F429573

General Info

Members Datasets Scaffolds Average Seq Length
383 238 766 179

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10915959|Ga0105245_109159592
Length 200
Sequence VSKVTADGANGAPHASIRYRHYHARMSIQPAFRAATAADADAIIALVESAYRGDASRVGWTTEADFLDGRRTGPDDVLAQIARPRSRILLAEQDGGLLACAHVAEEEGAGYFGMFSVQPGLQNAGLGKTVLAEAERIAREEWKLPSMRMTVIDIRDELIAWYERRGYRRTGITKPFPYGDARFGIPKRDDLRFEILEKML

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
64 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
65 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
66 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
80 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
152 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
153 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
154 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
157 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
158 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
168 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
169 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
214 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
221 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
222 2643221559 Lysobacter sp. Root559 Isolate Unclassified
223 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
224 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
225 2643221586 Lysobacter sp. Root667 Isolate Unclassified
226 2643221612 Lysobacter sp. Root76 Isolate Unclassified
227 2643221695 Lysobacter sp. Root494 Isolate Unclassified
228 2643221727 Lysobacter sp. Root96 Isolate Unclassified
229 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
230 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
231 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
232 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
233 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
234 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
235 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
236 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
237 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
238 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 0
Isolates 4.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.19
Nodule 0
Rhizoplane 6.01
Rhizosphere 69.45
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10915959 3300009098 Bacteria 919
2 SwRhRL2b_contig_401154 2162886007 Bacteria 2805
3 JGI25150J39212_1000286 3300002774 Bacteria 26314
4 JGI25151J46595_10000351 3300003187 Bacteria 49103
5 JGI25151J46595_10038511 3300003187 Bacteria 1778
6 JGI25153J46596_10000219 3300003215 Bacteria 49103
7 rootH1_10199012 3300003323 Bacteria 2854
8 Ga0055526_1000355 3300003771 Bacteria 37199
9 Ga0055537_1000272 3300003773 Bacteria 37332
10 Ga0055524_1000398 3300003775 Bacteria 37199
11 Ga0055536_1000572 3300003781 Bacteria 25133
12 Ga0055536_1001393 3300003781 Bacteria 14626
13 Ga0055536_1006890 3300003781 Bacteria 5187
14 Ga0055536_1011651 3300003781 Bacteria 3345
15 Ga0055534_1000253 3300003784 Bacteria 37199
16 Ga0055528_1000356 3300003790 Bacteria 37199
17 Ga0055530_10001491 3300003791 Bacteria 16998
18 Ga0055531_10002966 3300003794 Bacteria 11030
19 Ga0055531_10010668 3300003794 Bacteria 4535
20 Ga0055531_10015548 3300003794 Bacteria 3345
21 Ga0055531_10027498 3300003794 Bacteria 1994
22 Ga0065704_10071078 3300005289 Bacteria 13339
23 Ga0065704_10086819 3300005289 Bacteria 3082
24 Ga0065715_10000794 3300005293 Bacteria 8377
25 Ga0065715_10002080 3300005293 Bacteria 5181
26 Ga0065715_10167433 3300005293 Bacteria 1575
27 Ga0070670_100091667 3300005331 Bacteria 2613
28 Ga0070670_100255506 3300005331 Bacteria 1527
29 Ga0068869_100063841 3300005334 Bacteria 2707
30 Ga0068868_100759028 3300005338 Bacteria 872
31 Ga0070660_100054835 3300005339 Bacteria 3079
