F429533

General Info

Members Datasets Scaffolds Average Seq Length
383 231 766 209

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100005711|Ga0068858_1000057113
Length 232
Sequence MGFRATAAIIGYPVRMTDAPETTAPKTTRLSVFPLPGALLFPGMHLPLHIFEPRYRAMISDSMARDRRIGMIQPRPGPLTPGEAPALFTIGCVGRIAEFETSEDGRYNLVLEGIALFRILRELDVTTAFRQVEAELLPVRDEPEILSLSRRSSLEMESRRFADAQGYAVDWEAVNRLDDEALVNGIAQIAPFDVAAKQALLEANGIEDRAELIIQLMQFFGRHDGEESVTLQ

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
140 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
144 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
148 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
151 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
152 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
153 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
154 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
155 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
202 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
203 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
206 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
207 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
208 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
217 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
218 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
221 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
222 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
223 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
224 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
225 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
226 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
227 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
228 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
229 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
230 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
231 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 0
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 16.19
Nodule 0
Rhizoplane 3.66
Rhizosphere 72.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100005711 3300005842 Bacteria 12156
2 JGI24736J21556_1000023 3300001904 Bacteria 25735
3 JGI24752J21851_1000647 3300001976 Bacteria 4642
4 JGI24752J21851_1000649 3300001976 Bacteria 4637
5 JGI24740J21852_10030171 3300001979 Bacteria 1769
6 JGI24739J22299_10004650 3300001989 Bacteria 5249
7 JGI24739J22299_10029846 3300001989 Bacteria 1893
8 JGI24737J22298_10002290 3300001990 Bacteria 6807
9 JGI24750J21931_1000150 3300002070 Bacteria 11455
10 JGI24750J21931_1003965 3300002070 Bacteria 1783
11 JGI24748J21848_1000037 3300002074 Bacteria 72188
12 JGI24738J21930_10001522 3300002075 Bacteria 6409
13 JGI24749J21850_1001968 3300002076 Bacteria 2900
14 JGI24034J26672_10000024 3300002239 Bacteria 114754
15 JGI24034J26672_10000025 3300002239 Bacteria 110791
16 JGI24751J29686_10006785 3300002459 Bacteria 2333
17 JGI25165J46597_1000010 3300003214 Bacteria 442113
18 JGI25153J46596_10002609 3300003215 Bacteria 10308
19 JGI25153J46596_10011649 3300003215 Bacteria 3868
20 Ga0055537_1001357 3300003773 Bacteria 9869
21 Ga0055524_1000387 3300003775 Bacteria 37906
22 Ga0055530_10021267 3300003791 Bacteria 1916
23 Ga0055530_10021891 3300003791 Bacteria 1873
24 Ga0055531_10005489 3300003794 Bacteria 7418
25 Ga0065165_1004058 3300005262 Bacteria 9507
26 Ga0065165_1006425 3300005262 Bacteria 6168
27 Ga0065165_1031530 3300005262 Bacteria 1674
28 Ga0065704_10120183 3300005289 Bacteria 1777
29 Ga0065707_10000450 3300005295 Bacteria 70667
30 Ga0065707_10132676 3300005295 Bacteria 1894
31 Ga0065707_10221004 3300005295 Bacteria 1225
32 Ga0070658_10028226 3300005327 Bacteria 4505
33 Ga0070658_10069966 3300005327 Bacteria 2872
34 Ga0070690_100000202 3300005330 Bacteria 31141
35 Ga0070670_100000195 3300005331 Bacteria 56039
