F429563

General Info

Members Datasets Scaffolds Average Seq Length
383 230 766 473

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10008373|Ga0105240_1000837312
Length 537
Sequence VLRPFRLRTFALSSRSSKTWSPRSHAKWPFCTKADFATLDIVANPRHAPSFSPYPESIVKLLSALSLTAVSVFALGAAHAAETRIPDAAVRAAEQLRDRAMNDDTAYKFVEGLTTEVGPRLAAGDNDAKSREWVIAKFKALGFDKVYEEPVSYPKWVRRHEAGAIVAPFAQNLVLAALGHSFPTPAGGLTAEVVRFENLDALKAADPAKVKGKIVYIGFKMQPHKDGHDYGTGSSIRVGGPPLAASKGAAAFLLRSAGTDAKDRMAHTGATGFADAKANGIPAAALSNPDADQLERVLAHGKPVTLKLDLDVGFDGDYTGANVIGEVTGKKHPDQIIDIGGHLDSWDPGTGAIDDAAGVAIAAAAAHLVKQMPQRPDRTIRVIAFANEEAGLYGGKAYAEKHAAEVAKHVLGTESDFGAGPIWRMSASVKPEARAAIAQIAAVLKPIGVDYDDKKPGGGGSDLSQMHAKGMAALTLLQDGTHYFDIHHTANDTLDKIDPKELAQNVAVYATWTYLAAQAEGDFGSAPGAFAKDNGEE

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
159 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
160 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
161 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
162 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
219 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
226 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
227 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
228 2919513703 Luteimonas sp. 3794 Isolate Unclassified
229 2919675420 Luteimonas terrae 4099 Isolate Unclassified
230 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0.26
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.92
Nodule 0
Rhizoplane 4.18
Rhizosphere 87.21
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10008373 3300009093 Bacteria 14800
2 JGI24740J21852_10003893 3300001979 Bacteria 6481
3 JGI24740J21852_10005928 3300001979 Bacteria 5119
4 JGI24737J22298_10007427 3300001990 Bacteria 3701
5 JGI24738J21930_10000118 3300002075 Bacteria 18730
6 JGI25162J39368_1000360 3300002737 Bacteria 38829
7 rootL2_10144909 3300003322 Bacteria 8766
8 Ga0065165_1000913 3300005262 Bacteria 38106
9 Ga0065714_10014670 3300005288 Bacteria 2936
10 Ga0065715_10000370 3300005293 Bacteria 13372
11 Ga0065715_10004139 3300005293 Bacteria 4364
12 Ga0070676_10005808 3300005328 Bacteria 6579
13 Ga0070676_10009336 3300005328 Bacteria 5305
14 Ga0070683_100037011 3300005329 Bacteria 4465
15 Ga0070670_100001146 3300005331 Bacteria 21026
16 Ga0070670_100001912 3300005331 Bacteria 17058
17 Ga0070670_100017386 3300005331 Bacteria 6169
18 Ga0070670_100048114 3300005331 Bacteria 3669
19 Ga0070677_10000430 3300005333 Bacteria 14476
20 Ga0068869_100018323 3300005334 Bacteria 4764
21 Ga0070666_10000023 3300005335 Bacteria 161603
22 Ga0070666_10001153 3300005335 Bacteria 16042
23 Ga0070666_10062912 3300005335 Bacteria 2515
24 Ga0070680_100133330 3300005336 Bacteria 2079
25 Ga0070682_100055174 3300005337 Bacteria 2495
26 Ga0068868_100034060 3300005338 Bacteria 3930
27 Ga0068868_100055590 3300005338 Bacteria 3123
28 Ga0070691_10000860 3300005341 Bacteria 12285
29 Ga0070668_100000010 3300005347 Bacteria 132833
30 Ga0070668_100004333 3300005347 Bacteria 10526
31 Ga0070668_100055291 3300005347 Bacteria 3063
32 Ga0070669_100008737 3300005353 Bacteria 7227
33 Ga0070669_100017171 3300005353 Bacteria 5164
34 Ga0070675_100002570 3300005354 Bacteria 13593
35 Ga0070671_100084080 3300005355 Bacteria 2661
36 Ga0070671_100167791 3300005355 Bacteria 1856
37 Ga0070674_100024727 3300005356 Bacteria 3901
38 Ga0070673_100109910 3300005364 Bacteria 2285
39 Ga0070659_100027120 3300005366 Bacteria 4410
40 Ga0070667_100002680 3300005367 Bacteria 15408
41 Ga0070667_100003453 3300005367 Bacteria 13463
42 Ga0070667_100078353 3300005367 Bacteria 2823
43 Ga0070667_100168875 3300005367 Bacteria 1930
44 Ga0070711_100000213 3300005439 Bacteria 30586
45 Ga0070694_100103767 3300005444 Bacteria 2015
46 Ga0070708_100009847 3300005445 Bacteria 7720
47 Ga0070663_100012612 3300005455 Bacteria 5356