32 Ga0070660_100151592 3300005339 Bacteria 1864
33 Ga0070660_100301788 3300005339 Bacteria 1313
34 Ga0070661_100028186 3300005344 Bacteria 4049
35 Ga0070661_100644381 3300005344 Bacteria 860
36 Ga0070668_100002422 3300005347 Bacteria 13732
37 Ga0070668_100069064 3300005347 Bacteria 2748
38 Ga0070669_100128405 3300005353 Bacteria 1942
39 Ga0070669_100251524 3300005353 Bacteria 1407
40 Ga0070675_100143779 3300005354 Bacteria 2040
41 Ga0070675_100242847 3300005354 Bacteria 1574
42 Ga0070675_100250183 3300005354 Bacteria 1551
43 Ga0070671_100086795 3300005355 Bacteria 2618
44 Ga0070671_100489384 3300005355 Bacteria 1057
45 Ga0070674_100027348 3300005356 Bacteria 3737
46 Ga0070673_100398099 3300005364 Bacteria 1231
47 Ga0070659_100287668 3300005366 Bacteria 1368
48 Ga0070659_100360567 3300005366 Bacteria 1221
49 Ga0070659_101024889 3300005366 Bacteria 725
50 Ga0070667_100836947 3300005367 Bacteria 855
51 Ga0070713_100235723 3300005436 Bacteria 1665
52 Ga0070678_100174005 3300005456 Bacteria 1756
53 Ga0070681_10560805 3300005458 Bacteria 1056
54 Ga0068867_100071979 3300005459 Bacteria 2587
55 Ga0070679_100241779 3300005530 Bacteria 1762
56 Ga0068853_100001280 3300005539 Bacteria 18028
57 Ga0070672_100002051 3300005543 Bacteria 12698
58 Ga0070672_100128859 3300005543 Bacteria 2078
59 Ga0070665_100200405 3300005548 Bacteria 1996
60 Ga0070665_101030031 3300005548 Bacteria 835
61 Ga0068855_100048912 3300005563 Bacteria 4989
62 Ga0070664_100226404 3300005564 Bacteria 1675
63 Ga0068857_100082045 3300005577 Bacteria 2880
64 Ga0068854_100075628 3300005578 Bacteria 2473
65 Ga0068856_100053582 3300005614 Bacteria 3977
66 Ga0068852_100084547 3300005616 Bacteria 2824
67 Ga0068859_100000444 3300005617 Bacteria 41364
68 Ga0068864_100065476 3300005618 Bacteria 3152
69 Ga0068851_10282060 3300005834 Bacteria 950
70 Ga0068863_100128052 3300005841 Bacteria 2423
71 Ga0068863_100205458 3300005841 Bacteria 1896
72 Ga0068863_100342226 3300005841 Bacteria 1455
73 Ga0068860_100691499 3300005843 Bacteria 1029
74 Ga0068862_100000544 3300005844 Bacteria 39452
75 Ga0075364_10000335 3300006051 Bacteria 23436
76 Ga0075362_10148398 3300006177 Bacteria 1124
77 Ga0097621_100583457 3300006237 Bacteria 1020
78 Ga0097620_100000444 3300006931 Bacteria 41364
79 Ga0105240_10014542 3300009093 Bacteria 10744
80 Ga0105240_10092738 3300009093 Bacteria 3687
81 Ga0105245_10075637 3300009098 Bacteria 3066
82 Ga0105245_10188372 3300009098 Bacteria 1975
83 Ga0105241_10002896 3300009174 Bacteria 12829
84 Ga0105241_10722660 3300009174 Bacteria 911
85 Ga0105242_10175500 3300009176 Bacteria 1886
86 Ga0105248_10173912 3300009177 Bacteria 2427
87 Ga0105248_11160840 3300009177 Bacteria 873
88 Ga0105237_10096967 3300009545 Bacteria 2939
89 Ga0105238_10017124 3300009551 Bacteria 7357
90 Ga0105238_10383858 3300009551 Bacteria 1396
91 Ga0105249_10335294 3300009553 Bacteria 1527
92 Ga0105032_102741 3300009979 Bacteria 1561
93 Ga0105239_10003813 3300010375 Bacteria 18326
94 Ga0105239_10014505 3300010375 Bacteria 8742
95 Ga0105239_10301264 3300010375 Bacteria 1805
96 Ga0157329_1008258 3300012491 Bacteria 775
97 Ga0157314_1015550 3300012500 Bacteria 721
98 Ga0157315_1001675 3300012508 Bacteria 1277
99 Ga0157316_1002469 3300012510 Bacteria 1255
100 Ga0157373_10167578 3300013100 Bacteria 1546
101 Ga0157371_10098408 3300013102 Bacteria 2074
102 Ga0157370_10076393 3300013104 Bacteria 3155
103 Ga0157369_10003689 3300013105 Bacteria 18196
104 Ga0157374_10212542 3300013296 Bacteria 1897
105 Ga0163162_10358133 3300013306 Bacteria 1592
106 Ga0157372_10001068 3300013307 Bacteria 29960
107 Ga0157372_10223475 3300013307 Bacteria 2183
108 Ga0157372_10315250 3300013307 Bacteria 1821
109 Ga0157375_10010612 3300013308 Bacteria 8111
110 Ga0157375_10781243 3300013308 Bacteria 1105
111 Ga0157375_10791426 3300013308 Bacteria 1097
