F429653

General Info

Members Datasets Scaffolds Average Seq Length
383 188 766 440

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0136173|Ga0395900_0136173_499_1998
Length 499
Sequence VALRQGLRDGSCLTAFFPIFVFLNTLIEDAMRAHCRSVIFNGEIEMTELTRRQALAQVSALAAACAVSPLSAAVPSNKFIHRAGSRLIRDGQPWRYAGTNMWYAAYLGADAPYGNRARLQRELDRVAGLGIQSIRILGSSELSPLLHSVRPTFRDQTTHYNETLLQGLDFALAEMGKRNIRAVIYLANFWEWSGGFMTYLYWTNGGHYLNMNDPAHPWPQFPDMSSDFYGSPKAVAMLNDYIRAVVGRRNTITGQAYGNDPTIQAWQLANEPRPGVSPDVVARHMPAYLAWIDHTAGLIKSIDSHHMVSTGSEGTQGCAESDSCARDAHASPHIDYVTAHIWPQNWSWADPKDLPGTWPTVEKNTRTYFAREVAIAQALNKPLVIEEFGFPRDNGSFDPGTPTTYKDRFYSLIYELALENMRSGGPVAGTHFWAWSGEGRAQHPDHRFQPGDTDYVGDPPHEPQGWYGVFDVDASTQAVIRNHATAVRALASAGRGERG

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
144 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
175 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
180 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
181 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
182 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
183 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
184 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
185 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
186 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
187 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
188 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0.26
Isolates 2.61

Biome Distribution

Category Percentage (%)
Aerial Root 1.31
Bulb 0
Endosphere 11.49
Nodule 0
Rhizoplane 1.57
Rhizosphere 83.03
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0136173 3300037418 Unclassified 2516
2 JGI24736J21556_1000305 3300001904 Bacteria 9007
3 JGI24739J22299_10003454 3300001989 Bacteria 6024
4 JGI24737J22298_10005368 3300001990 Bacteria 4429
5 JGI25150J39212_1000213 3300002774 Bacteria 31530
6 JGI25153J46596_10000036 3300003215 Bacteria 182205
7 Ga0055526_1000948 3300003771 Bacteria 21478
8 Ga0055537_1001825 3300003773 Bacteria 7709
9 Ga0055537_1002993 3300003773 Bacteria 5345
10 Ga0055524_1000180 3300003775 Bacteria 71495
11 Ga0055536_1000775 3300003781 Bacteria 21284
12 Ga0055530_10007997 3300003791 Bacteria 4322
13 Ga0055540_1001281 3300003792 Bacteria 15301
14 Ga0055540_1005532 3300003792 Bacteria 5280
15 Ga0055531_10014204 3300003794 Bacteria 3605
16 Ga0055531_10016981 3300003794 Bacteria 3102
17 Ga0055531_10017508 3300003794 Bacteria 3020
18 Ga0065165_1001869 3300005262 Bacteria 20423
19 Ga0065165_1004474 3300005262 Bacteria 8626
20 Ga0070658_10000087 3300005327 Bacteria 85758
21 Ga0070658_10000199 3300005327 Bacteria 52822
22 Ga0070658_10048918 3300005327 Bacteria 3424
23 Ga0070676_10002120 3300005328 Bacteria 10099
24 Ga0070683_100000786 3300005329 Bacteria 23405
25 Ga0070683_100007519 3300005329 Bacteria 9210
26 Ga0070670_100002050 3300005331 Bacteria 16494
27 Ga0070670_100002581 3300005331 Bacteria 14976
28 Ga0070670_100005253 3300005331 Bacteria 10909
29 Ga0070666_10000190 3300005335 Bacteria 42241
30 Ga0068868_100054407 3300005338 Bacteria 3154
31 Ga0070660_100000084 3300005339 Bacteria 56611