48 Ga0070663_100101179 3300005455 Bacteria 2150
49 Ga0070678_100018052 3300005456 Bacteria 4562
50 Ga0070678_100063676 3300005456 Bacteria 2729
51 Ga0070662_100001494 3300005457 Bacteria 14387
52 Ga0070662_100001779 3300005457 Bacteria 13271
53 Ga0068867_100016022 3300005459 Bacteria 5322
54 Ga0068867_100081008 3300005459 Bacteria 2446
55 Ga0070685_10000386 3300005466 Bacteria 26505
56 Ga0070699_100124316 3300005518 Unclassified 2270
57 Ga0070679_100091109 3300005530 Bacteria 3037
58 Ga0070684_100005253 3300005535 Bacteria 9910
59 Ga0070697_100004946 3300005536 Bacteria 10229
60 Ga0068853_100001040 3300005539 Bacteria 19607
61 Ga0068853_100001130 3300005539 Bacteria 18915
62 Ga0068853_100006884 3300005539 Bacteria 9074
63 Ga0068853_100070566 3300005539 Bacteria 3041
64 Ga0070672_100001865 3300005543 Bacteria 13165
65 Ga0070672_100039343 3300005543 Bacteria 3622
66 Ga0070696_100038203 3300005546 Bacteria 3313
67 Ga0070665_100000242 3300005548 Bacteria 90566
68 Ga0070665_100003754 3300005548 Bacteria 16079
69 Ga0070665_100022204 3300005548 Bacteria 6384
70 Ga0070665_100079322 3300005548 Bacteria 3289
71 Ga0070665_100097206 3300005548 Bacteria 2949
72 Ga0070665_100256850 3300005548 Bacteria 1748
73 Ga0068855_100009258 3300005563 Bacteria 11899
74 Ga0068855_100038563 3300005563 Bacteria 5677
75 Ga0068855_100064659 3300005563 Bacteria 4266
76 Ga0068855_100147065 3300005563 Bacteria 2682
77 Ga0070664_100038681 3300005564 Bacteria 4017
78 Ga0070664_100058591 3300005564 Bacteria 3276
79 Ga0068857_100065328 3300005577 Bacteria 3235
80 Ga0068854_100004796 3300005578 Bacteria 8531
81 Ga0068856_100040668 3300005614 Bacteria 4567
82 Ga0068856_100086037 3300005614 Bacteria 3123
83 Ga0068859_100008008 3300005617 Bacteria 10714
84 Ga0068859_100220755 3300005617 Bacteria 1983
85 Ga0068859_100245019 3300005617 Bacteria 1882
86 Ga0068864_100129247 3300005618 Bacteria 2267
87 Ga0068851_10095164 3300005834 Bacteria 1573
88 Ga0068863_100000192 3300005841 Bacteria 64858
89 Ga0068863_100007347 3300005841 Bacteria 10785
90 Ga0068858_100016875 3300005842 Bacteria 6856
91 Ga0068860_100079992 3300005843 Bacteria 3108
92 Ga0068860_100193439 3300005843 Bacteria 1969
93 Ga0081540_1012187 3300005983 Bacteria 5685
94 Ga0070716_100072907 3300006173 Bacteria 2024
95 Ga0070712_100002507 3300006175 Bacteria 11321
96 Ga0075366_10094111 3300006195 Bacteria 1796
97 Ga0068871_100021042 3300006358 Bacteria 5007
98 Ga0075431_100043025 3300006847 Bacteria 4660
99 Ga0075429_100031963 3300006880 Bacteria 4576
100 Ga0097620_100008008 3300006931 Bacteria 10714
101 Ga0097620_100245016 3300006931 Bacteria 1882
102 Ga0105240_10000453 3300009093 Bacteria 75454
103 Ga0105240_10000868 3300009093 Bacteria 54479
104 Ga0105240_10094462 3300009093 Bacteria 3647
105 Ga0105240_10201786 3300009093 Bacteria 2330
106 Ga0111539_10014598 3300009094 Bacteria 9804
107 Ga0105247_10016742 3300009101 Bacteria 4396
108 Ga0105243_10005369 3300009148 Bacteria 9999
109 Ga0105241_10076177 3300009174 Bacteria 2615
110 Ga0105241_10102872 3300009174 Bacteria 2274
111 Ga0105248_10105742 3300009177 Bacteria 3173
112 Ga0105237_10000036 3300009545 Bacteria 191142
113 Ga0105237_10065777 3300009545 Bacteria 3620
114 Ga0105237_10121489 3300009545 Bacteria 2606
115 Ga0105238_10008158 3300009551 Bacteria 10475
116 Ga0105238_10057826 3300009551 Bacteria 3887
117 Ga0105238_10094149 3300009551 Bacteria 2983
118 Ga0105238_10144654 3300009551 Bacteria 2354
119 Ga0105249_10036784 3300009553 Bacteria 4441
120 Ga0105249_10041721 3300009553 Bacteria 4172
121 Ga0105249_10045606 3300009553 Bacteria 3988
122 Ga0105239_10009641 3300010375 Bacteria 10860
123 Ga0105239_10077799 3300010375 Bacteria 3651
124 Ga0157371_10009125 3300013102 Bacteria 7834
125 Ga0157371_10058202 3300013102 Bacteria 2741
126 Ga0157370_10093305 3300013104 Bacteria 2825