112 Ga0157375_11430614 3300013308 Bacteria 815
113 Ga0163163_10009981 3300014325 Bacteria 8513
114 Ga0163163_11173855 3300014325 Bacteria 830
115 Ga0157380_10073036 3300014326 Bacteria 2780
116 Ga0157379_10186390 3300014968 Bacteria 1875
117 Ga0182006_1032084 3300015261 Bacteria 2113
118 Ga0183360_10001 3300015689 Bacteria 3943671
119 Ga0207425_1000111 3300025245 Bacteria 77375
120 Ga0209129_1000087 3300025258 Bacteria 179582
121 Ga0209565_1000005 3300025263 Bacteria 947317
122 Ga0209565_1030695 3300025263 Bacteria 1048
123 Ga0209673_1000011 3300025273 Bacteria 586604
124 Ga0209673_1007456 3300025273 Bacteria 5036
125 Ga0209130_1005371 3300025284 Bacteria 4468
126 Ga0209675_1000004 3300025291 Bacteria 947166
127 Ga0209675_1008823 3300025291 Bacteria 3644
128 Ga0209675_1010997 3300025291 Bacteria 3038
129 Ga0209676_1000027 3300025292 Bacteria 560222
130 Ga0209676_1000562 3300025292 Bacteria 55987
131 Ga0209676_1002342 3300025292 Bacteria 13689
132 Ga0209676_1002675 3300025292 Bacteria 12082
133 Ga0209676_1003341 3300025292 Bacteria 10014
134 Ga0209676_1004276 3300025292 Bacteria 8051
135 Ga0209676_1010322 3300025292 Bacteria 3910
136 Ga0209025_1000013 3300025294 Bacteria 871757
137 Ga0209025_1001014 3300025294 Bacteria 41336
138 Ga0209025_1007487 3300025294 Bacteria 8118
139 Ga0209025_1107098 3300025294 Bacteria 868
140 Ga0209564_1000018 3300025295 Bacteria 586913
141 Ga0209564_1013172 3300025295 Bacteria 3537
142 Ga0209758_1000014 3300025297 Bacteria 871757
143 Ga0209050_1001279 3300025298 Bacteria 28742
144 Ga0209050_1004833 3300025298 Bacteria 8850
145 Ga0209256_1000021 3300025299 Bacteria 537097
146 Ga0209256_1002261 3300025299 Bacteria 16322
147 Ga0209256_1002887 3300025299 Bacteria 13024
148 Ga0209051_1060858 3300025303 Bacteria 1189
149 Ga0209257_1000274 3300025304 Bacteria 117076
150 Ga0209257_1000851 3300025304 Bacteria 43638
151 Ga0209257_1000885 3300025304 Bacteria 42112
152 Ga0209257_1001361 3300025304 Bacteria 29543
153 Ga0209257_1001774 3300025304 Bacteria 23862
154 Ga0209257_1002916 3300025304 Bacteria 15775
155 Ga0207705_10094167 3300025909 Bacteria 2196
156 Ga0207705_10717030 3300025909 Unclassified 777
157 Ga0207695_10000551 3300025913 Bacteria 77273
158 Ga0207671_10030246 3300025914 Bacteria 4040
159 Ga0207671_10131531 3300025914 Bacteria 1921
160 Ga0207671_10470600 3300025914 Bacteria 1001
161 Ga0207660_10387205 3300025917 Bacteria 1124
162 Ga0207657_10003567 3300025919 Bacteria 16602
163 Ga0207657_10083124 3300025919 Bacteria 2686
164 Ga0207657_10243013 3300025919 Bacteria 1437
165 Ga0207652_10110147 3300025921 Bacteria 2441
166 Ga0207681_10010090 3300025923 Bacteria 5780
167 Ga0207694_10071491 3300025924 Bacteria 2711
168 Ga0207650_10439557 3300025925 Bacteria 1084
169 Ga0207659_10254474 3300025926 Bacteria 1426
170 Ga0207659_10277206 3300025926 Bacteria 1370
171 Ga0207687_10806109 3300025927 Bacteria 801
172 Ga0207700_10292604 3300025928 Bacteria 1404
173 Ga0207644_10075713 3300025931 Bacteria 2474
174 Ga0207644_10296591 3300025931 Bacteria 1301
175 Ga0207690_10720959 3300025932 Bacteria 821
176 Ga0207709_10734467 3300025935 Bacteria 792
177 Ga0207691_10010586 3300025940 Bacteria 8847
178 Ga0207691_10070452 3300025940 Bacteria 3157
179 Ga0207711_10176023 3300025941 Bacteria 1944
180 Ga0207689_10031467 3300025942 Bacteria 4417
181 Ga0207679_10225336 3300025945 Bacteria 1579
182 Ga0207679_10550482 3300025945 Bacteria 1035
183 Ga0207667_10057867 3300025949 Bacteria 4067
184 Ga0207667_10859862 3300025949 Bacteria 901
185 Ga0207667_11164887 3300025949 Bacteria 752
186 Ga0207651_10231295 3300025960 Bacteria 1501
187 Ga0207668_10010531 3300025972 Bacteria 5590
188 Ga0207668_10031201 3300025972 Bacteria 3508
189 Ga0207640_10742615 3300025981 Bacteria 845
190 Ga0207658_10113534 3300025986 Bacteria 2147
191 Ga0207658_10761529 3300025986 Bacteria 877
