F429554

General Info

Members Datasets Scaffolds Average Seq Length
383 206 766 110

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100013786|Ga0075428_1000137867
Length 125
Sequence MTREKKECGMSDMKWTELRTESQLEQIQEESRTKSILIFKHSSRCSISKMALDRLERKWNAEETMHIKPYFVDLLSFREISASIASQFDVEHESPQVLIIENGQSIYDQSHFDIDYHKILVAAKN

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
121 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
122 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
123 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
149 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
150 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
159 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
160 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
161 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
166 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
167 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
168 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
169 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
170 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
171 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
172 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
175 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
179 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
180 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
181 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
183 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
184 2738541283 Pedobacter sp. OK701 Isolate Unclassified
185 2738541284 Pedobacter sp. YR016 Isolate Unclassified
186 2738541302 Pedobacter sp. CF074 Isolate Unclassified
187 2738543023 Pedobacter sp. OK628 Isolate Unclassified
188 2739367651 Pedobacter sp. OK291 Isolate Unclassified
189 2739367656 Pedobacter sp. CF523 Isolate Unclassified
190 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
191 2818991437 Pedobacter terrae 518 Isolate Unclassified
192 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
193 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
194 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
195 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
196 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
197 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
198 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
199 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
200 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
201 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
202 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
203 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
204 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
205 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
206 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.38
Metatranscriptomes 2.09
Isolates 6.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.23
Nodule 0
Rhizoplane 1.83
Rhizosphere 77.55
Stem 0
Stem Tuber 0
Unclassified 7.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100013786 3300006844 Bacteria 9004
2 SwRhRL2b_contig_1363481 2162886007 Bacteria 1119
3 SwRhRL2b_contig_3392341 2162886007 Bacteria 2529
4 JGI24736J21556_1001405 3300001904 Bacteria 4406
5 JGI24740J21852_10041403 3300001979 Bacteria 1388
6 JGI24739J22299_10199657 3300001989 Bacteria 587
7 JGI24739J22299_10199769 3300001989 Bacteria 587
8 JGI24737J22298_10000077 3300001990 Bacteria 28981
9 JGI24737J22298_10056968 3300001990 Bacteria 1180
10 JGI24737J22298_10137105 3300001990 Bacteria 723
11 JGI24735J21928_10000005 3300002067 Bacteria 356755
12 JGI24735J21928_10023968 3300002067 Bacteria 1848
13 JGI25162J39368_1000563 3300002737 Bacteria 27213
14 JGI25152J39213_1000006 3300002773 Bacteria 158516
15 JGI25150J39212_1000005 3300002774 Bacteria 311800
16 JGI25151J46595_10000004 3300003187 Bacteria 494006
17 JGI25153J46596_10000004 3300003215 Bacteria 494006