127 Ga0157369_10002396 3300013105 Bacteria 22523
128 Ga0157369_10087659 3300013105 Bacteria 3323
129 Ga0157374_10015323 3300013296 Bacteria 6724
130 Ga0157374_10020266 3300013296 Bacteria 5899
131 Ga0157374_10087489 3300013296 Bacteria 2966
132 Ga0163162_10000042 3300013306 Bacteria 131540
133 Ga0163162_10000661 3300013306 Bacteria 31916
134 Ga0163162_10032532 3300013306 Bacteria 5181
135 Ga0163162_10167465 3300013306 Bacteria 2321
136 Ga0163162_10177319 3300013306 Bacteria 2257
137 Ga0157372_10011769 3300013307 Bacteria 9318
138 Ga0157372_10364097 3300013307 Bacteria 1685
139 Ga0157375_10024351 3300013308 Bacteria 5601
140 Ga0157375_10025199 3300013308 Bacteria 5521
141 Ga0157380_10001232 3300014326 Bacteria 16609
142 Ga0157379_10015473 3300014968 Bacteria 6695
143 Ga0157379_10049278 3300014968 Bacteria 3760
144 Ga0157379_10198035 3300014968 Unclassified 1816
145 Ga0163161_10014477 3300017792 Bacteria 5492
146 Ga0163161_10022306 3300017792 Bacteria 4457
147 Ga0163161_10066669 3300017792 Bacteria 2629
148 Ga0206356_11030950 3300020070 Bacteria 3035
149 Ga0209674_100556 3300025226 Bacteria 14827
150 Ga0209148_1002007 3300025254 Bacteria 7975
151 Ga0209759_1002084 3300025256 Bacteria 9331
152 Ga0209129_1000697 3300025258 Bacteria 22024
153 Ga0209233_1001897 3300025261 Bacteria 8020
154 Ga0209051_1018017 3300025303 Bacteria 3139
155 Ga0209257_1022237 3300025304 Bacteria 2269
156 Ga0207697_10003482 3300025315 Bacteria 7770
157 Ga0207682_10001260 3300025893 Bacteria 11713
158 Ga0207642_10007350 3300025899 Bacteria 3716
159 Ga0207688_10009238 3300025901 Bacteria 5373
160 Ga0207680_10002268 3300025903 Bacteria 8961
161 Ga0207680_10064873 3300025903 Bacteria 2240
162 Ga0207647_10000066 3300025904 Bacteria 81782
163 Ga0207645_10006206 3300025907 Bacteria 8586
164 Ga0207645_10018285 3300025907 Bacteria 4615
165 Ga0207684_10004327 3300025910 Bacteria 13426
166 Ga0207654_10073662 3300025911 Bacteria 2036
167 Ga0207695_10000172 3300025913 Bacteria 190573
168 Ga0207695_10012023 3300025913 Bacteria 10412
169 Ga0207695_10023972 3300025913 Bacteria 6881
170 Ga0207695_10031281 3300025913 Bacteria 5840
171 Ga0207671_10001404 3300025914 Bacteria 28043
172 Ga0207693_10004449 3300025915 Bacteria 11843
173 Ga0207663_10006575 3300025916 Bacteria 5966
174 Ga0207660_10052124 3300025917 Bacteria 2912
175 Ga0207657_10005336 3300025919 Bacteria 13464
176 Ga0207657_10005796 3300025919 Bacteria 12870
177 Ga0207657_10012306 3300025919 Bacteria 8455
178 Ga0207649_10012580 3300025920 Bacteria 4699
179 Ga0207652_10018199 3300025921 Bacteria 5759
180 Ga0207652_10222339 3300025921 Bacteria 1701
181 Ga0207681_10000980 3300025923 Bacteria 18650
182 Ga0207681_10033357 3300025923 Bacteria 3375
183 Ga0207681_10061958 3300025923 Bacteria 2574
184 Ga0207694_10000308 3300025924 Bacteria 45953
185 Ga0207650_10000537 3300025925 Bacteria 30997
186 Ga0207650_10002481 3300025925 Bacteria 12831
187 Ga0207650_10006496 3300025925 Bacteria 7969
188 Ga0207687_10000509 3300025927 Bacteria 26200
189 Ga0207644_10156670 3300025931 Bacteria 1767
190 Ga0207690_10007160 3300025932 Bacteria 6627
191 Ga0207690_10019418 3300025932 Bacteria 4184
192 Ga0207706_10000415 3300025933 Bacteria 45662
193 Ga0207706_10003438 3300025933 Bacteria 15120
194 Ga0207686_10117624 3300025934 Bacteria 1804
195 Ga0207704_10058351 3300025938 Bacteria 2376
196 Ga0207691_10006421 3300025940 Bacteria 11361
197 Ga0207711_10000892 3300025941 Bacteria 28721
198 Ga0207689_10025732 3300025942 Bacteria 4930
199 Ga0207689_10166786 3300025942 Bacteria 1815
200 Ga0207661_10007878 3300025944 Bacteria 7591
201 Ga0207661_10012276 3300025944 Bacteria 6221
202 Ga0207667_10009556 3300025949 Bacteria 11412
203 Ga0207667_10012830 3300025949 Bacteria 9629
204 Ga0207667_10177398 3300025949 Bacteria 2189