192 Ga0207639_10000389 3300026041 Bacteria 30261
193 Ga0207639_10217890 3300026041 Bacteria 1647
194 Ga0207708_10486843 3300026075 Bacteria 1032
195 Ga0207702_10005391 3300026078 Bacteria 11204
196 Ga0207641_10103864 3300026088 Bacteria 2508
197 Ga0207641_10371311 3300026088 Bacteria 1368
198 Ga0207648_10356744 3300026089 Bacteria 1319
199 Ga0207676_10398045 3300026095 Bacteria 1286
200 Ga0207676_10833985 3300026095 Bacteria 901
201 Ga0207674_10100952 3300026116 Bacteria 2866
202 Ga0207674_10515912 3300026116 Bacteria 1154
203 Ga0207675_100807415 3300026118 Bacteria 952
204 Ga0207683_10199019 3300026121 Bacteria 1820
205 Ga0207698_10014623 3300026142 Bacteria 5225
206 Ga0209974_10025817 3300027876 Bacteria 1945
207 Ga0268266_10082445 3300028379 Bacteria 2806
208 Ga0268266_10228636 3300028379 Bacteria 1712
209 Ga0268266_10325874 3300028379 Bacteria 1439
210 Ga0268265_10000771 3300028380 Bacteria 30850
211 Ga0268265_10269627 3300028380 Bacteria 1518
212 Ga0268265_10282094 3300028380 Bacteria 1487
213 Ga0268264_10389581 3300028381 Bacteria 1336
214 Ga0316182_1319342 3300030745 Bacteria 1893
215 Ga0307408_100358828 3300031548 Bacteria 1239
216 Ga0307408_101068126 3300031548 Bacteria 747
217 Ga0307408_101133581 3300031548 Bacteria 727
218 Ga0307516_10057825 3300031730 Bacteria 3776
219 Ga0307405_10593161 3300031731 Bacteria 903
220 Ga0307413_10101245 3300031824 Bacteria 1904
221 Ga0307413_10464468 3300031824 Bacteria 1008
222 Ga0307410_11022115 3300031852 Bacteria 714
223 Ga0307406_10631511 3300031901 Bacteria 887
224 Ga0307406_11015570 3300031901 Bacteria 712
225 Ga0307407_10075087 3300031903 Bacteria 2025
226 Ga0307412_10080672 3300031911 Bacteria 2248
227 Ga0307412_10095111 3300031911 Bacteria 2094
228 Ga0307412_10111866 3300031911 Bacteria 1951
229 Ga0307412_10360250 3300031911 Bacteria 1171
230 Ga0307412_10774493 3300031911 Bacteria 830
231 Ga0307416_100064050 3300032002 Bacteria 3014
232 Ga0307416_100065952 3300032002 Bacteria 2978
233 Ga0307416_100484984 3300032002 Bacteria 1297
234 Ga0307414_10001111 3300032004 Bacteria 13729
235 Ga0307414_10026344 3300032004 Bacteria 3741
236 Ga0307414_11246271 3300032004 Bacteria 689
237 Ga0307411_10182937 3300032005 Bacteria 1592
238 Ga0307411_10207659 3300032005 Bacteria 1509
239 Ga0307411_10208620 3300032005 Bacteria 1507
240 Ga0307415_100311726 3300032126 Bacteria 1308
241 Ga0307415_100375721 3300032126 Bacteria 1205
242 Ga0307415_100542397 3300032126 Bacteria 1025
243 Ga0307415_100858342 3300032126 Bacteria 833
244 Ga0373937_0327305 3300036401 Bacteria 1450
245 Ga0395899_0004094 3300037312 Bacteria 11479
246 Ga0395900_0053766 3300037418 Bacteria 4145
247 Ga0395900_0079787 3300037418 Bacteria 3363
248 Ga0395900_0095578 3300037418 Bacteria 3053
249 Ga0395900_0510094 3300037418 Bacteria 1152
250 Ga0395898_0108346 3300037466 Bacteria 2664
251 Ga0395898_0308290 3300037466 Bacteria 1510
252 Ga0395905_0000755 3300037471 Bacteria 42658
253 Ga0395905_0063124 3300037471 Bacteria 3465
254 Ga0395905_0159007 3300037471 Bacteria 2124
255 Ga0395901_0024824 3300038443 Bacteria 6152
256 Ga0395901_0035734 3300038443 Bacteria 5134
257 Ga0395901_0280757 3300038443 Bacteria 1730
258 Ga0395901_0524727 3300038443 Bacteria 1203
259 Ga0395901_0630082 3300038443 Bacteria 1078
260 Ga0237819_00040 3300038705 Bacteria 45528
261 Ga0237816_00477 3300039145 Bacteria 3373
262 Ga0439436_0004609 3300041404 Bacteria 4226
263 Ga0439436_0006351 3300041404 Bacteria 3628
264 Ga0439436_0007780 3300041404 Bacteria 3294
265 Ga0439439_0051504 3300041406 Bacteria 1080
266 Ga0439465_0008603 3300041413 Bacteria 3221
267 Ga0439465_0074868 3300041413 Bacteria 1139
268 Ga0451789_0233702 3300041443 Bacteria 646
269 Ga0451797_1130451 3300041453 Bacteria 2206
270 Ga0451797_1499209 3300041453 Bacteria 1438
271 Ga0451795_1295232 3300041456 Bacteria 2054