36 Ga0070670_100030625 3300005331 Bacteria 4633
37 Ga0070666_10000053 3300005335 Bacteria 97883
38 Ga0070666_10002955 3300005335 Bacteria 10299
39 Ga0070689_100009404 3300005340 Bacteria 6929
40 Ga0070668_100023355 3300005347 Bacteria 4677
41 Ga0070668_100228180 3300005347 Bacteria 1538
42 Ga0070669_100000008 3300005353 Bacteria 226764
43 Ga0070669_100000009 3300005353 Bacteria 224683
44 Ga0070671_100000010 3300005355 Bacteria 202799
45 Ga0070667_100001362 3300005367 Bacteria 21916
46 Ga0070667_100006048 3300005367 Bacteria 10053
47 Ga0070667_100278344 3300005367 Bacteria 1502
48 Ga0070705_100049695 3300005440 Bacteria 2436
49 Ga0070685_10001448 3300005466 Bacteria 12452
50 Ga0068853_100000256 3300005539 Bacteria 37353
51 Ga0068853_100027338 3300005539 Bacteria 4793
52 Ga0068853_100353428 3300005539 Bacteria 1367
53 Ga0068853_100750641 3300005539 Bacteria 932
54 Ga0070686_100000050 3300005544 Bacteria 97879
55 Ga0070665_100000004 3300005548 Bacteria 785500
56 Ga0070665_100234325 3300005548 Bacteria 1836
57 Ga0068855_100897505 3300005563 Bacteria 936
58 Ga0068857_100031466 3300005577 Bacteria 4689
59 Ga0068857_100235910 3300005577 Bacteria 1674
60 Ga0068854_100161321 3300005578 Bacteria 1736
61 Ga0068856_100817405 3300005614 Bacteria 951
62 Ga0068852_100196731 3300005616 Bacteria 1906
63 Ga0068859_100000396 3300005617 Bacteria 43397
64 Ga0068859_100002837 3300005617 Bacteria 17580
65 Ga0068859_100088092 3300005617 Bacteria 3153
66 Ga0068859_100185315 3300005617 Bacteria 2165
67 Ga0068864_100000189 3300005618 Bacteria 56038
68 Ga0068864_100000851 3300005618 Bacteria 25734
69 Ga0068864_100011199 3300005618 Bacteria 7412
70 Ga0068864_100028681 3300005618 Bacteria 4708
71 Ga0068861_100001538 3300005719 Bacteria 14628
72 Ga0068861_100004386 3300005719 Bacteria 9461
73 Ga0068863_100000010 3300005841 Bacteria 237758
74 Ga0068863_100000073 3300005841 Bacteria 110576
75 Ga0068863_100125707 3300005841 Bacteria 2446
76 Ga0068863_100587915 3300005841 Bacteria 1101
77 Ga0068858_100000268 3300005842 Bacteria 55747
78 Ga0068858_100004631 3300005842 Bacteria 13468
79 Ga0068858_100004934 3300005842 Bacteria 13074
80 Ga0068858_100510974 3300005842 Bacteria 1161
81 Ga0068860_100000189 3300005843 Bacteria 97880
82 Ga0068860_100001052 3300005843 Bacteria 30421
83 Ga0068862_100000233 3300005844 Bacteria 62058
84 Ga0068862_100000334 3300005844 Bacteria 51308
85 Ga0068862_100000352 3300005844 Bacteria 49864
86 Ga0081455_10000212 3300005937 Bacteria 74448
87 Ga0081540_1075351 3300005983 Bacteria 1542
88 Ga0075368_10000034 3300006042 Bacteria 31979
89 Ga0097620_100000396 3300006931 Bacteria 43397
90 Ga0097620_100088095 3300006931 Bacteria 3153
91 Ga0097620_100185324 3300006931 Bacteria 2165
92 Ga0105251_10000468 3300009011 Bacteria 38504
93 Ga0105250_10043498 3300009092 Bacteria 1800
94 Ga0105245_10007068 3300009098 Bacteria 9847
95 Ga0105247_10001269 3300009101 Bacteria 18684
96 Ga0105247_10006001 3300009101 Bacteria 7567
97 Ga0105247_10065502 3300009101 Bacteria 2260
98 Ga0105243_10104087 3300009148 Bacteria 2362
99 Ga0105241_10177829 3300009174 Bacteria 1762
100 Ga0105248_10000026 3300009177 Bacteria 257155
101 Ga0105248_10002472 3300009177 Bacteria 20525
102 Ga0105248_10021003 3300009177 Bacteria 7235
103 Ga0105248_10249536 3300009177 Bacteria 1998
104 Ga0105237_10099952 3300009545 Bacteria 2892
105 Ga0105237_10258527 3300009545 Bacteria 1744
106 Ga0105238_10006048 3300009551 Bacteria 12001
107 Ga0105238_10705085 3300009551 Bacteria 1021
108 Ga0105249_10000157 3300009553 Bacteria 83216
109 Ga0105249_10000614 3300009553 Bacteria 32520
110 Ga0105249_10001016 3300009553 Bacteria 24808
111 Ga0105249_10152441 3300009553 Bacteria 2226
112 Ga0105239_10417583 3300010375 Bacteria 1519
113 Ga0105239_10449616 3300010375 Bacteria 1461
114 Ga0105239_10912066 3300010375 Bacteria 1009