32 Ga0070660_100000665 3300005339 Bacteria 22740
33 Ga0070661_100000050 3300005344 Bacteria 90752
34 Ga0070661_100008483 3300005344 Bacteria 7108
35 Ga0070661_100019589 3300005344 Bacteria 4822
36 Ga0070661_100181967 3300005344 Bacteria 1599
37 Ga0070692_10006464 3300005345 Bacteria 5090
38 Ga0070668_100008177 3300005347 Bacteria 7769
39 Ga0070675_100002531 3300005354 Bacteria 13673
40 Ga0070675_100157971 3300005354 Bacteria 1948
41 Ga0070671_100000305 3300005355 Bacteria 33410
42 Ga0070671_100040651 3300005355 Bacteria 3863
43 Ga0070659_100000117 3300005366 Bacteria 59483
44 Ga0070659_100004192 3300005366 Bacteria 10287
45 Ga0070659_100037614 3300005366 Bacteria 3774
46 Ga0070659_100110087 3300005366 Bacteria 2223
47 Ga0070667_100013546 3300005367 Bacteria 6737
48 Ga0070667_100044162 3300005367 Bacteria 3742
49 Ga0070663_100009987 3300005455 Bacteria 5901
50 Ga0070663_100142427 3300005455 Bacteria 1831
51 Ga0070678_100081274 3300005456 Bacteria 2456
52 Ga0070662_100000025 3300005457 Bacteria 87144
53 Ga0070662_100003303 3300005457 Bacteria 10049
54 Ga0070662_100202485 3300005457 Bacteria 1576
55 Ga0068867_100009731 3300005459 Bacteria 6778
56 Ga0070679_100025183 3300005530 Bacteria 5836
57 Ga0068853_100000061 3300005539 Bacteria 77461
58 Ga0070672_100006497 3300005543 Bacteria 7856
59 Ga0070693_100000099 3300005547 Bacteria 38227
60 Ga0070665_100012759 3300005548 Bacteria 8464
61 Ga0068855_100000326 3300005563 Bacteria 59175
62 Ga0068855_100027240 3300005563 Bacteria 6838
63 Ga0068855_100146577 3300005563 Bacteria 2687
64 Ga0068855_100233627 3300005563 Bacteria 2057
65 Ga0070664_100000012 3300005564 Bacteria 162011
66 Ga0070664_100000093 3300005564 Bacteria 57415
67 Ga0070664_100099510 3300005564 Bacteria 2527
68 Ga0068857_100002322 3300005577 Bacteria 15458
69 Ga0068854_100038055 3300005578 Bacteria 3381
70 Ga0068856_100000552 3300005614 Bacteria 41305
71 Ga0068856_100012005 3300005614 Bacteria 8391
72 Ga0068856_100248565 3300005614 Bacteria 1793
73 Ga0068852_100000691 3300005616 Bacteria 22066
74 Ga0068852_100001871 3300005616 Bacteria 14319
75 Ga0068852_100067709 3300005616 Bacteria 3122
76 Ga0068859_100082879 3300005617 Bacteria 3249
77 Ga0068859_100110974 3300005617 Bacteria 2804
78 Ga0068864_100014319 3300005618 Bacteria 6589
79 Ga0068864_100018967 3300005618 Bacteria 5751
80 Ga0068851_10009005 3300005834 Bacteria 4633
81 Ga0068863_100004593 3300005841 Bacteria 13611
82 Ga0068860_100009115 3300005843 Bacteria 9874
83 Ga0068862_100005021 3300005844 Bacteria 11131
84 Ga0068871_100050593 3300006358 Bacteria 3361
85 Ga0097620_100082880 3300006931 Bacteria 3249
86 Ga0097620_100110971 3300006931 Bacteria 2804
87 Ga0105241_10059214 3300009174 Bacteria 2944
88 Ga0105248_10000258 3300009177 Bacteria 62009
89 Ga0105248_10002223 3300009177 Bacteria 21450
90 Ga0105248_10075524 3300009177 Bacteria 3788
91 Ga0105238_10028305 3300009551 Bacteria 5710
92 Ga0157373_10019070 3300013100 Bacteria 4993
93 Ga0157373_10185048 3300013100 Bacteria 1467
94 Ga0157371_10002335 3300013102 Bacteria 18182
95 Ga0157371_10010873 3300013102 Bacteria 7060
96 Ga0157371_10021335 3300013102 Bacteria 4756