272 Ga0451802_0717998 3300041460 Bacteria 650
273 Ga0451807_1463995 3300041486 Bacteria 5771
274 Ga0451843_1251964 3300041509 Bacteria 1656
275 Ga0451843_1322650 3300041509 Bacteria 3148
276 Ga0451843_1777697 3300041509 Bacteria 1488
277 Ga0451853_0307962 3300041512 Bacteria 584
278 Ga0451853_3753781 3300041512 Bacteria 787
279 Ga0439445_0008257 3300042004 Bacteria 2433
280 Ga0439448_0130740 3300042005 Bacteria 865
281 Ga0439432_004241 3300042006 Bacteria 5242
282 Ga0439432_051750 3300042006 Bacteria 1279
283 Ga0439449_0002178 3300042007 Bacteria 7692
284 Ga0439449_0009442 3300042007 Bacteria 3699
285 Ga0439449_0059903 3300042007 Bacteria 1405
286 Ga0439449_0076817 3300042007 Bacteria 1231
287 Ga0439452_038350 3300042010 Bacteria 1138
288 Ga0439462_0055951 3300042015 Bacteria 1064
289 Ga0450914_015955 3300042118 Bacteria 791
290 Ga0451577_0647893 3300042876 Bacteria 958
291 Ga0466967_1592197 3300045976 Bacteria 651
292 Ga0495638_0008630 3300046460 Bacteria 7209
293 Ga0495638_0285463 3300046460 Bacteria 895
294 Ga0495663_0004858 3300046525 Bacteria 3755
295 Ga0495663_0052861 3300046525 Bacteria 1261
296 Ga0495663_0067575 3300046525 Bacteria 1133
297 Ga0495663_0202235 3300046525 Bacteria 693
298 Ga0495654_0034646 3300046530 Bacteria 2546
299 Ga0495598_0000565 3300046537 Bacteria 6959
300 Ga0495621_0000629 3300046539 Bacteria 8876
301 Ga0495621_0023453 3300046539 Bacteria 2052
302 Ga0495656_0004714 3300046615 Bacteria 4687
303 Ga0495656_0010654 3300046615 Bacteria 3349
304 Ga0495656_0044476 3300046615 Bacteria 1870
305 Ga0495656_0136108 3300046615 Bacteria 1173
306 Ga0495659_0048319 3300046664 Bacteria 1541
307 Ga0495670_0132406 3300046691 Bacteria 1300
308 Ga0495671_0006087 3300046692 Bacteria 7005
309 Ga0495649_0217404 3300046694 Bacteria 989
310 Ga0495636_0000303 3300047318 Bacteria 19375
311 Ga0495636_0001314 3300047318 Bacteria 9428
312 Ga0495636_0006211 3300047318 Bacteria 4691
313 Ga0495636_0022583 3300047318 Bacteria 2544
314 Ga0495636_0031803 3300047318 Bacteria 2164
315 Ga0495672_0044532 3300047320 Bacteria 2662
316 Ga0496100_0044576 3300048903 Bacteria 2842
317 Ga0496101_0084400 3300048904 Bacteria 2352
318 Ga0496102_0582940 3300048905 Bacteria 1041
319 Ga0496102_0640555 3300048905 Bacteria 986
320 Ga0496107_0957271 3300048910 Bacteria 622
321 Ga0496108_0017329 3300048911 Bacteria 5891
322 Ga0496108_0332862 3300048911 Bacteria 1324
323 Ga0496109_0084250 3300048912 Bacteria 2932
324 Ga0496109_1005246 3300048912 Bacteria 771
325 Ga0496110_0125500 3300048913 Bacteria 2315
326 Ga0496111_0076749 3300048914 Bacteria 2436
327 Ga0496112_0095934 3300048915 Bacteria 2936
328 Ga0496112_0764958 3300048915 Bacteria 891
329 Ga0496113_0257894 3300048916 Bacteria 1393
330 Ga0496113_0288170 3300048916 Bacteria 1313
331 Ga0496114_0005730 3300048917 Bacteria 9749
332 Ga0496114_1024652 3300048917 Bacteria 709
333 Ga0496117_0087099 3300048920 Bacteria 2026
334 Ga0496118_0000226 3300048921 Bacteria 98582
335 Ga0496121_0003940 3300048924 Bacteria 20555
336 Ga0496122_0001478 3300048925 Bacteria 37832
337 Ga0496122_0022485 3300048925 Bacteria 5602
338 Ga0496123_0000150 3300048926 Bacteria 142879
339 Ga0496124_0005358 3300048927 Bacteria 14482
340 Ga0496125_0151743 3300048928 Bacteria 1590
341 Ga0496126_0008286 3300048929 Bacteria 11225
342 Ga0496126_0017013 3300048929 Bacteria 7255
343 Ga0496126_0087906 3300048929 Bacteria 2739
344 Ga0501290_000658 3300049513 Bacteria 5174
345 Ga0501033_0006447 3300049570 Bacteria 9183
346 Ga0501034_0000552 3300049571 Bacteria 59397
347 Ga0501034_0001651 3300049571 Bacteria 28815
348 Ga0501034_0109630 3300049571 Unclassified 2752
349 Ga0501046_0167442 3300049580 Bacteria 1651
350 Ga0501047_0250304 3300049581 Bacteria 1620
351 Ga0501048_0029294 3300049582 Bacteria 3993
352 Ga0501069_0008007 3300049585 Bacteria 5550