205 Ga0207651_10004533 3300025960 Bacteria 7021
206 Ga0207712_10000589 3300025961 Bacteria 29134
207 Ga0207712_10008952 3300025961 Bacteria 6331
208 Ga0207712_10026173 3300025961 Bacteria 3884
209 Ga0207668_10000020 3300025972 Bacteria 140737
210 Ga0207668_10001025 3300025972 Bacteria 16716
211 Ga0207668_10029007 3300025972 Bacteria 3624
212 Ga0207668_10094294 3300025972 Bacteria 2207
213 Ga0207640_10060496 3300025981 Bacteria 2504
214 Ga0207658_10029760 3300025986 Bacteria 3860
215 Ga0207677_10081819 3300026023 Bacteria 2319
216 Ga0207703_10004533 3300026035 Bacteria 11391
217 Ga0207639_10001429 3300026041 Bacteria 16142
218 Ga0207639_10028578 3300026041 Bacteria 4073
219 Ga0207639_10042503 3300026041 Bacteria 3406
220 Ga0207639_10050016 3300026041 Bacteria 3172
221 Ga0207639_10056004 3300026041 Bacteria 3020
222 Ga0207678_10000577 3300026067 Bacteria 33572
223 Ga0207678_10000605 3300026067 Bacteria 32938
224 Ga0207678_10055150 3300026067 Bacteria 3423
225 Ga0207678_10069017 3300026067 Bacteria 3031
226 Ga0207702_10006322 3300026078 Bacteria 10234
227 Ga0207702_10042381 3300026078 Bacteria 3818
228 Ga0207641_10000074 3300026088 Bacteria 145908
229 Ga0207648_10018259 3300026089 Bacteria 6353
230 Ga0207648_10039257 3300026089 Bacteria 4163
231 Ga0207674_10001374 3300026116 Bacteria 31441
232 Ga0207674_10047073 3300026116 Bacteria 4424
233 Ga0207674_10068142 3300026116 Bacteria 3581
234 Ga0207674_10113220 3300026116 Bacteria 2686
235 Ga0207674_10132842 3300026116 Bacteria 2452
236 Ga0207674_10147057 3300026116 Bacteria 2315
237 Ga0207674_10178213 3300026116 Bacteria 2077
238 Ga0207675_100005627 3300026118 Bacteria 11998
239 Ga0207683_10015266 3300026121 Bacteria 6537
240 Ga0207683_10123231 3300026121 Bacteria 2328
241 Ga0209983_1002121 3300027665 Bacteria 4372
242 Ga0209974_10008722 3300027876 Bacteria 3455
243 Ga0268266_10000008 3300028379 Bacteria 1161875
244 Ga0268266_10013106 3300028379 Bacteria 7149
245 Ga0268265_10003381 3300028380 Bacteria 11486
246 Ga0268265_10162732 3300028380 Bacteria 1898
247 Ga0307517_10115437 3300028786 Bacteria 2015
248 Ga0265316_10000552 3300031344 Bacteria 42074
249 Ga0307408_100160178 3300031548 Bacteria 1787
250 Ga0307508_10036161 3300031616 Bacteria 4447
251 Ga0265314_10001011 3300031711 Bacteria 32906
252 Ga0307516_10001780 3300031730 Bacteria 29615
253 Ga0307410_10003696 3300031852 Bacteria 7738
254 Ga0307412_10041496 3300031911 Bacteria 2983
255 Ga0307409_100126573 3300031995 Bacteria 2174
256 Ga0307414_10000640 3300032004 Bacteria 17949
257 Ga0307415_100014957 3300032126 Bacteria 4580
258 Ga0373928_0006120 3300035084 Bacteria 2310
259 Ga0373927_0178357 3300035695 Bacteria 1393
260 Ga0373937_0001423 3300036401 Bacteria 19994
261 Ga0395900_0030887 3300037418 Bacteria 5502
262 Ga0395900_0068191 3300037418 Bacteria 3655
263 Ga0395900_0108495 3300037418 Bacteria 2852
264 Ga0395900_0200432 3300037418 Bacteria 2020
265 Ga0395898_0029476 3300037466 Bacteria 5497
266 Ga0395905_0001986 3300037471 Bacteria 23373
267 Ga0395905_0051408 3300037471 Bacteria 3860
268 Ga0395905_0067884 3300037471 Bacteria 3340
269 Ga0395905_0113384 3300037471 Bacteria 2547
270 Ga0395905_0242233 3300037471 Bacteria 1685
271 Ga0395905_0268583 3300037471 Bacteria 1591
272 Ga0395901_0016958 3300038443 Bacteria 7423
273 Ga0451793_1028672 3300041452 Bacteria 4983
274 Ga0451807_0280975 3300041486 Bacteria 2447
275 Ga0451837_1074998 3300041494 Bacteria 4363
276 Ga0439445_0000425 3300042004 Bacteria 8490
277 Ga0439440_0003042 3300042993 Bacteria 3199
278 Ga0466972_0018052 3300044658 Bacteria 3528
279 Ga0466972_0018289 3300044658 Bacteria 3502
280 Ga0466961_0048928 3300044693 Bacteria 2702
281 Ga0466963_0022243 3300044694 Bacteria 4013
282 Ga0466963_0030922 3300044694 Bacteria 3458
283 Ga0466970_0042490 3300044765 Bacteria 2418
