F429574

General Info

Members Datasets Scaffolds Average Seq Length
383 200 766 174

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11113984|Ga0105245_111139842
Length 205
Sequence MAFPGGHDLFYDRWNSDGKFYPAIHFASLIFYMEKIAVKNSFVEKLNTDFEVRSLDSVCINTSVLKHPWWYNIKYMVAGLLFGIVLVKTEVISWFRIQEMFRFQSFHMYGVIGSAVLTAMMSVWLIKKFRIKTIYGEPIQLYKIRFSKGQVYGGLLFGFGWAMTGACPGPLFALIGSGTTVIIVTLLSAIAGTWVYGFFREKLPH

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
152 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
161 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
176 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
177 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
178 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
179 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
180 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
181 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
182 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
183 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
184 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
190 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 1.83
Rhizosphere 96.08
Stem 0
Stem Tuber 0
Unclassified 11.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_11113984 3300009098 Bacteria 836
2 JGI24740J21852_10063451 3300001979 Bacteria 1011
3 JGI24739J22299_10194979 3300001989 Bacteria 595
4 rootH1_10009835 3300003316 Bacteria 7038
5 rootH2_10006458 3300003320 Bacteria 43676
6 rootL2_10000754 3300003322 Bacteria 26954
7 rootL2_10036669 3300003322 Bacteria 7308
8 rootH1_10058710 3300003323 Bacteria 7475
9 Ga0065707_10419862 3300005295 Bacteria 832
10 Ga0070658_10414749 3300005327 Bacteria 1158
11 Ga0070683_100037080 3300005329 Bacteria 4462
12 Ga0070690_100006178 3300005330 Bacteria 6789
13 Ga0070690_100265718 3300005330 Bacteria 1218
14 Ga0070690_100508933 3300005330 Bacteria 902
15 Ga0070670_100661039 3300005331 Bacteria 938
16 Ga0070670_100863889 3300005331 Bacteria 819
17 Ga0070677_10286641 3300005333 Bacteria 831
18 Ga0068869_100351803 3300005334 Bacteria 1201
19 Ga0068869_100511263 3300005334 Bacteria 1004
20 Ga0070666_10296571 3300005335 Bacteria 1151
21 Ga0070680_100031043 3300005336 Bacteria 4294
22 Ga0070680_100046989 3300005336 Bacteria 3514
23 Ga0070682_100009363 3300005337 Bacteria 5543
24 Ga0070682_100013579 3300005337 Bacteria 4690
25 Ga0070682_100014253 3300005337 Bacteria 4591
26 Ga0068868_100207335 3300005338 Bacteria 1636
27 Ga0070660_100004412 3300005339 Bacteria 9720
28 Ga0070660_100064628 3300005339 Bacteria 2847
29 Ga0070689_101055630 3300005340 Bacteria 725
30 Ga0070687_101062555 3300005343 Bacteria 590
31 Ga0070661_100001789 3300005344 Bacteria 14905
32 Ga0070661_100004634 3300005344 Bacteria 9465
33 Ga0070661_100048891 3300005344 Bacteria 3096
34 Ga0070661_100998057 3300005344 Bacteria 694
35 Ga0070675_100158312 3300005354 Unclassified 1946
36 Ga0070671_100010628 3300005355 Bacteria 7387
37 Ga0070671_100069613 3300005355 Bacteria 2935
38 Ga0070674_100394612 3300005356 Unclassified 1129
39 Ga0070673_100039342 3300005364 Bacteria 3618
40 Ga0070673_100042101 3300005364 Unclassified 3519
41 Ga0070673_100389942 3300005364 Unclassified 1243
42 Ga0070688_100257810 3300005365 Bacteria 1244
43 Ga0070659_100013067 3300005366 Bacteria 6174
44 Ga0070659_100042454 3300005366 Bacteria 3555
45 Ga0070667_100014521 3300005367 Bacteria 6508
46 Ga0070667_100030532 3300005367 Bacteria 4495
47 Ga0070667_100373633 3300005367 Bacteria 1294
48 Ga0070700_100151680 3300005441 Bacteria 1586
49 Ga0070663_100069411 3300005455 Bacteria 2560
50 Ga0070663_100735425 3300005455 Bacteria 841
51 Ga0070678_100150260 3300005456 Bacteria 1876
52 Ga0070678_100262463 3300005456 Bacteria 1453
53 Ga0070678_100837903 3300005456 Bacteria 837
54 Ga0070662_100009217 3300005457 Bacteria 6444
55 Ga0070681_10097313 3300005458 Bacteria 2890
56 Ga0068867_100006192 3300005459 Bacteria 8472
57 Ga0070698_100003376 3300005471 Bacteria 17567
58 Ga0070698_100021248 3300005471 Bacteria 6800
59 Ga0070679_100002484 3300005530 Bacteria 16709
60 Ga0070679_100018388 3300005530 Bacteria 6782