18 rootH1_10023440 3300003316 Bacteria 5453
19 rootH2_10194391 3300003320 Bacteria 1212
20 rootL2_10021894 3300003322 Bacteria 11126
21 rootL2_10103955 3300003322 Unclassified 1895
22 rootH1_10008582 3300003323 Bacteria 172664
23 rootH1_10100747 3300003323 Bacteria 6026
24 rootH1_10127442 3300003323 Unclassified 2053
25 rootH1_10152501 3300003323 Bacteria 2114
26 rootH1_10327782 3300003323 Bacteria 1544
27 rootH1_10364027 3300003323 Bacteria 1718
28 Ga0055536_1000004 3300003781 Bacteria 411108
29 Ga0055530_10001269 3300003791 Bacteria 19064
30 Ga0055543_1050969 3300004625 Bacteria 678
31 Ga0058862_10825505 3300004803 Bacteria 672
32 Ga0065165_1000470 3300005262 Bacteria 62866
33 Ga0065714_10004265 3300005288 Bacteria 5776
34 Ga0065714_10064689 3300005288 Bacteria 23467
35 Ga0065714_10066111 3300005288 Bacteria 7587
36 Ga0065714_10072693 3300005288 Bacteria 3313
37 Ga0065714_10120522 3300005288 Bacteria 1351
38 Ga0065714_10136200 3300005288 Bacteria 1207
39 Ga0065714_10155695 3300005288 Bacteria 1080
40 Ga0065714_10155781 3300005288 Bacteria 1079
41 Ga0065714_10207260 3300005288 Bacteria 877
42 Ga0065704_10073975 3300005289 Bacteria 6617
43 Ga0065704_10136808 3300005289 Bacteria 1552
44 Ga0065704_10858711 3300005289 Bacteria 507
45 Ga0065715_10118966 3300005293 Bacteria 2292
46 Ga0070658_10020598 3300005327 Bacteria 5286
47 Ga0070658_10084782 3300005327 Bacteria 2605
48 Ga0070658_10100385 3300005327 Bacteria 2392
49 Ga0070658_10168420 3300005327 Bacteria 1840
50 Ga0070683_100162959 3300005329 Bacteria 2116
51 Ga0070680_100008098 3300005336 Bacteria 8023
52 Ga0070680_101373635 3300005336 Bacteria 612
53 Ga0070660_100194832 3300005339 Bacteria 1642
54 Ga0070660_100256435 3300005339 Bacteria 1427
55 Ga0070692_10399109 3300005345 Bacteria 868
56 Ga0070675_100799079 3300005354 Bacteria 862
57 Ga0070674_100317739 3300005356 Bacteria 1247
58 Ga0070674_101647069 3300005356 Unclassified 579
59 Ga0070659_100002565 3300005366 Bacteria 12918
60 Ga0070713_100470894 3300005436 Bacteria 1182
61 Ga0070663_100017969 3300005455 Bacteria 4626
62 Ga0070663_100578458 3300005455 Bacteria 942
63 Ga0070681_10027266 3300005458 Bacteria 5745
64 Ga0070679_100073738 3300005530 Bacteria 3404
65 Ga0070679_101305008 3300005530 Bacteria 671
66 Ga0068853_100045019 3300005539 Bacteria 3779
67 Ga0070686_100522362 3300005544 Bacteria 924
68 Ga0068855_100041312 3300005563 Bacteria 5467
69 Ga0068855_101548569 3300005563 Unclassified 679
70 Ga0068857_100059357 3300005577 Bacteria 3398
71 Ga0068857_100138715 3300005577 Bacteria 2197
72 Ga0068857_100185597 3300005577 Bacteria 1893
73 Ga0068854_101153458 3300005578 Bacteria 692
74 Ga0068856_100012333 3300005614 Bacteria 8276
75 Ga0068856_100040266 3300005614 Bacteria 4589
76 Ga0075366_10005756 3300006195 Bacteria 6731
77 Ga0075366_10006727 3300006195 Bacteria 6313
78 Ga0097621_100664543 3300006237 Bacteria 957
79 Ga0075430_100684231 3300006846 Unclassified 845
80 Ga0105251_10426558 3300009011 Bacteria 612
81 Ga0105240_10465962 3300009093 Bacteria 1411
82 Ga0111539_10002481 3300009094 Bacteria 24471
83 Ga0105237_10195948 3300009545 Unclassified 2020
84 Ga0105237_10217510 3300009545 Bacteria 1910
85 Ga0105237_10229458 3300009545 Bacteria 1857
86 Ga0105237_10246298 3300009545 Bacteria 1789
87 Ga0105237_10295547 3300009545 Bacteria 1622
88 Ga0105239_10000008 3300010375 Bacteria 376925
89 Ga0105239_10000446 3300010375 Bacteria 60289
90 Ga0105239_10009159 3300010375 Bacteria 11197
91 Ga0105239_10018812 3300010375 Bacteria 7631
92 Ga0105239_11315001 3300010375 Unclassified 834
93 Ga0157373_10000091 3300013100 Bacteria 75012
94 Ga0157373_10000424 3300013100 Bacteria 33838
95 Ga0157373_10003653 3300013100 Bacteria 11625
96 Ga0157373_10018982 3300013100 Bacteria 5005
97 Ga0157373_10054096 3300013100 Bacteria 2853
98 Ga0157373_10121334 3300013100 Bacteria 1837
99 Ga0157373_10187902 3300013100 Bacteria 1455
100 Ga0157371_10000155 3300013102 Bacteria 100230