97 Ga0157371_10040259 3300013102 Unclassified 3338
98 Ga0157371_10053846 3300013102 Bacteria 2857
99 Ga0157370_10011105 3300013104 Bacteria 9443
100 Ga0157370_10339859 3300013104 Bacteria 1384
101 Ga0157369_10000354 3300013105 Bacteria 61200
102 Ga0157369_10001231 3300013105 Bacteria 31905
103 Ga0157369_10029722 3300013105 Bacteria 6036
104 Ga0157369_10085857 3300013105 Bacteria 3362
105 Ga0157374_10001400 3300013296 Bacteria 20458
106 Ga0157374_10054636 3300013296 Bacteria 3726
107 Ga0157374_10094790 3300013296 Bacteria 2853
108 Ga0157378_10238395 3300013297 Bacteria 1737
109 Ga0163162_10059201 3300013306 Bacteria 3862
110 Ga0163162_10113989 3300013306 Bacteria 2802
111 Ga0157372_10070448 3300013307 Bacteria 3934
112 Ga0157372_10076844 3300013307 Bacteria 3771
113 Ga0157372_10134673 3300013307 Bacteria 2844
114 Ga0163163_10000222 3300014325 Bacteria 58432
115 Ga0206353_10558927 3300020082 Bacteria 2085
116 Ga0213876_10000178 3300021384 Bacteria 65721
117 Ga0213875_10004821 3300021388 Bacteria 7330
118 Ga0207425_1000037 3300025245 Bacteria 224645
119 Ga0209129_1000363 3300025258 Bacteria 37614
120 Ga0209233_1000058 3300025261 Bacteria 421872
121 Ga0209565_1000012 3300025263 Bacteria 606500
122 Ga0209565_1000427 3300025263 Bacteria 34040
123 Ga0209673_1002832 3300025273 Bacteria 11149
124 Ga0209673_1024065 3300025273 Bacteria 2055
125 Ga0209676_1000046 3300025292 Bacteria 409173
126 Ga0209676_1002287 3300025292 Bacteria 13986
127 Ga0209676_1002861 3300025292 Bacteria 11381
128 Ga0209676_1013050 3300025292 Bacteria 3216
129 Ga0209025_1000117 3300025294 Bacteria 215073
130 Ga0209564_1003622 3300025295 Bacteria 10279
131 Ga0209758_1000103 3300025297 Bacteria 223968
132 Ga0209758_1012477 3300025297 Bacteria 4753
133 Ga0209050_1000001 3300025298 Bacteria 3563507
134 Ga0209050_1006341 3300025298 Bacteria 7038
135 Ga0209050_1014985 3300025298 Bacteria 3292
136 Ga0209256_1000012 3300025299 Bacteria 790371
137 Ga0209051_1003509 3300025303 Bacteria 10253
138 Ga0209257_1000505 3300025304 Bacteria 68565
139 Ga0209257_1005036 3300025304 Bacteria 9613
140 Ga0209257_1005111 3300025304 Bacteria 9510
141 Ga0207680_10001212 3300025903 Bacteria 12214
142 Ga0207680_10030185 3300025903 Bacteria 3054
143 Ga0207680_10061499 3300025903 Bacteria 2290
144 Ga0207647_10022612 3300025904 Bacteria 4173
145 Ga0207647_10040364 3300025904 Bacteria 2940
146 Ga0207647_10060019 3300025904 Bacteria 2326
147 Ga0207645_10000623 3300025907 Bacteria 29375
148 Ga0207645_10114763 3300025907 Bacteria 1745
149 Ga0207705_10000002 3300025909 Bacteria 2046852
150 Ga0207705_10000096 3300025909 Bacteria 105775
151 Ga0207705_10000217 3300025909 Bacteria 57123
152 Ga0207705_10006308 3300025909 Bacteria 8801
153 Ga0207705_10011124 3300025909 Bacteria 6525
154 Ga0207705_10026789 3300025909 Bacteria 4108
155 Ga0207705_10054954 3300025909 Bacteria 2870
156 Ga0207707_10195010 3300025912 Bacteria 1767
157 Ga0207695_10119944 3300025913 Bacteria 2600
158 Ga0207660_10000564 3300025917 Bacteria 24915
159 Ga0207657_10000028 3300025919 Bacteria 141576