61 Ga0070679_100056526 3300005530 Bacteria 3909
62 Ga0070684_100002013 3300005535 Bacteria 14950
63 Ga0070684_100089183 3300005535 Bacteria 2741
64 Ga0068853_100004150 3300005539 Bacteria 11165
65 Ga0068853_100005673 3300005539 Bacteria 9817
66 Ga0068853_100018118 3300005539 Bacteria 5823
67 Ga0068853_100675932 3300005539 Bacteria 984
68 Ga0070672_100202201 3300005543 Bacteria 1661
69 Ga0070672_100250048 3300005543 Unclassified 1493
70 Ga0070672_100447673 3300005543 Bacteria 1112
71 Ga0070686_100075539 3300005544 Bacteria 2217
72 Ga0070696_100162323 3300005546 Bacteria 1647
73 Ga0068855_100003326 3300005563 Bacteria 19674
74 Ga0068855_100028805 3300005563 Bacteria 6644
75 Ga0068855_100170342 3300005563 Bacteria 2466
76 Ga0070664_100001372 3300005564 Bacteria 19398
77 Ga0070664_100044684 3300005564 Bacteria 3740
78 Ga0070664_100587635 3300005564 Bacteria 1032
79 Ga0070664_100672077 3300005564 Bacteria 963
80 Ga0068857_100004400 3300005577 Bacteria 11908
81 Ga0068857_100039098 3300005577 Bacteria 4201
82 Ga0068857_100045383 3300005577 Bacteria 3898
83 Ga0068857_100813281 3300005577 Bacteria 893
84 Ga0068854_100029824 3300005578 Bacteria 3780
85 Ga0068854_100045718 3300005578 Bacteria 3114
86 Ga0068854_100100397 3300005578 Bacteria 2169
87 Ga0068854_100142962 3300005578 Unclassified 1838
88 Ga0068856_100006123 3300005614 Bacteria 11807
89 Ga0068856_100078045 3300005614 Bacteria 3282
90 Ga0068856_101753828 3300005614 Unclassified 633
91 Ga0070702_100017895 3300005615 Bacteria 3665
92 Ga0070702_100181934 3300005615 Bacteria 1376
93 Ga0068852_100001619 3300005616 Bacteria 15360
94 Ga0068852_100287205 3300005616 Unclassified 1588
95 Ga0068852_100487094 3300005616 Bacteria 1226
96 Ga0068852_100620423 3300005616 Unclassified 1087
97 Ga0068859_100032545 3300005617 Bacteria 5238
98 Ga0068859_100390294 3300005617 Bacteria 1488
99 Ga0068859_101096643 3300005617 Bacteria 876
100 Ga0068864_100046362 3300005618 Bacteria 3729
101 Ga0068864_100241467 3300005618 Unclassified 1674
102 Ga0068864_100256917 3300005618 Bacteria 1624
103 Ga0068866_10114840 3300005718 Bacteria 1508
104 Ga0068866_10641672 3300005718 Bacteria 722
105 Ga0068861_100157416 3300005719 Bacteria 1870
106 Ga0068870_10075134 3300005840 Bacteria 1853
107 Ga0068863_100053143 3300005841 Bacteria 3839
108 Ga0068863_100136626 3300005841 Bacteria 2342
109 Ga0068863_100569932 3300005841 Bacteria 1119
110 Ga0068863_100922189 3300005841 Unclassified 874
111 Ga0068858_101865388 3300005842 Bacteria 594
112 Ga0068860_100540090 3300005843 Bacteria 1167
113 Ga0068862_100108417 3300005844 Bacteria 2436
114 Ga0097621_100000559 3300006237 Bacteria 26141
115 Ga0097621_100039286 3300006237 Bacteria 3801
116 Ga0097621_100111047 3300006237 Bacteria 2316
117 Ga0068871_100002443 3300006358 Bacteria 12694
118 Ga0068871_100003509 3300006358 Bacteria 10795
119 Ga0068871_100060052 3300006358 Bacteria 3100
120 Ga0068871_100154777 3300006358 Bacteria 1957
121 Ga0068871_100433324 3300006358 Bacteria 1176
122 Ga0068871_101060307 3300006358 Unclassified 757
123 Ga0075428_100004788 3300006844 Bacteria 14994
124 Ga0075428_100130388 3300006844 Bacteria 2735
125 Ga0075428_100600757 3300006844 Bacteria 1175
126 Ga0075430_100668577 3300006846 Bacteria 856
127 Ga0075431_100375182 3300006847 Bacteria 1427
128 Ga0075429_100004456 3300006880 Bacteria 12047
129 Ga0068865_100072125 3300006881 Bacteria 2452
130 Ga0097620_100032545 3300006931 Bacteria 5238
131 Ga0097620_100390327 3300006931 Bacteria 1488
132 Ga0097620_101096678 3300006931 Bacteria 876
133 Ga0105251_10098997 3300009011 Unclassified 1334
134 Ga0105240_10026778 3300009093 Bacteria 7562
135 Ga0105240_10081372 3300009093 Unclassified 3980
136 Ga0105240_11194774 3300009093 Bacteria 806
137 Ga0111539_10197493 3300009094 Unclassified 2346
138 Ga0105247_10514661 3300009101 Unclassified 874
139 Ga0114129_10086243 3300009147 Bacteria 4355
140 Ga0105243_10685738 3300009148 Bacteria 997
141 Ga0105241_10391674 3300009174 Bacteria 1217
142 Ga0105241_10462964 3300009174 Bacteria 1124
143 Ga0105242_10026160 3300009176 Bacteria 4624