101 Ga0157371_10000241 3300013102 Bacteria 78231
102 Ga0157371_10001204 3300013102 Bacteria 27630
103 Ga0157371_10003294 3300013102 Bacteria 14779
104 Ga0157371_10012104 3300013102 Bacteria 6609
105 Ga0157371_10030949 3300013102 Bacteria 3857
106 Ga0157371_10078407 3300013102 Bacteria 2340
107 Ga0157371_10094458 3300013102 Bacteria 2119
108 Ga0157371_10748437 3300013102 Bacteria 734
109 Ga0157371_10915387 3300013102 Bacteria 666
110 Ga0157370_10000084 3300013104 Bacteria 104159
111 Ga0157370_10002172 3300013104 Bacteria 23929
112 Ga0157370_10023606 3300013104 Bacteria 6104
113 Ga0157370_10049416 3300013104 Bacteria 4025
114 Ga0157370_10083053 3300013104 Bacteria 3012
115 Ga0157370_10096156 3300013104 Bacteria 2779
116 Ga0157370_10121272 3300013104 Bacteria 2441
117 Ga0157370_10178676 3300013104 Bacteria 1972
118 Ga0157370_10222325 3300013104 Bacteria 1749
119 Ga0157370_10364533 3300013104 Bacteria 1332
120 Ga0157370_10465166 3300013104 Bacteria 1162
121 Ga0157370_11444768 3300013104 Bacteria 619
122 Ga0157370_11602112 3300013104 Bacteria 585
123 Ga0157369_10000023 3300013105 Bacteria 226955
124 Ga0157369_10001688 3300013105 Bacteria 26948
125 Ga0157369_10328518 3300013105 Bacteria 1589
126 Ga0157369_10762558 3300013105 Bacteria 995
127 Ga0157369_11373314 3300013105 Bacteria 719
128 Ga0157369_11868857 3300013105 Unclassified 610
129 Ga0157374_10498457 3300013296 Bacteria 1222
130 Ga0163162_10000675 3300013306 Bacteria 31705
131 Ga0163162_10133830 3300013306 Bacteria 2589
132 Ga0163162_10998812 3300013306 Bacteria 946
133 Ga0163162_11441054 3300013306 Bacteria 784
134 Ga0163162_12396548 3300013306 Bacteria 607
135 Ga0163162_12869300 3300013306 Unclassified 555
136 Ga0157372_10002228 3300013307 Bacteria 21035
137 Ga0157372_10004603 3300013307 Bacteria 14664
138 Ga0157372_10007451 3300013307 Bacteria 11640
139 Ga0157372_10012239 3300013307 Bacteria 9137
140 Ga0157372_10015721 3300013307 Bacteria 8116
141 Ga0157372_10039852 3300013307 Bacteria 5187
142 Ga0157372_10094520 3300013307 Bacteria 3404
143 Ga0157372_10529595 3300013307 Bacteria 1373
144 Ga0157372_10721732 3300013307 Bacteria 1159
145 Ga0157372_11684476 3300013307 Unclassified 730
146 Ga0157375_10523854 3300013308 Bacteria 1348
147 Ga0157375_10774243 3300013308 Bacteria 1110
148 Ga0157375_12057359 3300013308 Bacteria 679
149 Ga0182008_10000002 3300014497 Bacteria 480216
150 Ga0182008_10000112 3300014497 Bacteria 62174
151 Ga0182008_10004431 3300014497 Bacteria 8212
152 Ga0182008_10021751 3300014497 Bacteria 3293
153 Ga0182008_10087176 3300014497 Unclassified 1538
154 Ga0182008_10113001 3300014497 Bacteria 1346
155 Ga0182006_1000236 3300015261 Bacteria 52217
156 Ga0182006_1000666 3300015261 Bacteria 24108
157 Ga0182006_1002055 3300015261 Bacteria 11279
158 Ga0182006_1145081 3300015261 Bacteria 808
159 Ga0182007_10000002 3300015262 Bacteria 564661
160 Ga0182007_10007409 3300015262 Bacteria 4603
161 Ga0182007_10018782 3300015262 Bacteria 2499
162 Ga0182007_10039008 3300015262 Bacteria 1591
163 Ga0183373_1004 3300015682 Bacteria 537398
164 Ga0163161_10000893 3300017792 Bacteria 23185
165 Ga0163161_10000894 3300017792 Bacteria 23161
166 Ga0163161_10001714 3300017792 Bacteria 16064
167 Ga0163161_10010774 3300017792 Bacteria 6335
168 Ga0163161_10058418 3300017792 Bacteria 2804
169 Ga0163161_10265131 3300017792 Bacteria 1343
170 Ga0163161_10534279 3300017792 Bacteria 959
171 Ga0206351_10190117 3300020077 Bacteria 1211
172 Ga0206352_10337241 3300020078 Unclassified 562
173 Ga0206352_10805182 3300020078 Bacteria 670
174 Ga0206350_10412288 3300020080 Unclassified 702
175 Ga0206353_10082492 3300020082 Unclassified 650
176 Ga0154015_1364402 3300020610 Bacteria 540
177 Ga0213872_10464212 3300021361 Unclassified 508
178 Ga0209437_100507 3300025233 Bacteria 27709
179 Ga0207425_1000008 3300025245 Bacteria 618024
180 Ga0209129_1000040 3300025258 Bacteria 313043
181 Ga0209129_1006755 3300025258 Bacteria 3611