160 Ga0207657_10001150 3300025919 Bacteria 28145
161 Ga0207649_10000214 3300025920 Bacteria 47982
162 Ga0207649_10002617 3300025920 Bacteria 9997
163 Ga0207649_10005049 3300025920 Bacteria 7137
164 Ga0207650_10019849 3300025925 Bacteria 4729
165 Ga0207659_10022035 3300025926 Bacteria 4238
166 Ga0207687_10020658 3300025927 Bacteria 4370
167 Ga0207644_10002433 3300025931 Bacteria 11998
168 Ga0207690_10000042 3300025932 Bacteria 120002
169 Ga0207690_10009159 3300025932 Bacteria 5876
170 Ga0207706_10000029 3300025933 Bacteria 146113
171 Ga0207706_10009692 3300025933 Bacteria 8838
172 Ga0207706_10015111 3300025933 Bacteria 6988
173 Ga0207669_10003161 3300025937 Bacteria 7105
174 Ga0207704_10118896 3300025938 Bacteria 1803
175 Ga0207691_10011335 3300025940 Bacteria 8555
176 Ga0207711_10000236 3300025941 Bacteria 59308
177 Ga0207711_10002718 3300025941 Bacteria 15605
178 Ga0207711_10074099 3300025941 Bacteria 2960
179 Ga0207689_10030310 3300025942 Bacteria 4508
180 Ga0207661_10000330 3300025944 Bacteria 30136
181 Ga0207661_10006771 3300025944 Bacteria 8115
182 Ga0207661_10020462 3300025944 Bacteria 4946
183 Ga0207661_10138843 3300025944 Bacteria 2090
184 Ga0207679_10000092 3300025945 Bacteria 78331
185 Ga0207679_10003090 3300025945 Bacteria 10306
186 Ga0207667_10005528 3300025949 Bacteria 15423
187 Ga0207667_10011504 3300025949 Bacteria 10279
188 Ga0207667_10101917 3300025949 Bacteria 2961
189 Ga0207667_10143052 3300025949 Bacteria 2462
190 Ga0207651_10000956 3300025960 Bacteria 12758
191 Ga0207651_10122391 3300025960 Bacteria 1975
192 Ga0207668_10000330 3300025972 Bacteria 30637
193 Ga0207640_10000645 3300025981 Bacteria 20386
194 Ga0207640_10005728 3300025981 Bacteria 6769
195 Ga0207640_10051398 3300025981 Bacteria 2679
196 Ga0207640_10128085 3300025981 Bacteria 1830
197 Ga0207658_10002397 3300025986 Bacteria 13744
198 Ga0207658_10010060 3300025986 Bacteria 6425
199 Ga0207703_10002552 3300026035 Bacteria 15728
200 Ga0207639_10004825 3300026041 Bacteria 9093
201 Ga0207678_10002375 3300026067 Bacteria 17077
202 Ga0207678_10004602 3300026067 Bacteria 12396
203 Ga0207678_10011574 3300026067 Bacteria 7748
204 Ga0207678_10013490 3300026067 Bacteria 7174
205 Ga0207678_10042311 3300026067 Bacteria 3947
206 Ga0207678_10065749 3300026067 Bacteria 3113
207 Ga0207678_10105469 3300026067 Bacteria 2405
208 Ga0207678_10232126 3300026067 Bacteria 1580
209 Ga0207702_10000581 3300026078 Bacteria 40736
210 Ga0207702_10013512 3300026078 Bacteria 6782
211 Ga0207702_10056583 3300026078 Bacteria 3330
212 Ga0207641_10053439 3300026088 Bacteria 3424
213 Ga0207641_10244790 3300026088 Bacteria 1672
214 Ga0207648_10006551 3300026089 Bacteria 11562
215 Ga0207676_10012518 3300026095 Bacteria 6081
216 Ga0207674_10000324 3300026116 Bacteria 60949
217 Ga0207674_10009767 3300026116 Bacteria 10931
218 Ga0207674_10012432 3300026116 Bacteria 9512
219 Ga0207683_10014400 3300026121 Bacteria 6734
220 Ga0207698_10000670 3300026142 Bacteria 19839
221 Ga0207698_10003414 3300026142 Bacteria 9561
222 Ga0207698_10018964 3300026142 Bacteria 4697
223 Ga0207698_10140545 3300026142 Bacteria 2079