144 Ga0105242_10086830 3300009176 Bacteria 2626
145 Ga0105242_10121100 3300009176 Bacteria 2245
146 Ga0105242_10289110 3300009176 Bacteria 1492
147 Ga0105248_10005347 3300009177 Bacteria 14131
148 Ga0105237_10237855 3300009545 Bacteria 1822
149 Ga0105249_10014757 3300009553 Bacteria 6905
150 Ga0105249_10016590 3300009553 Bacteria 6536
151 Ga0105249_10167869 3300009553 Bacteria 2126
152 Ga0105249_10222949 3300009553 Bacteria 1856
153 Ga0105249_10428509 3300009553 Bacteria 1358
154 Ga0105249_11059494 3300009553 Unclassified 880
155 Ga0105249_12652403 3300009553 Bacteria 573
156 Ga0105239_10145871 3300010375 Bacteria 2639
157 Ga0105239_10751509 3300010375 Bacteria 1116
158 Ga0105239_10772687 3300010375 Bacteria 1100
159 Ga0105239_11012918 3300010375 Bacteria 955
160 Ga0105246_10596990 3300011119 Unclassified 953
161 Ga0105246_10755716 3300011119 Bacteria 858
162 Ga0157373_10003498 3300013100 Bacteria 11878
163 Ga0157373_10006801 3300013100 Bacteria 8520
164 Ga0157371_10013542 3300013102 Bacteria 6191
165 Ga0157371_10512644 3300013102 Bacteria 886
166 Ga0157370_10002557 3300013104 Bacteria 21831
167 Ga0157370_10096433 3300013104 Bacteria 2775
168 Ga0157370_10251796 3300013104 Bacteria 1633
169 Ga0157370_10284997 3300013104 Bacteria 1526
170 Ga0157370_10388136 3300013104 Bacteria 1286
171 Ga0157369_10004629 3300013105 Bacteria 16161
172 Ga0157369_10010208 3300013105 Bacteria 10716
173 Ga0157369_10054343 3300013105 Bacteria 4325
174 Ga0157369_10124114 3300013105 Bacteria 2739
175 Ga0157369_10201967 3300013105 Bacteria 2086
176 Ga0157369_11808386 3300013105 Bacteria 620
177 Ga0157374_10009869 3300013296 Bacteria 8195
178 Ga0157374_10903987 3300013296 Unclassified 900
179 Ga0157378_10004027 3300013297 Bacteria 12977
180 Ga0157378_10018492 3300013297 Bacteria 6123
181 Ga0157378_10292060 3300013297 Unclassified 1575
182 Ga0163162_10000761 3300013306 Bacteria 29992
183 Ga0163162_10014894 3300013306 Bacteria 7593
184 Ga0163162_10050100 3300013306 Bacteria 4187
185 Ga0163162_10165994 3300013306 Bacteria 2332
186 Ga0163162_10167669 3300013306 Bacteria 2320
187 Ga0163162_10356541 3300013306 Unclassified 1595
188 Ga0163162_10759004 3300013306 Bacteria 1089
189 Ga0157372_10077127 3300013307 Bacteria 3763
190 Ga0157372_10080626 3300013307 Bacteria 3683
191 Ga0157372_10462895 3300013307 Bacteria 1478
192 Ga0157372_10471233 3300013307 Bacteria 1464
193 Ga0157372_10809798 3300013307 Bacteria 1088
194 Ga0157372_11102708 3300013307 Bacteria 918
195 Ga0157375_10000067 3300013308 Bacteria 110313
196 Ga0157375_10012111 3300013308 Bacteria 7642
197 Ga0157375_10143555 3300013308 Bacteria 2516
198 Ga0157375_10160070 3300013308 Bacteria 2392
199 Ga0163163_10040248 3300014325 Bacteria 4564
200 Ga0163163_10060020 3300014325 Bacteria 3764
201 Ga0163163_10280054 3300014325 Bacteria 1719
202 Ga0163163_11781827 3300014325 Unclassified 676
203 Ga0157380_10001827 3300014326 Bacteria 14062
204 Ga0157377_10056326 3300014745 Bacteria 2232
205 Ga0157377_10145637 3300014745 Bacteria 1460
206 Ga0157379_10070781 3300014968 Bacteria 3121
207 Ga0157379_10085325 3300014968 Unclassified 2830
208 Ga0157379_10178692 3300014968 Bacteria 1917
209 Ga0157379_11055331 3300014968 Bacteria 777
210 Ga0157376_10000165 3300014969 Bacteria 46348
211 Ga0157376_10028816 3300014969 Unclassified 4417
212 Ga0157376_10728135 3300014969 Bacteria 999
213 Ga0157376_11276032 3300014969 Bacteria 764
214 Ga0163161_10002761 3300017792 Bacteria 12483
215 Ga0163161_10003712 3300017792 Bacteria 10697
216 Ga0163161_10094520 3300017792 Bacteria 2216
217 Ga0163161_10155904 3300017792 Bacteria 1738
218 Ga0163161_10245525 3300017792 Bacteria 1394
219 Ga0163161_10306510 3300017792 Bacteria 1252
220 Ga0207697_10088801 3300025315 Bacteria 1308
221 Ga0207656_10219981 3300025321 Bacteria 923
222 Ga0207642_10118379 3300025899 Bacteria 1362
223 Ga0207642_10161402 3300025899 Bacteria 1204
224 Ga0207688_10029833 3300025901 Bacteria 3006
225 Ga0207680_10100252 3300025903 Bacteria 1859
226 Ga0207680_10417306 3300025903 Unclassified 950
227 Ga0207647_10062232 3300025904 Bacteria 2274
228 Ga0207645_10107936 3300025907 Bacteria 1801