115 Ga0157373_10126721 3300013100 Bacteria 1796
116 Ga0157373_10166013 3300013100 Bacteria 1553
117 Ga0157371_10032110 3300013102 Bacteria 3780
118 Ga0157370_10040725 3300013104 Bacteria 4485
119 Ga0157370_10335384 3300013104 Bacteria 1394
120 Ga0157369_10023012 3300013105 Bacteria 6946
121 Ga0157374_10215721 3300013296 Bacteria 1882
122 Ga0157378_10128408 3300013297 Bacteria 2344
123 Ga0157378_10167283 3300013297 Bacteria 2060
124 Ga0163162_10001763 3300013306 Bacteria 20278
125 Ga0163162_10010553 3300013306 Bacteria 8985
126 Ga0163162_10045865 3300013306 Bacteria 4380
127 Ga0163162_10510725 3300013306 Bacteria 1332
128 Ga0157372_10232057 3300013307 Bacteria 2140
129 Ga0157372_10656958 3300013307 Bacteria 1221
130 Ga0163163_10026993 3300014325 Bacteria 5494
131 Ga0163163_10094509 3300014325 Bacteria 3008
132 Ga0163163_10633232 3300014325 Bacteria 1133
133 Ga0157380_10000740 3300014326 Bacteria 20395
134 Ga0157380_10003622 3300014326 Bacteria 10622
135 Ga0157379_10019263 3300014968 Bacteria 6026
136 Ga0157379_10105600 3300014968 Bacteria 2528
137 Ga0183363_1015 3300015690 Bacteria 74376
138 Ga0163161_10000020 3300017792 Bacteria 214642
139 Ga0213876_10140805 3300021384 Bacteria 1283
140 Ga0213875_10010742 3300021388 Bacteria 4578
141 Ga0207672_1001261 3300025223 Bacteria 2127
142 Ga0209233_1000044 3300025261 Bacteria 489783
143 Ga0209565_1000029 3300025263 Bacteria 340335
144 Ga0209673_1004556 3300025273 Bacteria 7363
145 Ga0209675_1006164 3300025291 Bacteria 4874
146 Ga0209758_1002578 3300025297 Bacteria 18191
147 Ga0209050_1003344 3300025298 Bacteria 11952
148 Ga0209256_1000008 3300025299 Bacteria 975723
149 Ga0209257_1002893 3300025304 Bacteria 15944
150 Ga0207697_10000036 3300025315 Bacteria 49927
151 Ga0207697_10003102 3300025315 Bacteria 8315
152 Ga0207656_10017112 3300025321 Bacteria 2835
153 Ga0207656_10022035 3300025321 Bacteria 2552
154 Ga0207713_1051050 3300025735 Bacteria 1646
155 Ga0207710_10001449 3300025900 Bacteria 11812
156 Ga0207710_10002285 3300025900 Bacteria 8971
157 Ga0207710_10037271 3300025900 Bacteria 2147
158 Ga0207680_10000017 3300025903 Bacteria 97899
159 Ga0207680_10000044 3300025903 Bacteria 64236
160 Ga0207647_10001726 3300025904 Bacteria 16752
161 Ga0207705_10113943 3300025909 Bacteria 2000
162 Ga0207705_10144259 3300025909 Bacteria 1780
163 Ga0207654_10009517 3300025911 Bacteria 4937
164 Ga0207695_10005689 3300025913 Bacteria 16443
165 Ga0207695_10013250 3300025913 Bacteria 9838
166 Ga0207695_10194332 3300025913 Bacteria 1946
167 Ga0207671_10011973 3300025914 Bacteria 7013
168 Ga0207671_10172822 3300025914 Bacteria 1679
169 Ga0207649_10175727 3300025920 Bacteria 1495
170 Ga0207681_10000002 3300025923 Bacteria 985597
171 Ga0207681_10000020 3300025923 Bacteria 240498
172 Ga0207694_10001864 3300025924 Bacteria 17537
173 Ga0207694_10016124 3300025924 Bacteria 5638
174 Ga0207650_10000243 3300025925 Bacteria 59507
175 Ga0207650_10030983 3300025925 Bacteria 3859
176 Ga0207650_10060975 3300025925 Bacteria 2815
177 Ga0207687_10004631 3300025927 Bacteria 9149
178 Ga0207644_10000002 3300025931 Bacteria 942221
179 Ga0207644_10001497 3300025931 Bacteria 15046
180 Ga0207690_10133726 3300025932 Bacteria 1818
181 Ga0207706_10015588 3300025933 Bacteria 6865
182 Ga0207706_10024558 3300025933 Bacteria 5402
183 Ga0207709_10130641 3300025935 Bacteria 1711
184 Ga0207670_10032568 3300025936 Bacteria 3353
185 Ga0207691_10500283 3300025940 Bacteria 1032
186 Ga0207711_10000004 3300025941 Bacteria 870636
187 Ga0207711_10001647 3300025941 Bacteria 20601
188 Ga0207711_10016688 3300025941 Bacteria 6097
189 Ga0207711_10028452 3300025941 Bacteria 4703
190 Ga0207689_10246983 3300025942 Bacteria 1476
191 Ga0207667_10021852 3300025949 Bacteria 7081
192 Ga0207667_10171498 3300025949 Bacteria 2230
193 Ga0207667_10537985 3300025949 Bacteria 1182
194 Ga0207712_10000099 3300025961 Bacteria 97890