182 Ga0209233_1000701 3300025261 Bacteria 15748
183 Ga0209676_1000009 3300025292 Bacteria 981719
184 Ga0209025_1000020 3300025294 Bacteria 618024
185 Ga0209758_1000022 3300025297 Bacteria 618024
186 Ga0209050_1000048 3300025298 Bacteria 371553
187 Ga0209050_1032221 3300025298 Bacteria 1616
188 Ga0207647_10000135 3300025904 Bacteria 58247
189 Ga0207647_10257612 3300025904 Bacteria 1000
190 Ga0207705_10002369 3300025909 Bacteria 14570
191 Ga0207705_10030405 3300025909 Bacteria 3854
192 Ga0207705_10325801 3300025909 Bacteria 1181
193 Ga0207705_10734326 3300025909 Bacteria 767
194 Ga0207707_10012873 3300025912 Bacteria 7280
195 Ga0207695_10115330 3300025913 Bacteria 2661
196 Ga0207671_10136879 3300025914 Bacteria 1884
197 Ga0207671_10180318 3300025914 Bacteria 1643
198 Ga0207671_10909905 3300025914 Bacteria 695
199 Ga0207671_11474097 3300025914 Unclassified 526
200 Ga0207660_10012315 3300025917 Bacteria 5593
201 Ga0207660_11468117 3300025917 Unclassified 552
202 Ga0207657_10192672 3300025919 Bacteria 1643
203 Ga0207657_10408978 3300025919 Bacteria 1067
204 Ga0207652_10000887 3300025921 Bacteria 28316
205 Ga0207690_10121727 3300025932 Bacteria 1897
206 Ga0207661_10430947 3300025944 Unclassified 1199
207 Ga0207667_10005073 3300025949 Bacteria 16090
208 Ga0207640_10077605 3300025981 Bacteria 2258
209 Ga0207678_10033101 3300026067 Bacteria 4504
210 Ga0207678_10046536 3300026067 Bacteria 3752
211 Ga0207702_10006955 3300026078 Bacteria 9689
212 Ga0207702_10009280 3300026078 Bacteria 8264
213 Ga0207648_10637572 3300026089 Bacteria 984
214 Ga0207674_10045110 3300026116 Bacteria 4537
215 Ga0207674_10122080 3300026116 Bacteria 2572
216 Ga0207674_10564116 3300026116 Unclassified 1100
217 Ga0209999_1057061 3300027543 Bacteria 741
218 Ga0209983_1112379 3300027665 Bacteria 619
219 Ga0209998_10110610 3300027717 Bacteria 686
220 Ga0207428_10059691 3300027907 Bacteria 3023
221 Ga0307515_10000643 3300028794 Bacteria 80674
222 Ga0307515_10014538 3300028794 Bacteria 14575
223 Ga0307515_10024651 3300028794 Bacteria 10465
224 Ga0307515_10170593 3300028794 Bacteria 2171
225 Ga0316181_1195168 3300030744 Bacteria 921
226 Ga0307513_10354762 3300031456 Bacteria 1213
227 Ga0307513_10838271 3300031456 Bacteria 626
228 Ga0307408_102018393 3300031548 Bacteria 555
229 Ga0307516_10647421 3300031730 Bacteria 712
230 Ga0307405_10000006 3300031731 Bacteria 361477
231 Ga0307405_11120188 3300031731 Bacteria 677
232 Ga0307405_11775149 3300031731 Unclassified 548
233 Ga0307413_12047960 3300031824 Bacteria 517
234 Ga0307407_10000003 3300031903 Bacteria 271723
235 Ga0307412_10000085 3300031911 Bacteria 88692
236 Ga0307412_10923470 3300031911 Unclassified 766
237 Ga0307409_100064605 3300031995 Bacteria 2876
238 Ga0307416_100000819 3300032002 Bacteria 16274
239 Ga0307414_10000078 3300032004 Bacteria 90911
240 Ga0307414_10000510 3300032004 Bacteria 20231
241 Ga0307414_10001132 3300032004 Bacteria 13647
242 Ga0307414_10001429 3300032004 Bacteria 12403
243 Ga0307414_10101762 3300032004 Bacteria 2164
244 Ga0307414_10385866 3300032004 Bacteria 1212
245 Ga0307414_10980520 3300032004 Unclassified 777
246 Ga0307414_11186960 3300032004 Bacteria 706
247 Ga0307411_10436206 3300032005 Bacteria 1092
248 Ga0307411_10767278 3300032005 Bacteria 846
249 Ga0307507_10014221 3300033179 Bacteria 9519
250 Ga0373935_0761895 3300035692 Bacteria 714
251 Ga0395899_0004023 3300037312 Bacteria 11589
252 Ga0395899_0053655 3300037312 Bacteria 2984
253 Ga0395900_0034150 3300037418 Bacteria 5236
254 Ga0395900_0810949 3300037418 Bacteria 863
255 Ga0395900_1838074 3300037418 Bacteria 516
256 Ga0395898_0005541 3300037466 Bacteria 13617
257 Ga0395898_0045346 3300037466 Bacteria 4322
258 Ga0395905_0185335 3300037471 Bacteria 1954
259 Ga0395901_0646589 3300038443 Bacteria 1061
260 Ga0395901_0828475 3300038443 Bacteria 912
261 Ga0451791_0163352 3300041451 Unclassified 579
262 Ga0451791_0631398 3300041451 Bacteria 887