229 Ga0207643_10180936 3300025908 Bacteria 1276
230 Ga0207705_10037534 3300025909 Bacteria 3467
231 Ga0207705_10041161 3300025909 Bacteria 3314
232 Ga0207705_10087346 3300025909 Bacteria 2280
233 Ga0207695_10011532 3300025913 Bacteria 10695
234 Ga0207695_10297566 3300025913 Bacteria 1505
235 Ga0207695_10976997 3300025913 Unclassified 726
236 Ga0207671_10236872 3300025914 Unclassified 1433
237 Ga0207660_10069977 3300025917 Bacteria 2550
238 Ga0207660_10193566 3300025917 Bacteria 1585
239 Ga0207660_10407139 3300025917 Bacteria 1096
240 Ga0207660_10843338 3300025917 Bacteria 748
241 Ga0207657_10028321 3300025919 Bacteria 5112
242 Ga0207657_10040973 3300025919 Bacteria 4099
243 Ga0207649_10002808 3300025920 Bacteria 9610
244 Ga0207649_10011562 3300025920 Bacteria 4870
245 Ga0207649_10195313 3300025920 Bacteria 1426
246 Ga0207652_10002120 3300025921 Bacteria 17031
247 Ga0207652_10213149 3300025921 Bacteria 1739
248 Ga0207681_10136557 3300025923 Bacteria 1821
249 Ga0207681_10812618 3300025923 Bacteria 781
250 Ga0207650_10008460 3300025925 Bacteria 7025
251 Ga0207650_10039614 3300025925 Bacteria 3443
252 Ga0207650_10243578 3300025925 Bacteria 1454
253 Ga0207650_10551265 3300025925 Bacteria 967
254 Ga0207650_10654141 3300025925 Bacteria 886
255 Ga0207659_10158357 3300025926 Bacteria 1775
256 Ga0207644_10022748 3300025931 Bacteria 4285
257 Ga0207690_10042213 3300025932 Bacteria 2994
258 Ga0207690_10226757 3300025932 Bacteria 1432
259 Ga0207706_10003683 3300025933 Bacteria 14626
260 Ga0207706_10016096 3300025933 Bacteria 6757
261 Ga0207686_10002586 3300025934 Bacteria 9824
262 Ga0207686_10032518 3300025934 Bacteria 3105
263 Ga0207686_10768240 3300025934 Bacteria 770
264 Ga0207704_10446790 3300025938 Bacteria 1031
265 Ga0207691_10032646 3300025940 Unclassified 4853
266 Ga0207711_10008182 3300025941 Bacteria 8756
267 Ga0207689_10003117 3300025942 Bacteria 15212
268 Ga0207689_10073751 3300025942 Unclassified 2804
269 Ga0207689_10390011 3300025942 Bacteria 1160
270 Ga0207661_10025445 3300025944 Bacteria 4499
271 Ga0207661_10121796 3300025944 Bacteria 2221
272 Ga0207679_10005252 3300025945 Bacteria 8117
273 Ga0207679_10020901 3300025945 Bacteria 4427
274 Ga0207679_10372593 3300025945 Unclassified 1250
275 Ga0207679_10518276 3300025945 Bacteria 1066
276 Ga0207667_10005433 3300025949 Bacteria 15535
277 Ga0207667_10166458 3300025949 Bacteria 2266
278 Ga0207651_10271159 3300025960 Unclassified 1398
279 Ga0207651_10278863 3300025960 Bacteria 1380
280 Ga0207712_10006689 3300025961 Bacteria 7268
281 Ga0207712_10231739 3300025961 Bacteria 1483
282 Ga0207640_10118949 3300025981 Bacteria 1888
283 Ga0207658_10129523 3300025986 Bacteria 2025
284 Ga0207658_10865768 3300025986 Unclassified 822
285 Ga0207677_10499677 3300026023 Bacteria 1051
286 Ga0207639_10012810 3300026041 Bacteria 5852
287 Ga0207639_10022547 3300026041 Bacteria 4536
288 Ga0207639_10234350 3300026041 Bacteria 1593
289 Ga0207639_10395428 3300026041 Bacteria 1244
290 Ga0207678_10086012 3300026067 Bacteria 2687
291 Ga0207708_10275489 3300026075 Bacteria 1362
292 Ga0207702_10031027 3300026078 Bacteria 4455
293 Ga0207702_10078690 3300026078 Bacteria 2855
294 Ga0207702_10298727 3300026078 Bacteria 1528
295 Ga0207702_11634624 3300026078 Bacteria 637
296 Ga0207641_10017818 3300026088 Bacteria 5819
297 Ga0207641_10054919 3300026088 Bacteria 3382
298 Ga0207641_10883821 3300026088 Unclassified 887
299 Ga0207648_10204711 3300026089 Bacteria 1751
300 Ga0207648_10361959 3300026089 Unclassified 1309
301 Ga0207676_10038234 3300026095 Bacteria 3661
302 Ga0207676_10128154 3300026095 Bacteria 2153
303 Ga0207674_10001740 3300026116 Bacteria 27826
304 Ga0207674_10063998 3300026116 Bacteria 3710
305 Ga0207674_10156378 3300026116 Unclassified 2235
306 Ga0207675_100074357 3300026118 Bacteria 3179
307 Ga0207683_10469939 3300026121 Bacteria 1160
308 Ga0207698_10003838 3300026142 Bacteria 9098
309 Ga0207698_10171169 3300026142 Bacteria 1912
310 Ga0207698_10253091 3300026142 Unclassified 1613
311 Ga0207698_10835141 3300026142 Unclassified 925
312 Ga0207428_10226013 3300027907 Bacteria 1402
