298 3300049661 Ga0501217_008469 Ga0501217_008469_1068_2162 364
299 3300049704 Ga0501221_021185 Ga0501221_021185_127_1221 364
300 iso_pu_bacteria 2576861424 2578337260 364
301 iso_pu_bacteria 2864733723 2864739729 364
302 iso_pu_bacteria 2881636855 2881637401 364
303 iso_pu_bacteria 2885526491 2885528403 364
304 iso_pu_bacteria 2889042446 2889042902 364
305 iso_pu_bacteria 2904162308 2904168727 364
306 iso_pu_bacteria 2904490793 2904495857 364
307 iso_pu_bacteria 2919160200 2919164880 364
308 iso_pu_bacteria 2931384279 2931386328 364
309 iso_pu_bacteria 2939679117 2939684417 364
310 iso_pu_bacteria 2945991243 2945995100 364
311 iso_pu_bacteria 2946053406 2946057823 364
312 3300031727 Ga0316576_10008004 Ga0316576_100080043 365
313 3300035398 Ga0316574_0001866 Ga0316574_0001866_5754_6851 365
314 3300035398 Ga0316574_0050432 Ga0316574_0050432_545_1717 365
315 3300005347 Ga0070668_100149513 Ga0070668_1001495131 366
316 3300013306 Ga0163162_10115157 Ga0163162_101151572 366
317 3300017792 Ga0163161_10085434 Ga0163161_100854342 366
318 3300026118 Ga0207675_100036339 Ga0207675_1000363392 366
319 3300035398 Ga0316574_0026620 Ga0316574_0026620_2211_3311 366
320 3300046537 Ga0495598_0001137 Ga0495598_0001137_1677_2786 366
321 3300003316 rootH1_10000511 rootH1_100005117 367
322 3300003322 rootL2_10035059 rootL2_100350597 367
323 3300003323 rootH1_10328621 rootH1_103286213 367
324 3300003578 Ga0006562J51391_1000410 Ga0006562J51391_10004103 367
325 3300003578 Ga0006562J51391_1017154 Ga0006562J51391_10171541 367
326 3300003790 Ga0055528_1001363 Ga0055528_10013637 367
327 3300005331 Ga0070670_100069554 Ga0070670_1000695542 367
328 3300005355 Ga0070671_100024067 Ga0070671_1000240673 367
329 3300009098 Ga0105245_10033570 Ga0105245_100335702 367
330 3300009101 Ga0105247_10008355 Ga0105247_100083554 367
331 3300009176 Ga0105242_10005264 Ga0105242_100052643 367
332 3300011119 Ga0105246_10005141 Ga0105246_100051416 367
333 3300013296 Ga0157374_10009592 Ga0157374_100095927 367
334 3300013297 Ga0157378_10023403 Ga0157378_100234033 367
335 3300014745 Ga0157377_10016747 Ga0157377_100167472 367
336 3300025711 Ga0207696_1007050 Ga0207696_10070503 367
337 3300025728 Ga0207655_1006256 Ga0207655_10062563 367
338 3300025907 Ga0207645_10076039 Ga0207645_100760392 367
339 3300025926 Ga0207659_10080345 Ga0207659_100803452 367
340 3300025934 Ga0207686_10095770 Ga0207686_100957702 367
341 3300035398 Ga0316574_0167715 Ga0316574_0167715_49_1251 367
342 3300046455 Ga0495603_0055995 Ga0495603_0055995_488_1591 367
343 3300046530 Ga0495654_0058667 Ga0495654_0058667_565_1668 367
344 3300047323 Ga0495683_0016200 Ga0495683_0016200_1625_2728 367
345 3300048904 Ga0496101_0004006 Ga0496101_0004006_5649_6752 367
346 3300048905 Ga0496102_0021951 Ga0496102_0021951_2460_3563 367
347 3300048906 Ga0496103_0002081 Ga0496103_0002081_2589_3692 367
348 3300048907 Ga0496104_0002047 Ga0496104_0002047_4589_5692 367
349 3300048908 Ga0496105_0001200 Ga0496105_0001200_8777_9880 367
350 3300048909 Ga0496106_0000104 Ga0496106_0000104_40640_41743 367
351 3300048910 Ga0496107_0000186 Ga0496107_0000186_9223_10326 367
352 3300048911 Ga0496108_0001707 Ga0496108_0001707_1646_2749 367
353 3300048912 Ga0496109_0002162 Ga0496109_0002162_7029_8132 367
354 3300048913 Ga0496110_0035890 Ga0496110_0035890_2588_3691 367
355 3300048913 Ga0496110_0250761 Ga0496110_0250761_280_1383 367
356 3300048914 Ga0496111_0128707 Ga0496111_0128707_156_1259 367
357 3300048915 Ga0496112_0046413 Ga0496112_0046413_2589_3692 367
358 3300048916 Ga0496113_0024927 Ga0496113_0024927_2587_3690 367
359 3300048920 Ga0496117_0008625 Ga0496117_0008625_6669_7772 367
360 3300048921 Ga0496118_0051015 Ga0496118_0051015_1811_2914 367
361 3300048922 Ga0496119_0006826 Ga0496119_0006826_6904_8007 367
362 3300048924 Ga0496121_0103291 Ga0496121_0103291_42_1145 367
363 3300048925 Ga0496122_0069800 Ga0496122_0069800_156_1259 367
364 3300048926 Ga0496123_0033653 Ga0496123_0033653_1084_2187 367
365 3300048928 Ga0496125_0009749 Ga0496125_0009749_5457_6560 367
366 3300048929 Ga0496126_0004279 Ga0496126_0004279_15021_16124 367
367 iso_pu_bacteria 8015556637 8015557314 367
368 3300009036 Ga0105244_10072296 Ga0105244_100722962 368
369 3300025233 Ga0209437_100662 Ga0209437_10066213 368
370 3300048925 Ga0496122_0068409 Ga0496122_0068409_859_1965 368
371 3300048927 Ga0496124_0071599 Ga0496124_0071599_310_1416 368
372 3300048927 Ga0496124_0180958 Ga0496124_0180958_106_1212 368
373 3300048928 Ga0496125_0020429 Ga0496125_0020429_4685_5791 368
374 3300048928 Ga0496125_0156809 Ga0496125_0156809_128_1234 368
375 2162886007 SwRhRL2b_contig_2693654 SwRhRL2b_0752.00000530 371
376 3300005289 Ga0065704_10070132 Ga0065704_10070132275 371
377 3300005563 Ga0068855_100366583 Ga0068855_1003665832 371
378 3300037471 Ga0395905_0000397 Ga0395905_0000397_54979_56094 371
379 3300047318 Ga0495636_0040729 Ga0495636_0040729_577_1695 371
380 3300048913 Ga0496110_0184036 Ga0496110_0184036_256_1371 371
381 3300048927 Ga0496124_0000003 Ga0496124_0000003_1170159_1171274 371
382 3300048928 Ga0496125_0087700 Ga0496125_0087700_1201_2316 371
383 3300048929 Ga0496126_0048553 Ga0496126_0048553_377_1492 371