224 Ga0268266_10000135 3300028379 Bacteria 141959
225 Ga0268266_10007540 3300028379 Bacteria 9800
226 Ga0268266_10058087 3300028379 Bacteria 3330
227 Ga0268265_10002699 3300028380 Bacteria 13141
228 Ga0268264_10003362 3300028381 Bacteria 13826
229 Ga0307509_10111063 3300031507 Bacteria 2745
230 Ga0307508_10005365 3300031616 Bacteria 12204
231 Ga0307413_10002531 3300031824 Bacteria 7459
232 Ga0307413_10062325 3300031824 Bacteria 2306
233 Ga0307413_10173180 3300031824 Bacteria 1530
234 Ga0307410_10000779 3300031852 Bacteria 13433
235 Ga0307406_10000983 3300031901 Bacteria 15867
236 Ga0307406_10005810 3300031901 Bacteria 6761
237 Ga0307407_10000332 3300031903 Bacteria 14125
238 Ga0307407_10012808 3300031903 Bacteria 4047
239 Ga0307412_10002527 3300031911 Bacteria 10165
240 Ga0307412_10008588 3300031911 Bacteria 5838
241 Ga0307409_100023749 3300031995 Bacteria 4257
242 Ga0307409_100173786 3300031995 Bacteria 1899
243 Ga0307416_100007454 3300032002 Bacteria 6961
244 Ga0307414_10001145 3300032004 Bacteria 13588
245 Ga0307414_10131100 3300032004 Bacteria 1946
246 Ga0307411_10007262 3300032005 Bacteria 5623
247 Ga0307415_100010346 3300032126 Bacteria 5280
248 Ga0307415_100013633 3300032126 Bacteria 4751
249 Ga0373943_0005373 3300035170 Bacteria 5763
250 Ga0373931_0078116 3300035691 Bacteria 1821
251 Ga0373947_0088212 3300035725 Bacteria 1930
252 Ga0373925_0050594 3300037068 Bacteria 3099
253 Ga0395899_0011468 3300037312 Bacteria 6784
254 Ga0395899_0014332 3300037312 Bacteria 6051
255 Ga0395899_0022586 3300037312 Bacteria 4766
256 Ga0395899_0048327 3300037312 Bacteria 3166
257 Ga0395899_0069491 3300037312 Bacteria 2579
258 Ga0395899_0081676 3300037312 Bacteria 2351
259 Ga0395900_0001516 3300037418 Bacteria 27574
260 Ga0395900_0004239 3300037418 Bacteria 15217
261 Ga0395900_0004370 3300037418 Bacteria 14995
262 Ga0395900_0005399 3300037418 Bacteria 13387
263 Ga0395900_0007912 3300037418 Bacteria 10947
264 Ga0395900_0013702 3300037418 Bacteria 8277
265 Ga0395900_0014930 3300037418 Bacteria 7915
266 Ga0395900_0027462 3300037418 Bacteria 5830
267 Ga0395900_0040319 3300037418 Bacteria 4812
268 Ga0395900_0056636 3300037418 Bacteria 4035
269 Ga0395900_0075839 3300037418 Bacteria 3456
270 Ga0395900_0076295 3300037418 Bacteria 3445
271 Ga0395900_0116538 3300037418 Bacteria 2741
272 Ga0395898_0007848 3300037466 Bacteria 11327
273 Ga0395898_0020232 3300037466 Bacteria 6762
274 Ga0395898_0036843 3300037466 Bacteria 4854
275 Ga0395898_0094727 3300037466 Bacteria 2869
276 Ga0395898_0135645 3300037466 Bacteria 2356
277 Ga0395898_0141255 3300037466 Bacteria 2305
278 Ga0395898_0181259 3300037466 Bacteria 2013
279 Ga0395898_0300513 3300037466 Bacteria 1531
280 Ga0395905_0000690 3300037471 Bacteria 44713
281 Ga0395905_0001128 3300037471 Bacteria 33451
282 Ga0395905_0003228 3300037471 Bacteria 17536
283 Ga0395905_0003285 3300037471 Bacteria 17370
284 Ga0395905_0006353 3300037471 Bacteria 11910
285 Ga0395905_0008533 3300037471 Bacteria 10104
286 Ga0395905_0009564 3300037471 Bacteria 9465
287 Ga0395905_0010413 3300037471 Bacteria 9047
288 Ga0395905_0018758 3300037471 Bacteria 6562