263 Ga0451793_0371445 3300041452 Bacteria 525
264 Ga0451795_0879970 3300041456 Bacteria 763
265 Ga0451849_0188467 3300041505 Bacteria 1128
266 Ga0439445_0144618 3300042004 Unclassified 690
267 Ga0450923_114421 3300042125 Bacteria 632
268 Ga0495627_051499 3300046453 Bacteria 1237
269 Ga0495627_138059 3300046453 Bacteria 683
270 Ga0495592_0205659 3300046454 Bacteria 1326
271 Ga0495629_0086686 3300046459 Bacteria 2184
272 Ga0495638_0157949 3300046460 Bacteria 1310
273 Ga0495638_0577163 3300046460 Bacteria 555
274 Ga0495651_0224811 3300046462 Bacteria 1297
275 Ga0495650_0000225 3300046471 Bacteria 117898
276 Ga0495650_0075761 3300046471 Bacteria 1309
277 Ga0495585_0000074 3300046492 Bacteria 102651
278 Ga0495585_0000323 3300046492 Bacteria 47094
279 Ga0495585_0157516 3300046492 Bacteria 1180
280 Ga0495583_0035693 3300046506 Bacteria 2371
281 Ga0495583_0167281 3300046506 Bacteria 905
282 Ga0495606_0000074 3300046507 Bacteria 170848
283 Ga0495606_0033701 3300046507 Bacteria 3529
284 Ga0495606_0051265 3300046507 Bacteria 2693
285 Ga0495606_0053134 3300046507 Bacteria 2630
286 Ga0495606_0346763 3300046507 Bacteria 789
287 Ga0495606_0377721 3300046507 Bacteria 744
288 Ga0495610_0000188 3300046512 Bacteria 69214
289 Ga0495610_0000499 3300046512 Bacteria 40154
290 Ga0495610_0022856 3300046512 Bacteria 3410
291 Ga0495616_0000806 3300046513 Bacteria 22928
292 Ga0495616_0002088 3300046513 Bacteria 13429
293 Ga0495628_0411986 3300046516 Bacteria 986
294 Ga0495648_0006718 3300046524 Bacteria 9305
295 Ga0495652_0261593 3300046529 Bacteria 1277
296 Ga0495609_0008096 3300046538 Bacteria 5178
297 Ga0495609_0367011 3300046538 Bacteria 579
298 Ga0495633_0000006 3300046558 Bacteria 326774
299 Ga0495633_0005434 3300046558 Bacteria 7785
300 Ga0495633_0087440 3300046558 Bacteria 1449
301 Ga0495668_0000011 3300046616 Bacteria 472186
302 Ga0495625_0000067 3300046660 Bacteria 171483
303 Ga0495625_0000462 3300046660 Bacteria 60985
304 Ga0495625_0000486 3300046660 Bacteria 59478
305 Ga0495625_0007386 3300046660 Bacteria 9575
306 Ga0495625_0028648 3300046660 Bacteria 4175
307 Ga0495625_0410232 3300046660 Bacteria 844
308 Ga0495661_0001183 3300046665 Bacteria 22653
309 Ga0495661_0108754 3300046665 Bacteria 1548
310 Ga0495661_0157013 3300046665 Bacteria 1224
311 Ga0495658_0126432 3300046683 Bacteria 1551
312 Ga0495671_0116509 3300046692 Bacteria 1304
313 Ga0495649_0000054 3300046694 Bacteria 107048
314 Ga0495660_0002682 3300046810 Bacteria 11256
315 Ga0495687_001083 3300047443 Bacteria 26756
316 Ga0495679_047885 3300047446 Bacteria 1295
317 Ga0495673_0163694 3300047469 Bacteria 852
318 Ga0495681_0049902 3300047470 Bacteria 1976
319 Ga0495686_0001571 3300047472 Bacteria 24245
320 Ga0495686_0004631 3300047472 Bacteria 11183
321 Ga0495686_0035242 3300047472 Bacteria 3218
322 Ga0495614_0152461 3300048089 Bacteria 1031
323 Ga0496114_0373770 3300048917 Bacteria 1262
324 Ga0496115_0192481 3300048918 Bacteria 1685
325 Ga0496122_0000837 3300048925 Bacteria 58147
326 Ga0496123_0006634 3300048926 Bacteria 11171
327 Ga0496125_0278886 3300048928 Bacteria 1037
328 Ga0496125_0579323 3300048928 Unclassified 617
329 Ga0495678_008557 3300049459 Bacteria 5149
330 Ga0495682_0019380 3300049460 Bacteria 2559
331 Ga0501257_160679 3300049686 Bacteria 625
332 Ga0501241_004551 3300049758 Bacteria 2597
333 Ga0501241_006587 3300049758 Bacteria 2136
334 nmdc:mga0k408_14434_c1 3300050493 Bacteria 4353
335 nmdc:mga0k408_22_c2 3300050493 Bacteria 93033
336 nmdc:mga0qj67_959813_c1 3300050509 Bacteria 672
337 nmdc:mga08y16_7679_c1 3300050511 Bacteria 8901
338 Ga0500635_0000482 3300053080 Bacteria 11190
339 Ga0500583_0093764 3300053092 Bacteria 1464
340 Ga0500651_0000312 3300053093 Bacteria 27929
341 Ga0500562_007087 3300053108 Bacteria 2828
342 Ga0500614_007798 3300053123 Bacteria 2262
343 Ga0500618_000148 3300053125 Bacteria 58264
344 Ga0500618_011470 3300053125 Bacteria 2349
345 Ga0500561_0048854 3300053137 Bacteria 1147