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02812

ELFV_dehydrog_N

Glu/Leu/Phe/Val dehydrogenase, dimerisation domain

81

201

0.93

PF00208

ELFV_dehydrog

Glutamate/Leucine/Phenylalanine/Valine dehydrogenase

210

275

0.86

PF00208

ELFV_dehydrog

Glutamate/Leucine/Phenylalanine/Valine dehydrogenase

270

420

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vpx-assembly1.cif.gz_B crystal structure of leucine dehydrogenase from a psychrophilic bacterium sporosarcina psychrophila. 0.9681 1 352
3vpx-assembly1.cif.gz_A crystal structure of leucine dehydrogenase from a psychrophilic bacterium sporosarcina psychrophila. 0.9655 1 352
6ach-assembly1.cif.gz_A structure of nad+-bound leucine dehydrogenase from geobacillus stearothermophilus by cryo-em 0.9559 1 352
7vid-assembly1.cif.gz_A the crystal structure of l-leucine dehydrogenase from pseudomonas aeruginosa 0.9557 4 342
6acf-assembly1.cif.gz_A structure of leucine dehydrogenase from geobacillus stearothermophilus by cryo-em 0.9549 1 352
ID Description Score Start End Superfamily
1lehB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9651 135 336 3.40.50.720
5b37E02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9599 147 336 3.40.50.720
6acfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9588 1 133 3.40.50.10860
5b37A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9564 4 134 3.40.50.10860
1lehB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9559 135 336 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W0XY14-F1-model_v4 Valine dehydrogenase 1.008 12 88 GO:0006520
GO:0016639
AF-G2TM38-F1-model_v4 Glu/Leu/Phe/Val dehydrogenase dimerization region 1.005 12 107 GO:0006520
GO:0016639
AF-A0A3C0F5V9-F1-model_v4 deleted 1.004 12 135
AF-A0A3B8WR41-F1-model_v4 Amino acid dehydrogenase 1.003 13 103 GO:0006520
GO:0016639
AF-A0A520D613-F1-model_v4 deleted 1.002 12 85

Feature Viewer

pLDDT pTM Quality
91.12 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map