284 Ga0466970_0066462 3300044765 Bacteria 1935
285 Ga0466958_0016285 3300045836 Bacteria 4278
286 Ga0466958_0021438 3300045836 Bacteria 3776
287 Ga0466958_0051702 3300045836 Bacteria 2488
288 Ga0466967_0098032 3300045976 Bacteria 2676
289 Ga0466967_0167175 3300045976 Bacteria 2067
290 Ga0495638_0000071 3300046460 Bacteria 166300
291 Ga0495638_0023689 3300046460 Bacteria 4011
292 Ga0495650_0001249 3300046471 Bacteria 26263
293 Ga0495580_0010286 3300046472 Bacteria 7297
294 Ga0495606_0008027 3300046507 Bacteria 9269
295 Ga0495616_0000128 3300046513 Bacteria 66249
296 Ga0495632_0033484 3300046519 Bacteria 2638
297 Ga0495621_0012646 3300046539 Bacteria 2634
298 Ga0495621_0013094 3300046539 Bacteria 2601
299 Ga0496100_0081862 3300048903 Unclassified 2182
300 Ga0496101_0064720 3300048904 Bacteria 2664
301 Ga0496101_0239423 3300048904 Bacteria 1412
302 Ga0496102_0079320 3300048905 Bacteria 3023
303 Ga0496103_0003328 3300048906 Bacteria 9832
304 Ga0496103_0059374 3300048906 Bacteria 2376
305 Ga0496104_0024451 3300048907 Bacteria 5555
306 Ga0496106_0067254 3300048909 Bacteria 2731
307 Ga0496108_0096433 3300048911 Bacteria 2519
308 Ga0496108_0103696 3300048911 Bacteria 2427
309 Ga0496110_0099774 3300048913 Bacteria 2603
310 Ga0496112_0040575 3300048915 Bacteria 4551
311 Ga0496113_0053256 3300048916 Bacteria 3025
312 Ga0496114_0179798 3300048917 Bacteria 1847
313 Ga0496118_0006022 3300048921 Bacteria 13511
314 Ga0496121_0047767 3300048924 Bacteria 3648
315 Ga0496122_0004243 3300048925 Bacteria 17977
316 Ga0496123_0002066 3300048926 Bacteria 25899
317 Ga0496124_0000052 3300048927 Bacteria 252750
318 Ga0496124_0018373 3300048927 Bacteria 6549
319 Ga0501032_0002036 3300049569 Bacteria 15952
320 Ga0501032_0003170 3300049569 Bacteria 12659
321 Ga0501032_0033949 3300049569 Bacteria 3494
322 Ga0501033_0003002 3300049570 Bacteria 14086
323 Ga0501033_0003081 3300049570 Bacteria 13854
324 Ga0501034_0001904 3300049571 Bacteria 26429
325 Ga0501034_0051510 3300049571 Bacteria 4150
326 Ga0501034_0055913 3300049571 Bacteria 3971
327 Ga0501034_0108331 3300049571 Bacteria 2769
328 Ga0501036_0052580 3300049572 Bacteria 3449
329 Ga0501036_0053627 3300049572 Bacteria 3414
330 Ga0501037_0000948 3300049573 Bacteria 21559
331 Ga0501037_0102156 3300049573 Bacteria 2068
332 Ga0501038_0000712 3300049574 Bacteria 29729
333 Ga0501038_0004188 3300049574 Bacteria 13395
334 Ga0501038_0065003 3300049574 Bacteria 3109
335 Ga0501039_0007044 3300049575 Bacteria 8558
336 Ga0501039_0032571 3300049575 Bacteria 4019
337 Ga0501039_0102966 3300049575 Bacteria 2228
338 Ga0501039_0115009 3300049575 Bacteria 2105
339 Ga0501040_0013160 3300049576 Bacteria 5441
340 Ga0501042_0037745 3300049578 Bacteria 3429
341 Ga0501043_0005297 3300049579 Bacteria 10428
342 Ga0501043_0032363 3300049579 Bacteria 4111
343 Ga0501046_0013710 3300049580 Bacteria 6854
344 Ga0501046_0028083 3300049580 Bacteria 4584
345 Ga0501047_0020575 3300049581 Bacteria 6336
346 Ga0501047_0036088 3300049581 Bacteria 4776
347 Ga0501047_0082309 3300049581 Bacteria 3094
348 Ga0501047_0131717 3300049581 Bacteria 2380
349 Ga0501048_0026548 3300049582 Bacteria 4216
350 Ga0501067_0026748 3300049583 Bacteria 3194
351 Ga0501069_0029897 3300049585 Bacteria 2990
352 Ga0501070_0008039 3300049586 Bacteria 8930
353 Ga0501070_0008908 3300049586 Bacteria 8483
354 Ga0501070_0056768 3300049586 Bacteria 3245
355 Ga0501070_0096593 3300049586 Bacteria 2444
356 Ga0501071_0004988 3300049587 Bacteria 8483
357 Ga0501071_0099729 3300049587 Bacteria 2140
358 Ga0501072_0048687 3300049588 Bacteria 3337
359 Ga0501073_0001226 3300049589 Bacteria 18704
360 Ga0501073_0029761 3300049589 Bacteria 3903
361 Ga0501074_0009561 3300049590 Bacteria 7039
362 Ga0501080_0013444 3300049742 Bacteria 7530
363 Ga0501080_0045549 3300049742 Bacteria 4083