346 Ga0500564_111404 3300053138 Bacteria 1201
347 Ga0500568_0141927 3300053139 Bacteria 890
348 Ga0500588_0336892 3300053146 Unclassified 573
349 Ga0500604_0000119 3300053151 Bacteria 23992
350 Ga0500616_0027585 3300053153 Unclassified 3134
351 Ga0500622_0000075 3300053156 Bacteria 109513
352 Ga0500622_0000435 3300053156 Bacteria 39609
353 Ga0500622_0000891 3300053156 Bacteria 25423
354 Ga0500622_0047249 3300053156 Bacteria 2224
355 Ga0500624_000813 3300053157 Bacteria 7221
356 Ga0500627_0051744 3300053158 Unclassified 1792
357 Ga0500634_0220369 3300053161 Bacteria 815
358 Ga0587072_080485 3300059643 Bacteria 703
359 2586210619 2585427687 Bacteria 5544917
360 2599479988 2599185184 Bacteria 6430550
361 2738758882 2738541283 Bacteria 7222293
362 2738762028 2738541284 Bacteria 5199923
363 2738854357 2738541302 Bacteria 5944758
364 2739301997 2738543023 Bacteria 6767879
365 2739587897 2739367651 Bacteria 6359826
366 2739617466 2739367656 Bacteria 5152243
367 2776615327 2775506987 Bacteria 5373360
368 2819545783 2818991437 Bacteria 5805520
369 2842724327 2842722452 Bacteria 6263924
370 2842913538 2842909656 Bacteria 6185908
371 2849282650 2849281842 Bacteria 6065644
372 2852625715 2852623160 Bacteria 4376875
373 2852628953 2852627209 Bacteria 5896285
374 2857630405 2857627736 Bacteria 5625397
375 2904448455 2904445276 Bacteria 5310396
376 2919189004 2919186247 Bacteria 6244071
377 2919440169 2919437846 Bacteria 6199444
378 2928081119 2928078545 Bacteria 6534839
379 2928152460 2928147474 Bacteria 6512076
380 2932087769 2932082852 Bacteria 6563563
381 2939666841 2939664404 Bacteria 6364494
382 2945998838 2945997725 Bacteria 6404843
383 2954021286 2954016120 Bacteria 6446024
384 Ga0075428_100013786
385 SwRhRL2b_contig_1363481
386 SwRhRL2b_contig_3392341
387 JGI24736J21556_1001405
388 JGI24740J21852_10041403
389 JGI24739J22299_10199657
390 JGI24739J22299_10199769
391 JGI24737J22298_10000077
392 JGI24737J22298_10056968
393 JGI24737J22298_10137105
394 JGI24735J21928_10000005
395 JGI24735J21928_10023968
396 JGI25162J39368_1000563
397 JGI25152J39213_1000006
398 JGI25150J39212_1000005
399 JGI25151J46595_10000004
400 JGI25153J46596_10000004
401 rootH1_10023440
402 rootH2_10194391
403 rootL2_10021894
404 rootL2_10103955
405 rootH1_10008582
406 rootH1_10100747
407 rootH1_10127442
408 rootH1_10152501
409 rootH1_10327782
410 rootH1_10364027
411 Ga0055536_1000004
412 Ga0055530_10001269
413 Ga0055543_1050969
414 Ga0058862_10825505
415 Ga0065165_1000470
416 Ga0065714_10004265
417 Ga0065714_10064689
418 Ga0065714_10066111
419 Ga0065714_10072693
420 Ga0065714_10120522
421 Ga0065714_10136200
422 Ga0065714_10155695
423 Ga0065714_10155781
424 Ga0065714_10207260
425 Ga0065704_10073975
426 Ga0065704_10136808
427 Ga0065704_10858711
428 Ga0065715_10118966
429 Ga0070658_10020598
430 Ga0070658_10084782
431 Ga0070658_10100385
432 Ga0070658_10168420
433 Ga0070683_100162959
434 Ga0070680_100008098
435 Ga0070680_101373635
436 Ga0070660_100194832
437 Ga0070660_100256435
438 Ga0070692_10399109
439 Ga0070675_100799079
440 Ga0070674_100317739
441 Ga0070674_101647069
442 Ga0070659_100002565
443 Ga0070713_100470894
444 Ga0070663_100017969
445 Ga0070663_100578458
446 Ga0070681_10027266
447 Ga0070679_100073738
448 Ga0070679_101305008
449 Ga0068853_100045019
450 Ga0070686_100522362
451 Ga0068855_100041312
452 Ga0068855_101548569
453 Ga0068857_100059357
454 Ga0068857_100138715
455 Ga0068857_100185597
456 Ga0068854_101153458
457 Ga0068856_100012333
458 Ga0068856_100040266
459 Ga0075366_10005756
460 Ga0075366_10006727
461 Ga0097621_100664543
462 Ga0075430_100684231
463 Ga0105251_10426558
464 Ga0105240_10465962
465 Ga0111539_10002481
466 Ga0105237_10195948
467 Ga0105237_10217510
468 Ga0105237_10229458
469 Ga0105237_10246298
470 Ga0105237_10295547
471 Ga0105239_10000008
472 Ga0105239_10000446
473 Ga0105239_10009159
474 Ga0105239_10018812
475 Ga0105239_11315001
476 Ga0157373_10000091
477 Ga0157373_10000424