195 Ga0207712_10009203 3300025961 Bacteria 6255
196 Ga0207712_10020825 3300025961 Bacteria 4300
197 Ga0207712_10110554 3300025961 Bacteria 2060
198 Ga0207668_10001703 3300025972 Bacteria 12868
199 Ga0207668_10052293 3300025972 Bacteria 2825
200 Ga0207640_10019425 3300025981 Bacteria 4014
201 Ga0207640_10059035 3300025981 Bacteria 2530
202 Ga0207640_10091030 3300025981 Bacteria 2112
203 Ga0207658_10000393 3300025986 Bacteria 42203
204 Ga0207658_10000430 3300025986 Bacteria 39640
205 Ga0207658_10007810 3300025986 Bacteria 7285
206 Ga0207658_10506977 3300025986 Bacteria 1075
207 Ga0207703_10000139 3300026035 Bacteria 86495
208 Ga0207703_10001170 3300026035 Bacteria 24778
209 Ga0207703_10005752 3300026035 Bacteria 9934
210 Ga0207703_10015392 3300026035 Bacteria 5966
211 Ga0207639_10009382 3300026041 Bacteria 6747
212 Ga0207639_10060645 3300026041 Bacteria 2919
213 Ga0207639_10087207 3300026041 Bacteria 2487
214 Ga0207639_10099497 3300026041 Bacteria 2346
215 Ga0207702_10003500 3300026078 Bacteria 14313
216 Ga0207641_10000018 3300026088 Bacteria 298209
217 Ga0207641_10000171 3300026088 Bacteria 90550
218 Ga0207676_10000027 3300026095 Bacteria 245868
219 Ga0207676_10000072 3300026095 Bacteria 101978
220 Ga0207676_10000489 3300026095 Bacteria 33247
221 Ga0207676_10159644 3300026095 Bacteria 1951
222 Ga0207674_10018943 3300026116 Bacteria 7462
223 Ga0207674_10041501 3300026116 Bacteria 4759
224 Ga0207674_10095817 3300026116 Bacteria 2953
225 Ga0207674_10191484 3300026116 Bacteria 1995
226 Ga0207675_100002114 3300026118 Bacteria 19682
227 Ga0207675_100002191 3300026118 Bacteria 19409
228 Ga0207698_10001620 3300026142 Bacteria 13098
229 Ga0207698_10239998 3300026142 Bacteria 1651
230 Ga0209983_1009335 3300027665 Bacteria 2005
231 Ga0268266_10000009 3300028379 Bacteria 1097737
232 Ga0268266_10191093 3300028379 Bacteria 1869
233 Ga0268265_10000097 3300028380 Bacteria 110755
234 Ga0268265_10000187 3300028380 Bacteria 73568
235 Ga0268265_10002184 3300028380 Bacteria 15120
236 Ga0268264_10000010 3300028381 Bacteria 596543
237 Ga0268264_10000023 3300028381 Bacteria 471408
238 Ga0307517_10112412 3300028786 Bacteria 2063
239 Ga0307515_10306351 3300028794 Bacteria 1268
240 Ga0307513_10024219 3300031456 Bacteria 7067
241 Ga0307513_10153468 3300031456 Bacteria 2207
242 Ga0307509_10143135 3300031507 Bacteria 2322
243 Ga0307508_10000011 3300031616 Bacteria 248001
244 Ga0307508_10100659 3300031616 Bacteria 2485
245 Ga0307516_10189408 3300031730 Bacteria 1784
246 Ga0307405_10150071 3300031731 Bacteria 1637
247 Ga0307412_10005910 3300031911 Bacteria 6895
248 Ga0307412_10183105 3300031911 Bacteria 1577
249 Ga0307416_100188246 3300032002 Bacteria 1943
250 Ga0307414_10033629 3300032004 Bacteria 3391
251 Ga0307510_10001394 3300033180 Bacteria 26509
252 Ga0395905_0364069 3300037471 Bacteria 1339
253 Ga0436364_0693360 3300037853 Bacteria 4902
254 Ga0237819_00130 3300038705 Bacteria 28324
255 Ga0237816_00594 3300039145 Bacteria 3065
256 Ga0436365_1644582 3300039437 Bacteria 1650
257 Ga0439439_0092210 3300041406 Bacteria 828
258 Ga0439439_0121913 3300041406 Bacteria 727
259 Ga0439461_0012277 3300041410 Bacteria 1600
260 Ga0439465_0027445 3300041413 Bacteria 1803
261 Ga0451793_0601646 3300041452 Bacteria 1079
262 Ga0451807_1216956 3300041486 Bacteria 1223
263 Ga0439431_0014061 3300041997 Bacteria 1852
264 Ga0439442_045605 3300042002 Bacteria 924
265 Ga0439445_0014555 3300042004 Bacteria 1916
266 Ga0439432_027662 3300042006 Bacteria 1850
267 Ga0439457_015269 3300042014 Bacteria 1716
268 Ga0439462_0000151 3300042015 Bacteria 11324
269 Ga0450923_127079 3300042125 Bacteria 605
270 Ga0450910_031374 3300042147 Bacteria 835
271 Ga0450909_002516 3300042185 Bacteria 2598
272 Ga0439434_0011832 3300042435 Bacteria 2580
273 Ga0453684_0233710 3300044712 Bacteria 2121
274 Ga0466970_0177110 3300044765 Bacteria 1183