289 Ga0395905_0019264 3300037471 Bacteria 6470
290 Ga0395905_0021997 3300037471 Bacteria 6032
291 Ga0395905_0023067 3300037471 Bacteria 5883
292 Ga0395905_0023772 3300037471 Bacteria 5786
293 Ga0395905_0034945 3300037471 Bacteria 4718
294 Ga0395905_0049196 3300037471 Bacteria 3950
295 Ga0395905_0059954 3300037471 Bacteria 3558
296 Ga0395905_0082804 3300037471 Bacteria 3006
297 Ga0395905_0098855 3300037471 Bacteria 2740
298 Ga0395905_0143102 3300037471 Bacteria 2250
299 Ga0395905_0145413 3300037471 Bacteria 2230
300 Ga0395905_0217819 3300037471 Bacteria 1787
301 Ga0436364_1200686 3300037853 Bacteria 14813
302 Ga0395901_0002805 3300038443 Bacteria 17583
303 Ga0395901_0003675 3300038443 Bacteria 15471
304 Ga0395901_0008517 3300038443 Bacteria 10360
305 Ga0395901_0008751 3300038443 Bacteria 10238
306 Ga0395901_0011112 3300038443 Bacteria 9124
307 Ga0395901_0012663 3300038443 Bacteria 8557
308 Ga0395901_0022340 3300038443 Bacteria 6483
309 Ga0395901_0044945 3300038443 Bacteria 4582
310 Ga0395901_0058839 3300038443 Bacteria 3997
311 Ga0395901_0094368 3300038443 Bacteria 3134
312 Ga0395901_0096982 3300038443 Bacteria 3090
313 Ga0395901_0109691 3300038443 Bacteria 2897
314 Ga0395901_0163472 3300038443 Bacteria 2337
315 Ga0395901_0248343 3300038443 Bacteria 1854
316 Ga0436365_1679154 3300039437 Bacteria 73730
317 Ga0439439_0017256 3300041406 Bacteria 1773
318 Ga0439461_0000282 3300041410 Bacteria 7317
319 Ga0439465_0004264 3300041413 Bacteria 4650
320 Ga0439431_0000586 3300041997 Bacteria 7729
321 Ga0439432_003330 3300042006 Bacteria 5968
322 Ga0439446_0006550 3300042156 Bacteria 3042
323 Ga0439458_0000337 3300042157 Bacteria 11754
324 Ga0439434_0001642 3300042435 Bacteria 6468
325 Ga0439434_0016560 3300042435 Bacteria 2203
326 Ga0466969_0067374 3300044656 Bacteria 1727
327 Ga0466965_0067433 3300044683 Bacteria 1796
328 Ga0466966_0000001 3300044684 Bacteria 410376
329 Ga0466966_0003481 3300044684 Bacteria 10375
330 Ga0466966_0066947 3300044684 Bacteria 2257
331 Ga0466961_0011447 3300044693 Bacteria 5674
332 Ga0466961_0037312 3300044693 Bacteria 3118
333 Ga0466961_0059723 3300044693 Bacteria 2424
334 Ga0466961_0060616 3300044693 Bacteria 2406
335 Ga0466963_0010474 3300044694 Bacteria 5612
336 Ga0466963_0037194 3300044694 Bacteria 3177
337 Ga0466963_0216875 3300044694 Bacteria 1339
338 Ga0466971_0003239 3300044719 Bacteria 6951
339 Ga0466968_0002449 3300044735 Bacteria 6809
340 Ga0466970_0071262 3300044765 Bacteria 1869
341 Ga0466970_0089929 3300044765 Bacteria 1666
342 Ga0466957_0001947 3300044842 Bacteria 10969
343 Ga0466957_0003066 3300044842 Bacteria 9086
344 Ga0466957_0004026 3300044842 Bacteria 8133
345 Ga0466957_0008693 3300044842 Bacteria 5783
346 Ga0451576_0000122 3300045051 Bacteria 197797
347 Ga0466958_0000407 3300045836 Bacteria 17665
348 Ga0466958_0024212 3300045836 Bacteria 3572
349 Ga0466958_0041233 3300045836 Bacteria 2776
350 Ga0466958_0085113 3300045836 Bacteria 1950
351 Ga0466967_0004861 3300045976 Bacteria 9174
352 Ga0466967_0159426 3300045976 Bacteria 2116
353 Ga0495585_0104821 3300046492 Bacteria 1509