364 Ga0501035_0001396 3300049822 Bacteria 24796
365 Ga0501035_0058247 3300049822 Bacteria 3443
366 Ga0501044_0078413 3300049823 Bacteria 3347
367 nmdc:mga00v17_118180_c1 3300050491 Bacteria 1687
368 nmdc:mga06r32_3606_c1 3300050510 Bacteria 13817
369 nmdc:mga08y16_30716_c1 3300050511 Bacteria 5650
370 Ga0500610_0011011 3300053079 Bacteria 4098
371 Ga0500651_0014757 3300053093 Bacteria 4783
372 Ga0500616_0000073 3300053153 Bacteria 231290
373 Ga0500616_0007454 3300053153 Bacteria 6948
374 Ga0500622_0003525 3300053156 Bacteria 10378
375 Ga0501084_0012807 3300054114 Bacteria 6948
376 Ga0501082_0018364 3300060353 Bacteria 6022
377 Ga0466962_0001188 3300061719 Bacteria 12013
378 2595447733 2593339238 Bacteria 4182970
379 2819566284 2818991440 Bacteria 4774720
380 2904466560 2904463128 Bacteria 4775606
381 2919515433 2919513703 Bacteria 3844312
382 2919675814 2919675420 Bacteria 3969095
383 8002871140 8002869464 Bacteria 3588529
384 Ga0105240_10008373
385 JGI24740J21852_10003893
386 JGI24740J21852_10005928
387 JGI24737J22298_10007427
388 JGI24738J21930_10000118
389 JGI25162J39368_1000360
390 rootL2_10144909
391 Ga0065165_1000913
392 Ga0065714_10014670
393 Ga0065715_10000370
394 Ga0065715_10004139
395 Ga0070676_10005808
396 Ga0070676_10009336
397 Ga0070683_100037011
398 Ga0070670_100001146
399 Ga0070670_100001912
400 Ga0070670_100017386
401 Ga0070670_100048114
402 Ga0070677_10000430
403 Ga0068869_100018323
404 Ga0070666_10000023
405 Ga0070666_10001153
406 Ga0070666_10062912
407 Ga0070680_100133330
408 Ga0070682_100055174
409 Ga0068868_100034060
410 Ga0068868_100055590
411 Ga0070691_10000860
412 Ga0070668_100000010
413 Ga0070668_100004333
414 Ga0070668_100055291
415 Ga0070669_100008737
416 Ga0070669_100017171
417 Ga0070675_100002570
418 Ga0070671_100084080
419 Ga0070671_100167791
420 Ga0070674_100024727
421 Ga0070673_100109910
422 Ga0070659_100027120
423 Ga0070667_100002680
424 Ga0070667_100003453
425 Ga0070667_100078353
426 Ga0070667_100168875
427 Ga0070711_100000213
428 Ga0070694_100103767
429 Ga0070708_100009847
430 Ga0070663_100012612
431 Ga0070663_100101179
432 Ga0070678_100018052
433 Ga0070678_100063676
434 Ga0070662_100001494
435 Ga0070662_100001779
436 Ga0068867_100016022
437 Ga0068867_100081008
438 Ga0070685_10000386
439 Ga0070699_100124316
440 Ga0070679_100091109
441 Ga0070684_100005253
442 Ga0070697_100004946
443 Ga0068853_100001040
444 Ga0068853_100001130
445 Ga0068853_100006884
446 Ga0068853_100070566
447 Ga0070672_100001865
448 Ga0070672_100039343
449 Ga0070696_100038203
450 Ga0070665_100000242
451 Ga0070665_100003754
452 Ga0070665_100022204
453 Ga0070665_100079322
454 Ga0070665_100097206
455 Ga0070665_100256850
456 Ga0068855_100009258
457 Ga0068855_100038563
458 Ga0068855_100064659
459 Ga0068855_100147065
460 Ga0070664_100038681
461 Ga0070664_100058591
462 Ga0068857_100065328
463 Ga0068854_100004796
464 Ga0068856_100040668
465 Ga0068856_100086037
466 Ga0068859_100008008
467 Ga0068859_100220755
468 Ga0068859_100245019
469 Ga0068864_100129247
470 Ga0068851_10095164
471 Ga0068863_100000192
472 Ga0068863_100007347
473 Ga0068858_100016875
474 Ga0068860_100079992
475 Ga0068860_100193439
476 Ga0081540_1012187
477 Ga0070716_100072907
478 Ga0070712_100002507
479 Ga0075366_10094111
480 Ga0068871_100021042
481 Ga0075431_100043025
482 Ga0075429_100031963
483 Ga0097620_100008008
484 Ga0097620_100245016
485 Ga0105240_10000453
486 Ga0105240_10000868
487 Ga0105240_10094462
488 Ga0105240_10201786
489 Ga0111539_10014598
490 Ga0105247_10016742
491 Ga0105243_10005369
492 Ga0105241_10076177
493 Ga0105241_10102872
494 Ga0105248_10105742
495 Ga0105237_10000036
496 Ga0105237_10065777
497 Ga0105237_10121489
498 Ga0105238_10008158
499 Ga0105238_10057826
500 Ga0105238_10094149
501 Ga0105238_10144654
502 Ga0105249_10036784
503 Ga0105249_10041721