275 Ga0495585_0180727 3300046492 Bacteria 1084
276 Ga0495607_0011146 3300046501 Bacteria 6003
277 Ga0495583_0005113 3300046506 Bacteria 9037
278 Ga0495643_0032966 3300046522 Bacteria 2870
279 Ga0495648_0006183 3300046524 Bacteria 9811
280 Ga0495663_0010901 3300046525 Bacteria 2528
281 Ga0495663_0012850 3300046525 Bacteria 2337
282 Ga0495666_0181713 3300046526 Bacteria 971
283 Ga0495654_0021598 3300046530 Bacteria 3347
284 Ga0495622_0166984 3300046557 Bacteria 991
285 Ga0495668_0002162 3300046616 Bacteria 16877
286 Ga0495668_0138172 3300046616 Bacteria 1334
287 Ga0495625_0000094 3300046660 Bacteria 144517
288 Ga0495625_0002964 3300046660 Bacteria 17643
289 Ga0495625_0052870 3300046660 Bacteria 2907
290 Ga0495625_0063665 3300046660 Bacteria 2604
291 Ga0495625_0159161 3300046660 Bacteria 1514
292 Ga0495670_0000016 3300046691 Bacteria 128045
293 Ga0495670_0009870 3300046691 Bacteria 4696
294 Ga0495670_0044129 3300046691 Bacteria 2226
295 Ga0495671_0012219 3300046692 Bacteria 4694
296 Ga0495671_0097184 3300046692 Bacteria 1440
297 Ga0495589_0021219 3300046794 Bacteria 3320
298 Ga0495677_0004063 3300047445 Bacteria 5649
299 Ga0495681_0031995 3300047470 Bacteria 2653
300 Ga0496101_0098950 3300048904 Bacteria 2180
301 Ga0496101_0234266 3300048904 Bacteria 1428
302 Ga0496102_0052322 3300048905 Bacteria 3720
303 Ga0496103_0006677 3300048906 Bacteria 6885
304 Ga0496103_0022364 3300048906 Bacteria 3807
305 Ga0496103_0184428 3300048906 Bacteria 1341
306 Ga0496103_0667323 3300048906 Bacteria 660
307 Ga0496106_0089666 3300048909 Bacteria 2372
308 Ga0496106_0341243 3300048909 Bacteria 1203
309 Ga0496111_0193759 3300048914 Bacteria 1511
310 Ga0496115_0242557 3300048918 Bacteria 1485
311 Ga0496116_0209700 3300048919 Bacteria 1011
312 Ga0496117_0000535 3300048920 Bacteria 62454
313 Ga0496117_0006156 3300048920 Bacteria 12260
314 Ga0496118_0001906 3300048921 Bacteria 29700
315 Ga0496118_0002459 3300048921 Bacteria 24907
316 Ga0496119_0137734 3300048922 Bacteria 1322
317 Ga0496121_0000441 3300048924 Bacteria 82090
318 Ga0496121_0012164 3300048924 Bacteria 9442
319 Ga0496122_0314736 3300048925 Bacteria 836
320 Ga0496123_0001952 3300048926 Bacteria 26806
321 Ga0496124_0181559 3300048927 Bacteria 1619
322 Ga0496125_0127995 3300048928 Bacteria 1795
323 Ga0501034_0588850 3300049571 Bacteria 1019
324 Ga0501034_1078152 3300049571 Bacteria 685
325 Ga0501037_0096950 3300049573 Bacteria 2131
326 Ga0501043_0133456 3300049579 Bacteria 1946
327 Ga0501046_0197988 3300049580 Bacteria 1496
328 Ga0501047_0399109 3300049581 Bacteria 1208
329 Ga0501047_0467231 3300049581 Bacteria 1090
330 Ga0501241_027855 3300049758 Bacteria 1058
331 Ga0501035_0163776 3300049822 Bacteria 1924
332 Ga0501044_0274426 3300049823 Bacteria 1621
333 Ga0501044_1229863 3300049823 Bacteria 616
334 Ga0500643_000550 3300053087 Bacteria 26088
335 Ga0500643_002364 3300053087 Bacteria 9833
336 Ga0500643_006964 3300053087 Bacteria 4640
337 Ga0500643_015578 3300053087 Bacteria 2602
338 Ga0500643_019068 3300053087 Bacteria 2265
339 Ga0500643_024468 3300053087 Bacteria 1916
340 Ga0500643_084251 3300053087 Bacteria 871
341 Ga0500583_0166692 3300053092 Bacteria 1097
342 Ga0500641_0003973 3300053096 Bacteria 5230
343 Ga0500556_0085065 3300053104 Bacteria 1201
344 Ga0500562_082524 3300053108 Bacteria 870
345 Ga0500592_000427 3300053116 Bacteria 7038
346 Ga0500595_011043 3300053119 Bacteria 3557
347 Ga0500597_024404 3300053120 Bacteria 2427
348 Ga0500608_030827 3300053122 Bacteria 2543
349 Ga0500618_012816 3300053125 Bacteria 2185
350 Ga0500658_0000189 3300053134 Bacteria 29335
351 Ga0500658_0019168 3300053134 Bacteria 2572
352 Ga0500559_0000456 3300053136 Bacteria 29143
353 Ga0500559_0009597 3300053136 Bacteria 4180
354 Ga0500559_0231834 3300053136 Bacteria 870
355 Ga0500568_0009769 3300053139 Bacteria 4536
356 Ga0500568_0065343 3300053139 Bacteria 1401