313 Ga0268265_10088868 3300028380 Bacteria 2463
314 Ga0268265_10145403 3300028380 Unclassified 1991
315 Ga0268264_10038122 3300028381 Bacteria 3965
316 Ga0268264_10090546 3300028381 Bacteria 2637
317 Ga0268264_10479417 3300028381 Bacteria 1210
318 Ga0307516_10405620 3300031730 Bacteria 1022
319 Ga0307414_11833006 3300032004 Unclassified 566
320 Ga0307411_10210177 3300032005 Bacteria 1502
321 Ga0395899_0008250 3300037312 Bacteria 8024
322 Ga0395900_0100020 3300037418 Bacteria 2978
323 Ga0395898_0008380 3300037466 Bacteria 10932
324 Ga0395901_0005031 3300038443 Bacteria 13348
325 Ga0451800_0038765 3300041459 Unclassified 804
326 Ga0451800_0928796 3300041459 Bacteria 1083
327 Ga0451849_0513228 3300041505 Bacteria 731
328 Ga0450923_075462 3300042125 Bacteria 752
329 Ga0453683_0100130 3300044673 Bacteria 1819
330 Ga0453684_0040792 3300044712 Bacteria 6295
331 Ga0495650_0015595 3300046471 Bacteria 3890
332 Ga0495676_0077529 3300047321 Bacteria 2534
333 Ga0496100_0385302 3300048903 Unclassified 1065
334 Ga0496100_0540493 3300048903 Bacteria 901
335 Ga0496104_0362561 3300048907 Bacteria 1362
336 Ga0496104_0581973 3300048907 Bacteria 1030
337 Ga0496114_0050594 3300048917 Bacteria 3459
338 Ga0501297_004706 3300049520 Bacteria 1405
339 Ga0501300_001916 3300049523 Bacteria 3110
340 Ga0501031_0657040 3300049568 Bacteria 674
341 Ga0501034_0062004 3300049571 Bacteria 3754
342 Ga0501037_0121488 3300049573 Unclassified 1878
343 Ga0501042_0086284 3300049578 Bacteria 2251
344 Ga0501043_0461858 3300049579 Bacteria 952
345 Ga0501046_0001780 3300049580 Bacteria 20573
346 Ga0501047_0181101 3300049581 Unclassified 1973
347 Ga0501048_0085003 3300049582 Bacteria 2231
348 Ga0501067_0032166 3300049583 Bacteria 2912
349 Ga0501068_0442976 3300049584 Bacteria 840
350 Ga0501072_0030099 3300049588 Bacteria 4244
351 Ga0501207_062586 3300049654 Unclassified 685
352 Ga0501217_000395 3300049661 Bacteria 7038
353 Ga0501217_018876 3300049661 Bacteria 1605
354 Ga0501223_004780 3300049663 Bacteria 2882
355 Ga0501224_004067 3300049664 Bacteria 2060
356 Ga0501235_005903 3300049669 Bacteria 2665
357 Ga0501242_038073 3300049674 Unclassified 672
358 Ga0501243_001151 3300049675 Bacteria 3761
359 Ga0501246_007348 3300049676 Bacteria 959
360 Ga0501257_017339 3300049686 Bacteria 1674
361 Ga0501259_001452 3300049688 Bacteria 3944
362 Ga0501259_002209 3300049688 Bacteria 3189
363 Ga0501261_007129 3300049690 Bacteria 1432
364 Ga0501221_001295 3300049704 Bacteria 4134
365 Ga0501221_003120 3300049704 Bacteria 2724
366 Ga0501225_0026606 3300049705 Bacteria 1590
367 Ga0501225_0040972 3300049705 Bacteria 1277
368 Ga0501079_0311036 3300049741 Bacteria 1233
369 Ga0501080_0343060 3300049742 Bacteria 1349
370 Ga0501083_0004260 3300049744 Bacteria 10070
371 Ga0501264_004471 3300049761 Bacteria 1268
372 Ga0501280_006926 3300049776 Bacteria 1592
373 Ga0501044_0048035 3300049823 Bacteria 4411
374 nmdc:mga09592_29508_c1 3300050508 Bacteria 4561
375 nmdc:mga0qj67_65235_c1 3300050509 Bacteria 2898
376 nmdc:mga06r32_333630_c1 3300050510 Bacteria 1501
377 nmdc:mga08y16_208530_c1 3300050511 Bacteria 2024
378 nmdc:mga08y16_247460_c1 3300050511 Bacteria 1842
379 nmdc:mga08x19_348705_c1 3300050514 Bacteria 1033
380 Ga0500622_0000328 3300053156 Bacteria 47220
381 Ga0501084_0442230 3300054114 Bacteria 1099
382 Ga0501082_0394106 3300060353 Bacteria 1208
383 2890739460 2890737413 Bacteria 4269751
384 Ga0105245_11113984
385 JGI24740J21852_10063451
386 JGI24739J22299_10194979
387 rootH1_10009835
388 rootH2_10006458
389 rootL2_10000754
390 rootL2_10036669
391 rootH1_10058710
392 Ga0065707_10419862
393 Ga0070658_10414749
394 Ga0070683_100037080
395 Ga0070690_100006178
396 Ga0070690_100265718
397 Ga0070690_100508933
398 Ga0070670_100661039
399 Ga0070670_100863889
400 Ga0070677_10286641
401 Ga0068869_100351803
402 Ga0068869_100511263
403 Ga0070666_10296571
404 Ga0070680_100031043
405 Ga0070680_100046989
406 Ga0070682_100009363
407 Ga0070682_100013579
408 Ga0070682_100014253
409 Ga0068868_100207335
410 Ga0070660_100004412
411 Ga0070660_100064628
412 Ga0070689_101055630
413 Ga0070687_101062555
414 Ga0070661_100001789