478 Ga0157373_10003653
479 Ga0157373_10018982
480 Ga0157373_10054096
481 Ga0157373_10121334
482 Ga0157373_10187902
483 Ga0157371_10000155
484 Ga0157371_10000241
485 Ga0157371_10001204
486 Ga0157371_10003294
487 Ga0157371_10012104
488 Ga0157371_10030949
489 Ga0157371_10078407
490 Ga0157371_10094458
491 Ga0157371_10748437
492 Ga0157371_10915387
493 Ga0157370_10000084
494 Ga0157370_10002172
495 Ga0157370_10023606
496 Ga0157370_10049416
497 Ga0157370_10083053
498 Ga0157370_10096156
499 Ga0157370_10121272
500 Ga0157370_10178676
501 Ga0157370_10222325
502 Ga0157370_10364533
503 Ga0157370_10465166
504 Ga0157370_11444768
505 Ga0157370_11602112
506 Ga0157369_10000023
507 Ga0157369_10001688
508 Ga0157369_10328518
509 Ga0157369_10762558
510 Ga0157369_11373314
511 Ga0157369_11868857
512 Ga0157374_10498457
513 Ga0163162_10000675
514 Ga0163162_10133830
515 Ga0163162_10998812
516 Ga0163162_11441054
517 Ga0163162_12396548
518 Ga0163162_12869300
519 Ga0157372_10002228
520 Ga0157372_10004603
521 Ga0157372_10007451
522 Ga0157372_10012239
523 Ga0157372_10015721
524 Ga0157372_10039852
525 Ga0157372_10094520
526 Ga0157372_10529595
527 Ga0157372_10721732
528 Ga0157372_11684476
529 Ga0157375_10523854
530 Ga0157375_10774243
531 Ga0157375_12057359
532 Ga0182008_10000002
533 Ga0182008_10000112
534 Ga0182008_10004431
535 Ga0182008_10021751
536 Ga0182008_10087176
537 Ga0182008_10113001
538 Ga0182006_1000236
539 Ga0182006_1000666
540 Ga0182006_1002055
541 Ga0182006_1145081
542 Ga0182007_10000002
543 Ga0182007_10007409
544 Ga0182007_10018782
545 Ga0182007_10039008
546 Ga0183373_1004
547 Ga0163161_10000893
548 Ga0163161_10000894
549 Ga0163161_10001714
550 Ga0163161_10010774
551 Ga0163161_10058418
552 Ga0163161_10265131
553 Ga0163161_10534279
554 Ga0206351_10190117
555 Ga0206352_10337241
556 Ga0206352_10805182
557 Ga0206350_10412288
558 Ga0206353_10082492
559 Ga0154015_1364402
560 Ga0213872_10464212
561 Ga0209437_100507
562 Ga0207425_1000008
563 Ga0209129_1000040
564 Ga0209129_1006755
565 Ga0209233_1000701
566 Ga0209676_1000009
567 Ga0209025_1000020
568 Ga0209758_1000022
569 Ga0209050_1000048
570 Ga0209050_1032221
571 Ga0207647_10000135
572 Ga0207647_10257612
573 Ga0207705_10002369
574 Ga0207705_10030405
575 Ga0207705_10325801
576 Ga0207705_10734326
577 Ga0207707_10012873
578 Ga0207695_10115330
579 Ga0207671_10136879
580 Ga0207671_10180318
581 Ga0207671_10909905
582 Ga0207671_11474097
583 Ga0207660_10012315
584 Ga0207660_11468117
585 Ga0207657_10192672
586 Ga0207657_10408978
587 Ga0207652_10000887
588 Ga0207690_10121727
589 Ga0207661_10430947
590 Ga0207667_10005073
591 Ga0207640_10077605
592 Ga0207678_10033101
593 Ga0207678_10046536
594 Ga0207702_10006955
595 Ga0207702_10009280
596 Ga0207648_10637572
597 Ga0207674_10045110
598 Ga0207674_10122080
599 Ga0207674_10564116
600 Ga0209999_1057061
601 Ga0209983_1112379
602 Ga0209998_10110610
603 Ga0207428_10059691
604 Ga0307515_10000643
605 Ga0307515_10014538
606 Ga0307515_10024651
607 Ga0307515_10170593
608 Ga0316181_1195168
609 Ga0307513_10354762
610 Ga0307513_10838271
611 Ga0307408_102018393
612 Ga0307516_10647421
613 Ga0307405_10000006
614 Ga0307405_11120188
615 Ga0307405_11775149
616 Ga0307413_12047960
617 Ga0307407_10000003
618 Ga0307412_10000085
619 Ga0307412_10923470
620 Ga0307409_100064605
621 Ga0307416_100000819
622 Ga0307414_10000078
623 Ga0307414_10000510
624 Ga0307414_10001132
625 Ga0307414_10001429
626 Ga0307414_10101762
627 Ga0307414_10385866
628 Ga0307414_10980520
629 Ga0307414_11186960
630 Ga0307411_10436206
631 Ga0307411_10767278
632 Ga0307507_10014221
633 Ga0373935_0761895
634 Ga0395899_0004023
635 Ga0395899_0053655
636 Ga0395900_0034150
637 Ga0395900_0810949
638 Ga0395900_1838074
639 Ga0395898_0005541
640 Ga0395898_0045346
641 Ga0395905_0185335
642 Ga0395901_0646589
643 Ga0395901_0828475
644 Ga0451791_0163352
645 Ga0451791_0631398
646 Ga0451793_0371445
647 Ga0451795_0879970
648 Ga0451849_0188467
649 Ga0439445_0144618
650 Ga0450923_114421