353 Ga0501070_0000970 3300049586 Bacteria 25738
354 Ga0501070_0007653 3300049586 Bacteria 9170
355 Ga0501070_0312018 3300049586 Bacteria 1280
356 Ga0501071_0373878 3300049587 Bacteria 1086
357 Ga0501080_0079096 3300049742 Bacteria 3057
358 Ga0501266_037419 3300049763 Bacteria 712
359 Ga0501275_000297 3300049772 Bacteria 5667
360 Ga0501044_0526935 3300049823 Bacteria 1081
361 nmdc:mga03683_200345_c1 3300050489 Bacteria 916
362 nmdc:mga00v17_73836_c1 3300050491 Bacteria 2119
363 Ga0500658_0070545 3300053134 Bacteria 1473
364 Ga0500568_0057813 3300053139 Bacteria 1508
365 Ga0500638_042967 3300053162 Bacteria 2195
366 Ga0500661_003273 3300055283 Bacteria 3047
367 2643816528 2643221559 Bacteria 4424915
368 2643905463 2643221579 Bacteria 4443405
369 2643913396 2643221581 Bacteria 3893603
370 2643938793 2643221586 Bacteria 4446529
371 2644077464 2643221612 Bacteria 4361984
372 2644529749 2643221695 Bacteria 3441323
373 2644694221 2643221727 Bacteria 4415595
374 2842759266 2842757796 Bacteria 3981385
375 2894417266 2894414249 Bacteria 4405451
376 2919132733 2919130084 Bacteria 5301837
377 2923517579 2923516293 Bacteria 3716336
378 2929196902 2929195423 Bacteria 5325372
379 2941491918 2941489479 Bacteria 6313767
380 2987607762 2987605356 Bacteria 4187822
381 2995952882 2995948881 Bacteria 6358104
382 8002869668 8002869464 Bacteria 3588529
383 8003016696 8003014200 Bacteria 4059994
384 Ga0105245_10915959
385 SwRhRL2b_contig_401154
386 JGI25150J39212_1000286
387 JGI25151J46595_10000351
388 JGI25151J46595_10038511
389 JGI25153J46596_10000219
390 rootH1_10199012
391 Ga0055526_1000355
392 Ga0055537_1000272
393 Ga0055524_1000398
394 Ga0055536_1000572
395 Ga0055536_1001393
396 Ga0055536_1006890
397 Ga0055536_1011651
398 Ga0055534_1000253
399 Ga0055528_1000356
400 Ga0055530_10001491
401 Ga0055531_10002966
402 Ga0055531_10010668
403 Ga0055531_10015548
404 Ga0055531_10027498
405 Ga0065704_10071078
406 Ga0065704_10086819
407 Ga0065715_10000794
408 Ga0065715_10002080
409 Ga0065715_10167433
410 Ga0070670_100091667
411 Ga0070670_100255506
412 Ga0068869_100063841
413 Ga0068868_100759028
414 Ga0070660_100054835
415 Ga0070660_100151592
416 Ga0070660_100301788
417 Ga0070661_100028186
418 Ga0070661_100644381
419 Ga0070668_100002422
420 Ga0070668_100069064
421 Ga0070669_100128405
422 Ga0070669_100251524
423 Ga0070675_100143779
424 Ga0070675_100242847
425 Ga0070675_100250183
426 Ga0070671_100086795
427 Ga0070671_100489384
428 Ga0070674_100027348
429 Ga0070673_100398099
430 Ga0070659_100287668
431 Ga0070659_100360567
432 Ga0070659_101024889
433 Ga0070667_100836947
434 Ga0070713_100235723
435 Ga0070678_100174005
436 Ga0070681_10560805
437 Ga0068867_100071979
438 Ga0070679_100241779
439 Ga0068853_100001280
440 Ga0070672_100002051
441 Ga0070672_100128859
442 Ga0070665_100200405
443 Ga0070665_101030031
444 Ga0068855_100048912
445 Ga0070664_100226404
446 Ga0068857_100082045
447 Ga0068854_100075628
448 Ga0068856_100053582
449 Ga0068852_100084547
450 Ga0068859_100000444
451 Ga0068864_100065476
452 Ga0068851_10282060
453 Ga0068863_100128052
454 Ga0068863_100205458
455 Ga0068863_100342226
456 Ga0068860_100691499
457 Ga0068862_100000544
458 Ga0075364_10000335
459 Ga0075362_10148398
460 Ga0097621_100583457
461 Ga0097620_100000444
462 Ga0105240_10014542
463 Ga0105240_10092738
464 Ga0105245_10075637
465 Ga0105245_10188372
466 Ga0105241_10002896
467 Ga0105241_10722660
468 Ga0105242_10175500
469 Ga0105248_10173912
470 Ga0105248_11160840
471 Ga0105237_10096967
472 Ga0105238_10017124
473 Ga0105238_10383858
474 Ga0105249_10335294
475 Ga0105032_102741
476 Ga0105239_10003813
477 Ga0105239_10014505
478 Ga0105239_10301264
479 Ga0157329_1008258
480 Ga0157314_1015550
481 Ga0157315_1001675
482 Ga0157316_1002469
483 Ga0157373_10167578
484 Ga0157371_10098408
485 Ga0157370_10076393
486 Ga0157369_10003689