357 Ga0500573_0000093 3300053140 Bacteria 40260
358 Ga0500577_0006170 3300053142 Bacteria 3285
359 Ga0500604_0030160 3300053151 Bacteria 1585
360 Ga0500616_0003849 3300053153 Bacteria 11090
361 Ga0500616_0011809 3300053153 Bacteria 5139
362 Ga0500622_0035776 3300053156 Bacteria 2598
363 Ga0500622_0094641 3300053156 Bacteria 1478
364 Ga0500624_000003 3300053157 Bacteria 253364
365 Ga0500624_000173 3300053157 Bacteria 25864
366 Ga0500627_0008001 3300053158 Bacteria 3727
367 Ga0500627_0061636 3300053158 Bacteria 1651
368 Ga0500638_313582 3300053162 Bacteria 599
369 Ga0500636_0007644 3300053177 Bacteria 6252
370 Ga0500636_0085124 3300053177 Bacteria 1817
371 Ga0500637_0000073 3300053178 Bacteria 35884
372 Ga0500611_000556 3300053727 Bacteria 3786
373 Ga0500645_005336 3300053730 Bacteria 4755
374 Ga0500645_129708 3300053730 Bacteria 701
375 Ga0500601_018981 3300053737 Bacteria 791
376 2600203228 2599185354 Bacteria 4398675
377 2644127446 2643221622 Bacteria 4212502
378 2753766755 2751185897 Bacteria 5322941
379 2830076018 2830075706 Bacteria 3855215
380 2885432695 2885429604 Bacteria 3642894
381 2946790361 2946787523 Bacteria 4366789
382 2990268164 2990265787 Bacteria 3943888
383 2993696811 2993693658 Bacteria 4040749
384 Ga0068858_100005711
385 JGI24736J21556_1000023
386 JGI24752J21851_1000647
387 JGI24752J21851_1000649
388 JGI24740J21852_10030171
389 JGI24739J22299_10004650
390 JGI24739J22299_10029846
391 JGI24737J22298_10002290
392 JGI24750J21931_1000150
393 JGI24750J21931_1003965
394 JGI24748J21848_1000037
395 JGI24738J21930_10001522
396 JGI24749J21850_1001968
397 JGI24034J26672_10000024
398 JGI24034J26672_10000025
399 JGI24751J29686_10006785
400 JGI25165J46597_1000010
401 JGI25153J46596_10002609
402 JGI25153J46596_10011649
403 Ga0055537_1001357
404 Ga0055524_1000387
405 Ga0055530_10021267
406 Ga0055530_10021891
407 Ga0055531_10005489
408 Ga0065165_1004058
409 Ga0065165_1006425
410 Ga0065165_1031530
411 Ga0065704_10120183
412 Ga0065707_10000450
413 Ga0065707_10132676
414 Ga0065707_10221004
415 Ga0070658_10028226
416 Ga0070658_10069966
417 Ga0070690_100000202
418 Ga0070670_100000195
419 Ga0070670_100030625
420 Ga0070666_10000053
421 Ga0070666_10002955
422 Ga0070689_100009404
423 Ga0070668_100023355
424 Ga0070668_100228180
425 Ga0070669_100000008
426 Ga0070669_100000009
427 Ga0070671_100000010
428 Ga0070667_100001362
429 Ga0070667_100006048
430 Ga0070667_100278344
431 Ga0070705_100049695
432 Ga0070685_10001448
433 Ga0068853_100000256
434 Ga0068853_100027338
435 Ga0068853_100353428
436 Ga0068853_100750641
437 Ga0070686_100000050
438 Ga0070665_100000004
439 Ga0070665_100234325
440 Ga0068855_100897505
441 Ga0068857_100031466
442 Ga0068857_100235910
443 Ga0068854_100161321
444 Ga0068856_100817405
445 Ga0068852_100196731
446 Ga0068859_100000396
447 Ga0068859_100002837
448 Ga0068859_100088092
449 Ga0068859_100185315
450 Ga0068864_100000189
451 Ga0068864_100000851
452 Ga0068864_100011199
453 Ga0068864_100028681
454 Ga0068861_100001538
455 Ga0068861_100004386
456 Ga0068863_100000010
457 Ga0068863_100000073
458 Ga0068863_100125707
459 Ga0068863_100587915
460 Ga0068858_100000268
461 Ga0068858_100004631
462 Ga0068858_100004934
463 Ga0068858_100510974
464 Ga0068860_100000189
465 Ga0068860_100001052
466 Ga0068862_100000233
467 Ga0068862_100000334
468 Ga0068862_100000352
469 Ga0081455_10000212
470 Ga0081540_1075351
471 Ga0075368_10000034
472 Ga0097620_100000396
473 Ga0097620_100088095
474 Ga0097620_100185324
475 Ga0105251_10000468
476 Ga0105250_10043498
477 Ga0105245_10007068
478 Ga0105247_10001269
479 Ga0105247_10006001
480 Ga0105247_10065502
481 Ga0105243_10104087
482 Ga0105241_10177829
483 Ga0105248_10000026
484 Ga0105248_10002472
485 Ga0105248_10021003
486 Ga0105248_10249536
487 Ga0105237_10099952
488 Ga0105237_10258527
489 Ga0105238_10006048
490 Ga0105238_10705085
491 Ga0105249_10000157