651 Ga0495627_051499
652 Ga0495627_138059
653 Ga0495592_0205659
654 Ga0495629_0086686
655 Ga0495638_0157949
656 Ga0495638_0577163
657 Ga0495651_0224811
658 Ga0495650_0000225
659 Ga0495650_0075761
660 Ga0495585_0000074
661 Ga0495585_0000323
662 Ga0495585_0157516
663 Ga0495583_0035693
664 Ga0495583_0167281
665 Ga0495606_0000074
666 Ga0495606_0033701
667 Ga0495606_0051265
668 Ga0495606_0053134
669 Ga0495606_0346763
670 Ga0495606_0377721
671 Ga0495610_0000188
672 Ga0495610_0000499
673 Ga0495610_0022856
674 Ga0495616_0000806
675 Ga0495616_0002088
676 Ga0495628_0411986
677 Ga0495648_0006718
678 Ga0495652_0261593
679 Ga0495609_0008096
680 Ga0495609_0367011
681 Ga0495633_0000006
682 Ga0495633_0005434
683 Ga0495633_0087440
684 Ga0495668_0000011
685 Ga0495625_0000067
686 Ga0495625_0000462
687 Ga0495625_0000486
688 Ga0495625_0007386
689 Ga0495625_0028648
690 Ga0495625_0410232
691 Ga0495661_0001183
692 Ga0495661_0108754
693 Ga0495661_0157013
694 Ga0495658_0126432
695 Ga0495671_0116509
696 Ga0495649_0000054
697 Ga0495660_0002682
698 Ga0495687_001083
699 Ga0495679_047885
700 Ga0495673_0163694
701 Ga0495681_0049902
702 Ga0495686_0001571
703 Ga0495686_0004631
704 Ga0495686_0035242
705 Ga0495614_0152461
706 Ga0496114_0373770
707 Ga0496115_0192481
708 Ga0496122_0000837
709 Ga0496123_0006634
710 Ga0496125_0278886
711 Ga0496125_0579323
712 Ga0495678_008557
713 Ga0495682_0019380
714 Ga0501257_160679
715 Ga0501241_004551
716 Ga0501241_006587
717 nmdc:mga0k408_14434_c1
718 nmdc:mga0k408_22_c2
719 nmdc:mga0qj67_959813_c1
720 nmdc:mga08y16_7679_c1
721 Ga0500635_0000482
722 Ga0500583_0093764
723 Ga0500651_0000312
724 Ga0500562_007087
725 Ga0500614_007798
726 Ga0500618_000148
727 Ga0500618_011470
728 Ga0500561_0048854
729 Ga0500564_111404
730 Ga0500568_0141927
731 Ga0500588_0336892
732 Ga0500604_0000119
733 Ga0500616_0027585
734 Ga0500622_0000075
735 Ga0500622_0000435
736 Ga0500622_0000891
737 Ga0500622_0047249
738 Ga0500624_000813
739 Ga0500627_0051744
740 Ga0500634_0220369
741 Ga0587072_080485
742 2586210619
743 2599479988
744 2738758882
745 2738762028
746 2738854357
747 2739301997
748 2739587897
749 2739617466
750 2776615327
751 2819545783
752 2842724327
753 2842913538
754 2849282650
755 2852625715
756 2852628953
757 2857630405
758 2904448455
759 2919189004
760 2919440169
761 2928081119
762 2928152460
763 2932087769
764 2939666841
765 2945998838
766 2954021286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11009

BrxC

Monothiol bacilliredoxin BrxC

5

119

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iv4-assembly1.cif.gz_A a putative oxidoreductase with a thioredoxin fold 0.8786 5 106
2oe3-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8144 3 109
4dss-assembly1.cif.gz_B crystal structure of peroxiredoxin ahp1 from saccharomyces cerevisiae in complex with thioredoxin trx2 0.8102 2 109
5ykw-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.8058 3 109
2voc-assembly1.cif.gz_A thioredoxin a active site mutants form mixed disulfide dimers that resemble enzyme-substrate reaction intermediate 0.8043 2 109
ID Description Score Start End Superfamily
af_Q2G066_1_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8923 2 106 3.40.30.10
af_Q2G066_1_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8615 2 106 3.40.30.10
3ul3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8295 20 109 3.40.30.10
af_Q2FV89_2_105_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8269 4 109 3.40.30.10
af_A0A0R0K134_277_390_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8186 10 109 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1I0TG39-F1-model_v4 Bacillithiol system protein YtxJ 0.993 1 110
AF-A0A2A2S0J8-F1-model_v4 Thioredoxin family protein 0.9877 1 108
AF-A0A1I0TG39-F1-model_v4 Bacillithiol system protein YtxJ 0.984 1 110
AF-A0A2T5J4S9-F1-model_v4 Bacillithiol system protein YtxJ 0.9822 1 108
AF-A0A2A2S0J8-F1-model_v4 Thioredoxin family protein 0.9699 1 108

Map