354 Ga0495598_0000577 3300046537 Bacteria 6907
355 Ga0495598_0028787 3300046537 Bacteria 1543
356 Ga0495621_0003507 3300046539 Bacteria 4329
357 Ga0495633_0006264 3300046558 Bacteria 7093
358 Ga0495669_0002426 3300046684 Bacteria 7622
359 Ga0495670_0001376 3300046691 Bacteria 11891
360 Ga0496107_0118068 3300048910 Bacteria 1953
361 Ga0496109_0094872 3300048912 Bacteria 2762
362 Ga0496110_0001094 3300048913 Bacteria 19097
363 Ga0496111_0026775 3300048914 Bacteria 4073
364 Ga0496115_0005756 3300048918 Bacteria 9026
365 Ga0496115_0062504 3300048918 Bacteria 3004
366 Ga0500651_0091487 3300053093 Bacteria 1872
367 Ga0500566_0002509 3300053094 Bacteria 10901
368 Ga0500658_0002030 3300053134 Bacteria 7899
369 Ga0500658_0002068 3300053134 Bacteria 7807
370 Ga0500568_0016516 3300053139 Bacteria 3280
371 Ga0500616_0105821 3300053153 Bacteria 1367
372 Ga0466962_0000509 3300061719 Bacteria 16925
373 Ga0466962_0006995 3300061719 Bacteria 5407
374 2644126961 2643221622 Bacteria 4212502
375 2644354107 2643221663 Bacteria 3425771
376 2848299468 2848297114 Bacteria 3608511
377 2928028693 2928027323 Bacteria 4382488
378 2946788659 2946787523 Bacteria 4366789
379 2984555507 2984555340 Bacteria 4247089
380 2984566382 2984564862 Bacteria 4339992
381 2990265905 2990265787 Bacteria 3943888
382 2993357395 2993356040 Bacteria 4247105
383 2993696304 2993693658 Bacteria 4040749
384 Ga0395900_0136173
385 JGI24736J21556_1000305
386 JGI24739J22299_10003454
387 JGI24737J22298_10005368
388 JGI25150J39212_1000213
389 JGI25153J46596_10000036
390 Ga0055526_1000948
391 Ga0055537_1001825
392 Ga0055537_1002993
393 Ga0055524_1000180
394 Ga0055536_1000775
395 Ga0055530_10007997
396 Ga0055540_1001281
397 Ga0055540_1005532
398 Ga0055531_10014204
399 Ga0055531_10016981
400 Ga0055531_10017508
401 Ga0065165_1001869
402 Ga0065165_1004474
403 Ga0070658_10000087
404 Ga0070658_10000199
405 Ga0070658_10048918
406 Ga0070676_10002120
407 Ga0070683_100000786
408 Ga0070683_100007519
409 Ga0070670_100002050
410 Ga0070670_100002581
411 Ga0070670_100005253
412 Ga0070666_10000190
413 Ga0068868_100054407
414 Ga0070660_100000084
415 Ga0070660_100000665
416 Ga0070661_100000050
417 Ga0070661_100008483
418 Ga0070661_100019589
419 Ga0070661_100181967
420 Ga0070692_10006464
421 Ga0070668_100008177
422 Ga0070675_100002531
423 Ga0070675_100157971
424 Ga0070671_100000305
425 Ga0070671_100040651
426 Ga0070659_100000117
427 Ga0070659_100004192
428 Ga0070659_100037614
429 Ga0070659_100110087
430 Ga0070667_100013546
431 Ga0070667_100044162
432 Ga0070663_100009987
433 Ga0070663_100142427
434 Ga0070678_100081274
435 Ga0070662_100000025
436 Ga0070662_100003303
437 Ga0070662_100202485
438 Ga0068867_100009731
439 Ga0070679_100025183
440 Ga0068853_100000061
441 Ga0070672_100006497
442 Ga0070693_100000099
443 Ga0070665_100012759
444 Ga0068855_100000326
445 Ga0068855_100027240
446 Ga0068855_100146577
447 Ga0068855_100233627
448 Ga0070664_100000012
449 Ga0070664_100000093
450 Ga0070664_100099510
451 Ga0068857_100002322
452 Ga0068854_100038055
453 Ga0068856_100000552
454 Ga0068856_100012005
455 Ga0068856_100248565