415 Ga0070661_100004634
416 Ga0070661_100048891
417 Ga0070661_100998057
418 Ga0070675_100158312
419 Ga0070671_100010628
420 Ga0070671_100069613
421 Ga0070674_100394612
422 Ga0070673_100039342
423 Ga0070673_100042101
424 Ga0070673_100389942
425 Ga0070688_100257810
426 Ga0070659_100013067
427 Ga0070659_100042454
428 Ga0070667_100014521
429 Ga0070667_100030532
430 Ga0070667_100373633
431 Ga0070700_100151680
432 Ga0070663_100069411
433 Ga0070663_100735425
434 Ga0070678_100150260
435 Ga0070678_100262463
436 Ga0070678_100837903
437 Ga0070662_100009217
438 Ga0070681_10097313
439 Ga0068867_100006192
440 Ga0070698_100003376
441 Ga0070698_100021248
442 Ga0070679_100002484
443 Ga0070679_100018388
444 Ga0070679_100056526
445 Ga0070684_100002013
446 Ga0070684_100089183
447 Ga0068853_100004150
448 Ga0068853_100005673
449 Ga0068853_100018118
450 Ga0068853_100675932
451 Ga0070672_100202201
452 Ga0070672_100250048
453 Ga0070672_100447673
454 Ga0070686_100075539
455 Ga0070696_100162323
456 Ga0068855_100003326
457 Ga0068855_100028805
458 Ga0068855_100170342
459 Ga0070664_100001372
460 Ga0070664_100044684
461 Ga0070664_100587635
462 Ga0070664_100672077
463 Ga0068857_100004400
464 Ga0068857_100039098
465 Ga0068857_100045383
466 Ga0068857_100813281
467 Ga0068854_100029824
468 Ga0068854_100045718
469 Ga0068854_100100397
470 Ga0068854_100142962
471 Ga0068856_100006123
472 Ga0068856_100078045
473 Ga0068856_101753828
474 Ga0070702_100017895
475 Ga0070702_100181934
476 Ga0068852_100001619
477 Ga0068852_100287205
478 Ga0068852_100487094
479 Ga0068852_100620423
480 Ga0068859_100032545
481 Ga0068859_100390294
482 Ga0068859_101096643
483 Ga0068864_100046362
484 Ga0068864_100241467
485 Ga0068864_100256917
486 Ga0068866_10114840
487 Ga0068866_10641672
488 Ga0068861_100157416
489 Ga0068870_10075134
490 Ga0068863_100053143
491 Ga0068863_100136626
492 Ga0068863_100569932
493 Ga0068863_100922189
494 Ga0068858_101865388
495 Ga0068860_100540090
496 Ga0068862_100108417
497 Ga0097621_100000559
498 Ga0097621_100039286
499 Ga0097621_100111047
500 Ga0068871_100002443
501 Ga0068871_100003509
502 Ga0068871_100060052
503 Ga0068871_100154777
504 Ga0068871_100433324
505 Ga0068871_101060307
506 Ga0075428_100004788
507 Ga0075428_100130388
508 Ga0075428_100600757
509 Ga0075430_100668577
510 Ga0075431_100375182
511 Ga0075429_100004456
512 Ga0068865_100072125
513 Ga0097620_100032545
514 Ga0097620_100390327
515 Ga0097620_101096678
516 Ga0105251_10098997
517 Ga0105240_10026778
518 Ga0105240_10081372
519 Ga0105240_11194774
520 Ga0111539_10197493
521 Ga0105247_10514661
522 Ga0114129_10086243
523 Ga0105243_10685738
524 Ga0105241_10391674
525 Ga0105241_10462964
526 Ga0105242_10026160
527 Ga0105242_10086830
528 Ga0105242_10121100
529 Ga0105242_10289110
530 Ga0105248_10005347
531 Ga0105237_10237855
532 Ga0105249_10014757
533 Ga0105249_10016590
534 Ga0105249_10167869
535 Ga0105249_10222949
536 Ga0105249_10428509
537 Ga0105249_11059494
538 Ga0105249_12652403
539 Ga0105239_10145871
540 Ga0105239_10751509
541 Ga0105239_10772687
542 Ga0105239_11012918
543 Ga0105246_10596990
544 Ga0105246_10755716
545 Ga0157373_10003498
546 Ga0157373_10006801
547 Ga0157371_10013542
548 Ga0157371_10512644
549 Ga0157370_10002557
550 Ga0157370_10096433
551 Ga0157370_10251796
552 Ga0157370_10284997
553 Ga0157370_10388136
554 Ga0157369_10004629
555 Ga0157369_10010208
556 Ga0157369_10054343
557 Ga0157369_10124114
558 Ga0157369_10201967
559 Ga0157369_11808386
560 Ga0157374_10009869
561 Ga0157374_10903987
562 Ga0157378_10004027
563 Ga0157378_10018492
564 Ga0157378_10292060
565 Ga0163162_10000761
566 Ga0163162_10014894
567 Ga0163162_10050100
568 Ga0163162_10165994
569 Ga0163162_10167669
570 Ga0163162_10356541
571 Ga0163162_10759004
572 Ga0157372_10077127
573 Ga0157372_10080626
574 Ga0157372_10462895
575 Ga0157372_10471233
576 Ga0157372_10809798
577 Ga0157372_11102708
578 Ga0157375_10000067
579 Ga0157375_10012111
580 Ga0157375_10143555
581 Ga0157375_10160070
582 Ga0163163_10040248
583 Ga0163163_10060020
584 Ga0163163_10280054
585 Ga0163163_11781827
586 Ga0157380_10001827
587 Ga0157377_10056326
588 Ga0157377_10145637