492 Ga0105249_10000614
493 Ga0105249_10001016
494 Ga0105249_10152441
495 Ga0105239_10417583
496 Ga0105239_10449616
497 Ga0105239_10912066
498 Ga0157373_10126721
499 Ga0157373_10166013
500 Ga0157371_10032110
501 Ga0157370_10040725
502 Ga0157370_10335384
503 Ga0157369_10023012
504 Ga0157374_10215721
505 Ga0157378_10128408
506 Ga0157378_10167283
507 Ga0163162_10001763
508 Ga0163162_10010553
509 Ga0163162_10045865
510 Ga0163162_10510725
511 Ga0157372_10232057
512 Ga0157372_10656958
513 Ga0163163_10026993
514 Ga0163163_10094509
515 Ga0163163_10633232
516 Ga0157380_10000740
517 Ga0157380_10003622
518 Ga0157379_10019263
519 Ga0157379_10105600
520 Ga0183363_1015
521 Ga0163161_10000020
522 Ga0213876_10140805
523 Ga0213875_10010742
524 Ga0207672_1001261
525 Ga0209233_1000044
526 Ga0209565_1000029
527 Ga0209673_1004556
528 Ga0209675_1006164
529 Ga0209758_1002578
530 Ga0209050_1003344
531 Ga0209256_1000008
532 Ga0209257_1002893
533 Ga0207697_10000036
534 Ga0207697_10003102
535 Ga0207656_10017112
536 Ga0207656_10022035
537 Ga0207713_1051050
538 Ga0207710_10001449
539 Ga0207710_10002285
540 Ga0207710_10037271
541 Ga0207680_10000017
542 Ga0207680_10000044
543 Ga0207647_10001726
544 Ga0207705_10113943
545 Ga0207705_10144259
546 Ga0207654_10009517
547 Ga0207695_10005689
548 Ga0207695_10013250
549 Ga0207695_10194332
550 Ga0207671_10011973
551 Ga0207671_10172822
552 Ga0207649_10175727
553 Ga0207681_10000002
554 Ga0207681_10000020
555 Ga0207694_10001864
556 Ga0207694_10016124
557 Ga0207650_10000243
558 Ga0207650_10030983
559 Ga0207650_10060975
560 Ga0207687_10004631
561 Ga0207644_10000002
562 Ga0207644_10001497
563 Ga0207690_10133726
564 Ga0207706_10015588
565 Ga0207706_10024558
566 Ga0207709_10130641
567 Ga0207670_10032568
568 Ga0207691_10500283
569 Ga0207711_10000004
570 Ga0207711_10001647
571 Ga0207711_10016688
572 Ga0207711_10028452
573 Ga0207689_10246983
574 Ga0207667_10021852
575 Ga0207667_10171498
576 Ga0207667_10537985
577 Ga0207712_10000099
578 Ga0207712_10009203
579 Ga0207712_10020825
580 Ga0207712_10110554
581 Ga0207668_10001703
582 Ga0207668_10052293
583 Ga0207640_10019425
584 Ga0207640_10059035
585 Ga0207640_10091030
586 Ga0207658_10000393
587 Ga0207658_10000430
588 Ga0207658_10007810
589 Ga0207658_10506977
590 Ga0207703_10000139
591 Ga0207703_10001170
592 Ga0207703_10005752
593 Ga0207703_10015392
594 Ga0207639_10009382
595 Ga0207639_10060645
596 Ga0207639_10087207
597 Ga0207639_10099497
598 Ga0207702_10003500
599 Ga0207641_10000018
600 Ga0207641_10000171
601 Ga0207676_10000027
602 Ga0207676_10000072
603 Ga0207676_10000489
604 Ga0207676_10159644
605 Ga0207674_10018943
606 Ga0207674_10041501
607 Ga0207674_10095817
608 Ga0207674_10191484
609 Ga0207675_100002114
610 Ga0207675_100002191
611 Ga0207698_10001620
612 Ga0207698_10239998
613 Ga0209983_1009335
614 Ga0268266_10000009
615 Ga0268266_10191093
616 Ga0268265_10000097
617 Ga0268265_10000187
618 Ga0268265_10002184
619 Ga0268264_10000010
620 Ga0268264_10000023
621 Ga0307517_10112412
622 Ga0307515_10306351
623 Ga0307513_10024219
624 Ga0307513_10153468
625 Ga0307509_10143135
626 Ga0307508_10000011
627 Ga0307508_10100659
628 Ga0307516_10189408
629 Ga0307405_10150071
630 Ga0307412_10005910
631 Ga0307412_10183105
632 Ga0307416_100188246
633 Ga0307414_10033629
634 Ga0307510_10001394
635 Ga0395905_0364069
636 Ga0436364_0693360
637 Ga0237819_00130
638 Ga0237816_00594
639 Ga0436365_1644582
640 Ga0439439_0092210
641 Ga0439439_0121913
642 Ga0439461_0012277
643 Ga0439465_0027445
644 Ga0451793_0601646
645 Ga0451807_1216956
646 Ga0439431_0014061
647 Ga0439442_045605
648 Ga0439445_0014555
649 Ga0439432_027662
650 Ga0439457_015269
651 Ga0439462_0000151
652 Ga0450923_127079
653 Ga0450910_031374
654 Ga0450909_002516
655 Ga0439434_0011832
656 Ga0453684_0233710
657 Ga0466970_0177110
658 Ga0495585_0180727
659 Ga0495607_0011146
660 Ga0495583_0005113