487 Ga0157374_10212542
488 Ga0163162_10358133
489 Ga0157372_10001068
490 Ga0157372_10223475
491 Ga0157372_10315250
492 Ga0157375_10010612
493 Ga0157375_10781243
494 Ga0157375_10791426
495 Ga0157375_11430614
496 Ga0163163_10009981
497 Ga0163163_11173855
498 Ga0157380_10073036
499 Ga0157379_10186390
500 Ga0182006_1032084
501 Ga0183360_10001
502 Ga0207425_1000111
503 Ga0209129_1000087
504 Ga0209565_1000005
505 Ga0209565_1030695
506 Ga0209673_1000011
507 Ga0209673_1007456
508 Ga0209130_1005371
509 Ga0209675_1000004
510 Ga0209675_1008823
511 Ga0209675_1010997
512 Ga0209676_1000027
513 Ga0209676_1000562
514 Ga0209676_1002342
515 Ga0209676_1002675
516 Ga0209676_1003341
517 Ga0209676_1004276
518 Ga0209676_1010322
519 Ga0209025_1000013
520 Ga0209025_1001014
521 Ga0209025_1007487
522 Ga0209025_1107098
523 Ga0209564_1000018
524 Ga0209564_1013172
525 Ga0209758_1000014
526 Ga0209050_1001279
527 Ga0209050_1004833
528 Ga0209256_1000021
529 Ga0209256_1002261
530 Ga0209256_1002887
531 Ga0209051_1060858
532 Ga0209257_1000274
533 Ga0209257_1000851
534 Ga0209257_1000885
535 Ga0209257_1001361
536 Ga0209257_1001774
537 Ga0209257_1002916
538 Ga0207705_10094167
539 Ga0207705_10717030
540 Ga0207695_10000551
541 Ga0207671_10030246
542 Ga0207671_10131531
543 Ga0207671_10470600
544 Ga0207660_10387205
545 Ga0207657_10003567
546 Ga0207657_10083124
547 Ga0207657_10243013
548 Ga0207652_10110147
549 Ga0207681_10010090
550 Ga0207694_10071491
551 Ga0207650_10439557
552 Ga0207659_10254474
553 Ga0207659_10277206
554 Ga0207687_10806109
555 Ga0207700_10292604
556 Ga0207644_10075713
557 Ga0207644_10296591
558 Ga0207690_10720959
559 Ga0207709_10734467
560 Ga0207691_10010586
561 Ga0207691_10070452
562 Ga0207711_10176023
563 Ga0207689_10031467
564 Ga0207679_10225336
565 Ga0207679_10550482
566 Ga0207667_10057867
567 Ga0207667_10859862
568 Ga0207667_11164887
569 Ga0207651_10231295
570 Ga0207668_10010531
571 Ga0207668_10031201
572 Ga0207640_10742615
573 Ga0207658_10113534
574 Ga0207658_10761529
575 Ga0207639_10000389
576 Ga0207639_10217890
577 Ga0207708_10486843
578 Ga0207702_10005391
579 Ga0207641_10103864
580 Ga0207641_10371311
581 Ga0207648_10356744
582 Ga0207676_10398045
583 Ga0207676_10833985
584 Ga0207674_10100952
585 Ga0207674_10515912
586 Ga0207675_100807415
587 Ga0207683_10199019
588 Ga0207698_10014623
589 Ga0209974_10025817
590 Ga0268266_10082445
591 Ga0268266_10228636
592 Ga0268266_10325874
593 Ga0268265_10000771
594 Ga0268265_10269627
595 Ga0268265_10282094
596 Ga0268264_10389581
597 Ga0316182_1319342
598 Ga0307408_100358828
599 Ga0307408_101068126
600 Ga0307408_101133581
601 Ga0307516_10057825
602 Ga0307405_10593161
603 Ga0307413_10101245
604 Ga0307413_10464468
605 Ga0307410_11022115
606 Ga0307406_10631511
607 Ga0307406_11015570
608 Ga0307407_10075087
609 Ga0307412_10080672
610 Ga0307412_10095111
611 Ga0307412_10111866
612 Ga0307412_10360250
613 Ga0307412_10774493
614 Ga0307416_100064050
615 Ga0307416_100065952
616 Ga0307416_100484984
617 Ga0307414_10001111
618 Ga0307414_10026344
619 Ga0307414_11246271
620 Ga0307411_10182937
621 Ga0307411_10207659
622 Ga0307411_10208620
623 Ga0307415_100311726
624 Ga0307415_100375721
625 Ga0307415_100542397
626 Ga0307415_100858342
627 Ga0373937_0327305
628 Ga0395899_0004094
629 Ga0395900_0053766
630 Ga0395900_0079787
631 Ga0395900_0095578
632 Ga0395900_0510094
633 Ga0395898_0108346
634 Ga0395898_0308290
635 Ga0395905_0000755
636 Ga0395905_0063124
637 Ga0395905_0159007
638 Ga0395901_0024824
639 Ga0395901_0035734
640 Ga0395901_0280757
641 Ga0395901_0524727
642 Ga0395901_0630082
643 Ga0237819_00040
644 Ga0237816_00477
645 Ga0439436_0004609
646 Ga0439436_0006351
647 Ga0439436_0007780
648 Ga0439439_0051504
649 Ga0439465_0008603
650 Ga0439465_0074868
651 Ga0451789_0233702
652 Ga0451797_1130451
653 Ga0451797_1499209
654 Ga0451795_1295232
655 Ga0451802_0717998