504 Ga0105249_10045606
505 Ga0105239_10009641
506 Ga0105239_10077799
507 Ga0157371_10009125
508 Ga0157371_10058202
509 Ga0157370_10093305
510 Ga0157369_10002396
511 Ga0157369_10087659
512 Ga0157374_10015323
513 Ga0157374_10020266
514 Ga0157374_10087489
515 Ga0163162_10000042
516 Ga0163162_10000661
517 Ga0163162_10032532
518 Ga0163162_10167465
519 Ga0163162_10177319
520 Ga0157372_10011769
521 Ga0157372_10364097
522 Ga0157375_10024351
523 Ga0157375_10025199
524 Ga0157380_10001232
525 Ga0157379_10015473
526 Ga0157379_10049278
527 Ga0157379_10198035
528 Ga0163161_10014477
529 Ga0163161_10022306
530 Ga0163161_10066669
531 Ga0206356_11030950
532 Ga0209674_100556
533 Ga0209148_1002007
534 Ga0209759_1002084
535 Ga0209129_1000697
536 Ga0209233_1001897
537 Ga0209051_1018017
538 Ga0209257_1022237
539 Ga0207697_10003482
540 Ga0207682_10001260
541 Ga0207642_10007350
542 Ga0207688_10009238
543 Ga0207680_10002268
544 Ga0207680_10064873
545 Ga0207647_10000066
546 Ga0207645_10006206
547 Ga0207645_10018285
548 Ga0207684_10004327
549 Ga0207654_10073662
550 Ga0207695_10000172
551 Ga0207695_10012023
552 Ga0207695_10023972
553 Ga0207695_10031281
554 Ga0207671_10001404
555 Ga0207693_10004449
556 Ga0207663_10006575
557 Ga0207660_10052124
558 Ga0207657_10005336
559 Ga0207657_10005796
560 Ga0207657_10012306
561 Ga0207649_10012580
562 Ga0207652_10018199
563 Ga0207652_10222339
564 Ga0207681_10000980
565 Ga0207681_10033357
566 Ga0207681_10061958
567 Ga0207694_10000308
568 Ga0207650_10000537
569 Ga0207650_10002481
570 Ga0207650_10006496
571 Ga0207687_10000509
572 Ga0207644_10156670
573 Ga0207690_10007160
574 Ga0207690_10019418
575 Ga0207706_10000415
576 Ga0207706_10003438
577 Ga0207686_10117624
578 Ga0207704_10058351
579 Ga0207691_10006421
580 Ga0207711_10000892
581 Ga0207689_10025732
582 Ga0207689_10166786
583 Ga0207661_10007878
584 Ga0207661_10012276
585 Ga0207667_10009556
586 Ga0207667_10012830
587 Ga0207667_10177398
588 Ga0207651_10004533
589 Ga0207712_10000589
590 Ga0207712_10008952
591 Ga0207712_10026173
592 Ga0207668_10000020
593 Ga0207668_10001025
594 Ga0207668_10029007
595 Ga0207668_10094294
596 Ga0207640_10060496
597 Ga0207658_10029760
598 Ga0207677_10081819
599 Ga0207703_10004533
600 Ga0207639_10001429
601 Ga0207639_10028578
602 Ga0207639_10042503
603 Ga0207639_10050016
604 Ga0207639_10056004
605 Ga0207678_10000577
606 Ga0207678_10000605
607 Ga0207678_10055150
608 Ga0207678_10069017
609 Ga0207702_10006322
610 Ga0207702_10042381
611 Ga0207641_10000074
612 Ga0207648_10018259
613 Ga0207648_10039257
614 Ga0207674_10001374
615 Ga0207674_10047073
616 Ga0207674_10068142
617 Ga0207674_10113220
618 Ga0207674_10132842
619 Ga0207674_10147057
620 Ga0207674_10178213
621 Ga0207675_100005627
622 Ga0207683_10015266
623 Ga0207683_10123231
624 Ga0209983_1002121
625 Ga0209974_10008722
626 Ga0268266_10000008
627 Ga0268266_10013106
628 Ga0268265_10003381
629 Ga0268265_10162732
630 Ga0307517_10115437
631 Ga0265316_10000552
632 Ga0307408_100160178
633 Ga0307508_10036161
634 Ga0265314_10001011
635 Ga0307516_10001780
636 Ga0307410_10003696
637 Ga0307412_10041496
638 Ga0307409_100126573
639 Ga0307414_10000640
640 Ga0307415_100014957
641 Ga0373928_0006120
642 Ga0373927_0178357
643 Ga0373937_0001423
644 Ga0395900_0030887
645 Ga0395900_0068191
646 Ga0395900_0108495
647 Ga0395900_0200432
648 Ga0395898_0029476
649 Ga0395905_0001986
650 Ga0395905_0051408
651 Ga0395905_0067884
652 Ga0395905_0113384
653 Ga0395905_0242233
654 Ga0395905_0268583
655 Ga0395901_0016958
656 Ga0451793_1028672
657 Ga0451807_0280975
658 Ga0451837_1074998
659 Ga0439445_0000425
660 Ga0439440_0003042
661 Ga0466972_0018052
662 Ga0466972_0018289
663 Ga0466961_0048928
664 Ga0466963_0022243
665 Ga0466963_0030922
666 Ga0466970_0042490
667 Ga0466970_0066462
668 Ga0466958_0016285
669 Ga0466958_0021438