661 Ga0495643_0032966
662 Ga0495648_0006183
663 Ga0495663_0010901
664 Ga0495663_0012850
665 Ga0495666_0181713
666 Ga0495654_0021598
667 Ga0495622_0166984
668 Ga0495668_0002162
669 Ga0495668_0138172
670 Ga0495625_0000094
671 Ga0495625_0002964
672 Ga0495625_0052870
673 Ga0495625_0063665
674 Ga0495625_0159161
675 Ga0495670_0000016
676 Ga0495670_0009870
677 Ga0495670_0044129
678 Ga0495671_0012219
679 Ga0495671_0097184
680 Ga0495589_0021219
681 Ga0495677_0004063
682 Ga0495681_0031995
683 Ga0496101_0098950
684 Ga0496101_0234266
685 Ga0496102_0052322
686 Ga0496103_0006677
687 Ga0496103_0022364
688 Ga0496103_0184428
689 Ga0496103_0667323
690 Ga0496106_0089666
691 Ga0496106_0341243
692 Ga0496111_0193759
693 Ga0496115_0242557
694 Ga0496116_0209700
695 Ga0496117_0000535
696 Ga0496117_0006156
697 Ga0496118_0001906
698 Ga0496118_0002459
699 Ga0496119_0137734
700 Ga0496121_0000441
701 Ga0496121_0012164
702 Ga0496122_0314736
703 Ga0496123_0001952
704 Ga0496124_0181559
705 Ga0496125_0127995
706 Ga0501034_0588850
707 Ga0501034_1078152
708 Ga0501037_0096950
709 Ga0501043_0133456
710 Ga0501046_0197988
711 Ga0501047_0399109
712 Ga0501047_0467231
713 Ga0501241_027855
714 Ga0501035_0163776
715 Ga0501044_0274426
716 Ga0501044_1229863
717 Ga0500643_000550
718 Ga0500643_002364
719 Ga0500643_006964
720 Ga0500643_015578
721 Ga0500643_019068
722 Ga0500643_024468
723 Ga0500643_084251
724 Ga0500583_0166692
725 Ga0500641_0003973
726 Ga0500556_0085065
727 Ga0500562_082524
728 Ga0500592_000427
729 Ga0500595_011043
730 Ga0500597_024404
731 Ga0500608_030827
732 Ga0500618_012816
733 Ga0500658_0000189
734 Ga0500658_0019168
735 Ga0500559_0000456
736 Ga0500559_0009597
737 Ga0500559_0231834
738 Ga0500568_0009769
739 Ga0500568_0065343
740 Ga0500573_0000093
741 Ga0500577_0006170
742 Ga0500604_0030160
743 Ga0500616_0003849
744 Ga0500616_0011809
745 Ga0500622_0035776
746 Ga0500622_0094641
747 Ga0500624_000003
748 Ga0500624_000173
749 Ga0500627_0008001
750 Ga0500627_0061636
751 Ga0500638_313582
752 Ga0500636_0007644
753 Ga0500636_0085124
754 Ga0500637_0000073
755 Ga0500611_000556
756 Ga0500645_005336
757 Ga0500645_129708
758 Ga0500601_018981
759 2600203228
760 2644127446
761 2753766755
762 2830076018
763 2885432695
764 2946790361
765 2990268164
766 2993696811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02190

LON_substr_bdg

ATP-dependent protease La (LON) substrate-binding domain

29

218

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ane-assembly1.cif.gz_D crystal structure of n-terminal domain of e.coli lon protease 0.888 7 111
2ane-assembly1.cif.gz_D crystal structure of n-terminal domain of e.coli lon protease 0.8437 7 111
7cay-assembly1.cif.gz_A crystal structure of lon n-terminal domain protein from xanthomonas campestris 0.8221 7 195
7cay-assembly1.cif.gz_A crystal structure of lon n-terminal domain protein from xanthomonas campestris 0.8051 7 195
3ljc-assembly1.cif.gz_A crystal structure of lon n-terminal domain. 0.8031 6 199
ID Description Score Start End Superfamily
af_B4FM67_80_193_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9186 3 110 2.30.130.40
af_I1K7N5_54_171_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9143 2 111 2.30.130.40
af_I1KCV7_279_380_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.914 7 111 2.30.130.40
af_P96280_7_116_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9115 7 111 2.30.130.40
af_A0A0G2K313_628_728_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9065 9 111 2.30.130.40
ID Description Score Start End GO Terms
AF-A0A2P7QUC0-F1-model_v4 ATP-dependent protease 0.9623 3 209 GO:0006508
GO:0008233
AF-A0A4R6FHJ8-F1-model_v4 deleted 0.9524 7 204
AF-A0A0S3F3L0-F1-model_v4 ATP-dependent protease 0.946 6 209 GO:0006508
GO:0008233
AF-A0A7Y3W5B0-F1-model_v4 Peptidase S16 0.9444 8 199
AF-A0A2E6X6L1-F1-model_v4 Peptidase S16 0.9392 8 202

Map