589 Ga0157379_10070781
590 Ga0157379_10085325
591 Ga0157379_10178692
592 Ga0157379_11055331
593 Ga0157376_10000165
594 Ga0157376_10028816
595 Ga0157376_10728135
596 Ga0157376_11276032
597 Ga0163161_10002761
598 Ga0163161_10003712
599 Ga0163161_10094520
600 Ga0163161_10155904
601 Ga0163161_10245525
602 Ga0163161_10306510
603 Ga0207697_10088801
604 Ga0207656_10219981
605 Ga0207642_10118379
606 Ga0207642_10161402
607 Ga0207688_10029833
608 Ga0207680_10100252
609 Ga0207680_10417306
610 Ga0207647_10062232
611 Ga0207645_10107936
612 Ga0207643_10180936
613 Ga0207705_10037534
614 Ga0207705_10041161
615 Ga0207705_10087346
616 Ga0207695_10011532
617 Ga0207695_10297566
618 Ga0207695_10976997
619 Ga0207671_10236872
620 Ga0207660_10069977
621 Ga0207660_10193566
622 Ga0207660_10407139
623 Ga0207660_10843338
624 Ga0207657_10028321
625 Ga0207657_10040973
626 Ga0207649_10002808
627 Ga0207649_10011562
628 Ga0207649_10195313
629 Ga0207652_10002120
630 Ga0207652_10213149
631 Ga0207681_10136557
632 Ga0207681_10812618
633 Ga0207650_10008460
634 Ga0207650_10039614
635 Ga0207650_10243578
636 Ga0207650_10551265
637 Ga0207650_10654141
638 Ga0207659_10158357
639 Ga0207644_10022748
640 Ga0207690_10042213
641 Ga0207690_10226757
642 Ga0207706_10003683
643 Ga0207706_10016096
644 Ga0207686_10002586
645 Ga0207686_10032518
646 Ga0207686_10768240
647 Ga0207704_10446790
648 Ga0207691_10032646
649 Ga0207711_10008182
650 Ga0207689_10003117
651 Ga0207689_10073751
652 Ga0207689_10390011
653 Ga0207661_10025445
654 Ga0207661_10121796
655 Ga0207679_10005252
656 Ga0207679_10020901
657 Ga0207679_10372593
658 Ga0207679_10518276
659 Ga0207667_10005433
660 Ga0207667_10166458
661 Ga0207651_10271159
662 Ga0207651_10278863
663 Ga0207712_10006689
664 Ga0207712_10231739
665 Ga0207640_10118949
666 Ga0207658_10129523
667 Ga0207658_10865768
668 Ga0207677_10499677
669 Ga0207639_10012810
670 Ga0207639_10022547
671 Ga0207639_10234350
672 Ga0207639_10395428
673 Ga0207678_10086012
674 Ga0207708_10275489
675 Ga0207702_10031027
676 Ga0207702_10078690
677 Ga0207702_10298727
678 Ga0207702_11634624
679 Ga0207641_10017818
680 Ga0207641_10054919
681 Ga0207641_10883821
682 Ga0207648_10204711
683 Ga0207648_10361959
684 Ga0207676_10038234
685 Ga0207676_10128154
686 Ga0207674_10001740
687 Ga0207674_10063998
688 Ga0207674_10156378
689 Ga0207675_100074357
690 Ga0207683_10469939
691 Ga0207698_10003838
692 Ga0207698_10171169
693 Ga0207698_10253091
694 Ga0207698_10835141
695 Ga0207428_10226013
696 Ga0268265_10088868
697 Ga0268265_10145403
698 Ga0268264_10038122
699 Ga0268264_10090546
700 Ga0268264_10479417
701 Ga0307516_10405620
702 Ga0307414_11833006
703 Ga0307411_10210177
704 Ga0395899_0008250
705 Ga0395900_0100020
706 Ga0395898_0008380
707 Ga0395901_0005031
708 Ga0451800_0038765
709 Ga0451800_0928796
710 Ga0451849_0513228
711 Ga0450923_075462
712 Ga0453683_0100130
713 Ga0453684_0040792
714 Ga0495650_0015595
715 Ga0495676_0077529
716 Ga0496100_0385302
717 Ga0496100_0540493
718 Ga0496104_0362561
719 Ga0496104_0581973
720 Ga0496114_0050594
721 Ga0501297_004706
722 Ga0501300_001916
723 Ga0501031_0657040
724 Ga0501034_0062004
725 Ga0501037_0121488
726 Ga0501042_0086284
727 Ga0501043_0461858
728 Ga0501046_0001780
729 Ga0501047_0181101
730 Ga0501048_0085003
731 Ga0501067_0032166
732 Ga0501068_0442976
733 Ga0501072_0030099
734 Ga0501207_062586
735 Ga0501217_000395
736 Ga0501217_018876
737 Ga0501223_004780
738 Ga0501224_004067
739 Ga0501235_005903
740 Ga0501242_038073
741 Ga0501243_001151
742 Ga0501246_007348
743 Ga0501257_017339
744 Ga0501259_001452
745 Ga0501259_002209
746 Ga0501261_007129
747 Ga0501221_001295
748 Ga0501221_003120
749 Ga0501225_0026606
750 Ga0501225_0040972
751 Ga0501079_0311036
752 Ga0501080_0343060
753 Ga0501083_0004260
754 Ga0501264_004471
755 Ga0501280_006926
756 Ga0501044_0048035
757 nmdc:mga09592_29508_c1
758 nmdc:mga0qj67_65235_c1
759 nmdc:mga06r32_333630_c1
760 nmdc:mga08y16_208530_c1
761 nmdc:mga08y16_247460_c1
762 nmdc:mga08x19_348705_c1
763 Ga0500622_0000328
764 Ga0501084_0442230
765 Ga0501082_0394106
766 2890739460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04143