670 Ga0466958_0051702
671 Ga0466967_0098032
672 Ga0466967_0167175
673 Ga0495638_0000071
674 Ga0495638_0023689
675 Ga0495650_0001249
676 Ga0495580_0010286
677 Ga0495606_0008027
678 Ga0495616_0000128
679 Ga0495632_0033484
680 Ga0495621_0012646
681 Ga0495621_0013094
682 Ga0496100_0081862
683 Ga0496101_0064720
684 Ga0496101_0239423
685 Ga0496102_0079320
686 Ga0496103_0003328
687 Ga0496103_0059374
688 Ga0496104_0024451
689 Ga0496106_0067254
690 Ga0496108_0096433
691 Ga0496108_0103696
692 Ga0496110_0099774
693 Ga0496112_0040575
694 Ga0496113_0053256
695 Ga0496114_0179798
696 Ga0496118_0006022
697 Ga0496121_0047767
698 Ga0496122_0004243
699 Ga0496123_0002066
700 Ga0496124_0000052
701 Ga0496124_0018373
702 Ga0501032_0002036
703 Ga0501032_0003170
704 Ga0501032_0033949
705 Ga0501033_0003002
706 Ga0501033_0003081
707 Ga0501034_0001904
708 Ga0501034_0051510
709 Ga0501034_0055913
710 Ga0501034_0108331
711 Ga0501036_0052580
712 Ga0501036_0053627
713 Ga0501037_0000948
714 Ga0501037_0102156
715 Ga0501038_0000712
716 Ga0501038_0004188
717 Ga0501038_0065003
718 Ga0501039_0007044
719 Ga0501039_0032571
720 Ga0501039_0102966
721 Ga0501039_0115009
722 Ga0501040_0013160
723 Ga0501042_0037745
724 Ga0501043_0005297
725 Ga0501043_0032363
726 Ga0501046_0013710
727 Ga0501046_0028083
728 Ga0501047_0020575
729 Ga0501047_0036088
730 Ga0501047_0082309
731 Ga0501047_0131717
732 Ga0501048_0026548
733 Ga0501067_0026748
734 Ga0501069_0029897
735 Ga0501070_0008039
736 Ga0501070_0008908
737 Ga0501070_0056768
738 Ga0501070_0096593
739 Ga0501071_0004988
740 Ga0501071_0099729
741 Ga0501072_0048687
742 Ga0501073_0001226
743 Ga0501073_0029761
744 Ga0501074_0009561
745 Ga0501080_0013444
746 Ga0501080_0045549
747 Ga0501035_0001396
748 Ga0501035_0058247
749 Ga0501044_0078413
750 nmdc:mga00v17_118180_c1
751 nmdc:mga06r32_3606_c1
752 nmdc:mga08y16_30716_c1
753 Ga0500610_0011011
754 Ga0500651_0014757
755 Ga0500616_0000073
756 Ga0500616_0007454
757 Ga0500622_0003525
758 Ga0501084_0012807
759 Ga0501082_0018364
760 Ga0466962_0001188
761 2595447733
762 2819566284
763 2904466560
764 2919515433
765 2919675814
766 8002871140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

322

513

0.88

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

348

514

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.9641 33 470
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.9491 33 470
1q7l-assembly1.cif.gz_A zn-binding domain of the t347g mutant of human aminoacylase-i 0.8282 264 334
1xbu-assembly1.cif.gz_A streptomyces griseus aminopeptidase complexed with p-iodo-d-phenylalanine 0.7928 262 460
1tkf-assembly1.cif.gz_A streptomyces griseus aminopeptidase complexed with d-tryptophan 0.7855 262 460
ID Description Score Start End Superfamily
3iibA02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.9412 104 254 3.50.30.30
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9365 33 470 3.40.630.10
3iibA02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.9351 104 254 3.50.30.30
af_Q9Y646_117_259_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9205 104 254 3.40.630.10
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9176 33 470 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A1G3G213-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9997 32 480 GO:0004177
GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A848QH50-F1-model_v4 deleted 0.9983 312 480
AF-A0A1G3G213-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9953 32 480 GO:0004177
GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A7V8GJV0-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9873 135 341 GO:0004177
GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A4R6YQZ5-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9864 20 480 GO:0004180
GO:0005576
GO:0005764
GO:0070573

Map