656 Ga0451807_1463995
657 Ga0451843_1251964
658 Ga0451843_1322650
659 Ga0451843_1777697
660 Ga0451853_0307962
661 Ga0451853_3753781
662 Ga0439445_0008257
663 Ga0439448_0130740
664 Ga0439432_004241
665 Ga0439432_051750
666 Ga0439449_0002178
667 Ga0439449_0009442
668 Ga0439449_0059903
669 Ga0439449_0076817
670 Ga0439452_038350
671 Ga0439462_0055951
672 Ga0450914_015955
673 Ga0451577_0647893
674 Ga0466967_1592197
675 Ga0495638_0008630
676 Ga0495638_0285463
677 Ga0495663_0004858
678 Ga0495663_0052861
679 Ga0495663_0067575
680 Ga0495663_0202235
681 Ga0495654_0034646
682 Ga0495598_0000565
683 Ga0495621_0000629
684 Ga0495621_0023453
685 Ga0495656_0004714
686 Ga0495656_0010654
687 Ga0495656_0044476
688 Ga0495656_0136108
689 Ga0495659_0048319
690 Ga0495670_0132406
691 Ga0495671_0006087
692 Ga0495649_0217404
693 Ga0495636_0000303
694 Ga0495636_0001314
695 Ga0495636_0006211
696 Ga0495636_0022583
697 Ga0495636_0031803
698 Ga0495672_0044532
699 Ga0496100_0044576
700 Ga0496101_0084400
701 Ga0496102_0582940
702 Ga0496102_0640555
703 Ga0496107_0957271
704 Ga0496108_0017329
705 Ga0496108_0332862
706 Ga0496109_0084250
707 Ga0496109_1005246
708 Ga0496110_0125500
709 Ga0496111_0076749
710 Ga0496112_0095934
711 Ga0496112_0764958
712 Ga0496113_0257894
713 Ga0496113_0288170
714 Ga0496114_0005730
715 Ga0496114_1024652
716 Ga0496117_0087099
717 Ga0496118_0000226
718 Ga0496121_0003940
719 Ga0496122_0001478
720 Ga0496122_0022485
721 Ga0496123_0000150
722 Ga0496124_0005358
723 Ga0496125_0151743
724 Ga0496126_0008286
725 Ga0496126_0017013
726 Ga0496126_0087906
727 Ga0501290_000658
728 Ga0501033_0006447
729 Ga0501034_0000552
730 Ga0501034_0001651
731 Ga0501034_0109630
732 Ga0501046_0167442
733 Ga0501047_0250304
734 Ga0501048_0029294
735 Ga0501069_0008007
736 Ga0501070_0000970
737 Ga0501070_0007653
738 Ga0501070_0312018
739 Ga0501071_0373878
740 Ga0501080_0079096
741 Ga0501266_037419
742 Ga0501275_000297
743 Ga0501044_0526935
744 nmdc:mga03683_200345_c1
745 nmdc:mga00v17_73836_c1
746 Ga0500658_0070545
747 Ga0500568_0057813
748 Ga0500638_042967
749 Ga0500661_003273
750 2643816528
751 2643905463
752 2643913396
753 2643938793
754 2644077464
755 2644529749
756 2644694221
757 2842759266
758 2894417266
759 2919132733
760 2923517579
761 2929196902
762 2941491918
763 2987607762
764 2995952882
765 8002869668
766 8003016696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

57

167

0.85

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

84

169

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lua-assembly1.cif.gz_A crystal structure of n-acetyltransferase from staphylococcus aureus mu50 0.8321 3 174
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.8307 5 165
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8296 51 173
4qvt-assembly5.cif.gz_H crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.8262 5 165
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.8166 3 179
ID Description Score Start End Superfamily
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8883 71 115 3.40.630.30
af_Q54U46_65_201_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8817 65 153 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8805 83 149 3.40.630.30
4qvtA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8764 5 140 3.40.630.30
af_Q58925_1_145_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8658 5 175 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2N1WXL2-F1-model_v4 deleted 0.978 61 174
AF-A0A091ASX9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9763 1 174 GO:0016747
AF-A0A7W9Z8A0-F1-model_v4 GNAT superfamily N-acetyltransferase 0.9753 2 178 GO:0016747
AF-A0A562LPD4-F1-model_v4 Ribosomal protein S18 acetylase RimI-like enzyme 0.9718 2 174 GO:0005840
GO:0016747
AF-G7UQS6-F1-model_v4 GCN5-like N-acetyltransferase 0.9715 1 174 GO:0016747

Map