Sulf_transp

Sulphur transport

95

202

0.87

PF20398

DUF6691

Family of unknown function (DUF6691)

70

204

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r1x-assembly1.cif.gz_A crystal structure of 2-oxo-3-deoxygalactonate kinase from klebsiella pneumoniae 0.5456 113 171
8b6h-assembly1.cif.gz_EG cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.4006 108 171
8gym-assembly1.cif.gz_t7 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.3785 111 171
8b6h-assembly1.cif.gz_EG cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.2866 108 171
3r1x-assembly1.cif.gz_A crystal structure of 2-oxo-3-deoxygalactonate kinase from klebsiella pneumoniae 0.2221 113 171
ID Description Score Start End Superfamily
3nuwA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;2-keto-3-deoxy-galactonokinase, C-terminal domain 0.5133 113 171 3.30.420.310
1anwB03 Mainly Alpha;Orthogonal Bundle;Annexin V; domain 1;Annexin 0.5011 109 160 1.10.220.10
af_I1KSG6_66_191_1.20.140.50 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;alix/aip1 like domains 0.4824 116 171 1.20.140.50
af_A0A1D6GUL8_419_510_1.10.10.630 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DnaD domain-like 0.3993 108 172 1.10.10.630
af_Q86I14_1_135_1.25.40.180 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.3919 115 173 1.25.40.180
ID Description Score Start End GO Terms
AF-A0A348TQP9-F1-model_v4 Transporter 0.529 88 174 GO:0016020
AF-A0A348TQP9-F1-model_v4 Transporter 0.5181 88 174 GO:0016020
AF-A0A7J6YLZ9-F1-model_v4 deleted 0.4929 82 174
AF-A0A5C6LW40-F1-model_v4 Transporter 0.4477 31 174 GO:0005886
AF-A0A520DUT7-F1-model_v4 Transporter 0.4379 15 174 GO:0005886

Map