456 Ga0068852_100000691
457 Ga0068852_100001871
458 Ga0068852_100067709
459 Ga0068859_100082879
460 Ga0068859_100110974
461 Ga0068864_100014319
462 Ga0068864_100018967
463 Ga0068851_10009005
464 Ga0068863_100004593
465 Ga0068860_100009115
466 Ga0068862_100005021
467 Ga0068871_100050593
468 Ga0097620_100082880
469 Ga0097620_100110971
470 Ga0105241_10059214
471 Ga0105248_10000258
472 Ga0105248_10002223
473 Ga0105248_10075524
474 Ga0105238_10028305
475 Ga0157373_10019070
476 Ga0157373_10185048
477 Ga0157371_10002335
478 Ga0157371_10010873
479 Ga0157371_10021335
480 Ga0157371_10040259
481 Ga0157371_10053846
482 Ga0157370_10011105
483 Ga0157370_10339859
484 Ga0157369_10000354
485 Ga0157369_10001231
486 Ga0157369_10029722
487 Ga0157369_10085857
488 Ga0157374_10001400
489 Ga0157374_10054636
490 Ga0157374_10094790
491 Ga0157378_10238395
492 Ga0163162_10059201
493 Ga0163162_10113989
494 Ga0157372_10070448
495 Ga0157372_10076844
496 Ga0157372_10134673
497 Ga0163163_10000222
498 Ga0206353_10558927
499 Ga0213876_10000178
500 Ga0213875_10004821
501 Ga0207425_1000037
502 Ga0209129_1000363
503 Ga0209233_1000058
504 Ga0209565_1000012
505 Ga0209565_1000427
506 Ga0209673_1002832
507 Ga0209673_1024065
508 Ga0209676_1000046
509 Ga0209676_1002287
510 Ga0209676_1002861
511 Ga0209676_1013050
512 Ga0209025_1000117
513 Ga0209564_1003622
514 Ga0209758_1000103
515 Ga0209758_1012477
516 Ga0209050_1000001
517 Ga0209050_1006341
518 Ga0209050_1014985
519 Ga0209256_1000012
520 Ga0209051_1003509
521 Ga0209257_1000505
522 Ga0209257_1005036
523 Ga0209257_1005111
524 Ga0207680_10001212
525 Ga0207680_10030185
526 Ga0207680_10061499
527 Ga0207647_10022612
528 Ga0207647_10040364
529 Ga0207647_10060019
530 Ga0207645_10000623
531 Ga0207645_10114763
532 Ga0207705_10000002
533 Ga0207705_10000096
534 Ga0207705_10000217
535 Ga0207705_10006308
536 Ga0207705_10011124
537 Ga0207705_10026789
538 Ga0207705_10054954
539 Ga0207707_10195010
540 Ga0207695_10119944
541 Ga0207660_10000564
542 Ga0207657_10000028
543 Ga0207657_10001150
544 Ga0207649_10000214
545 Ga0207649_10002617
546 Ga0207649_10005049
547 Ga0207650_10019849
548 Ga0207659_10022035
549 Ga0207687_10020658
550 Ga0207644_10002433
551 Ga0207690_10000042
552 Ga0207690_10009159
553 Ga0207706_10000029
554 Ga0207706_10009692
555 Ga0207706_10015111
556 Ga0207669_10003161
557 Ga0207704_10118896
558 Ga0207691_10011335
559 Ga0207711_10000236
560 Ga0207711_10002718
561 Ga0207711_10074099
562 Ga0207689_10030310
563 Ga0207661_10000330
564 Ga0207661_10006771
565 Ga0207661_10020462
566 Ga0207661_10138843
567 Ga0207679_10000092
568 Ga0207679_10003090
569 Ga0207667_10005528
570 Ga0207667_10011504
571 Ga0207667_10101917
572 Ga0207667_10143052
573 Ga0207651_10000956
574 Ga0207651_10122391
575 Ga0207668_10000330
576 Ga0207640_10000645
577 Ga0207640_10005728
578 Ga0207640_10051398
579 Ga0207640_10128085
580 Ga0207658_10002397
581 Ga0207658_10010060
582 Ga0207703_10002552
583 Ga0207639_10004825
584 Ga0207678_10002375
585 Ga0207678_10004602
586 Ga0207678_10011574
587 Ga0207678_10013490
588 Ga0207678_10042311
589 Ga0207678_10065749
590 Ga0207678_10105469
591 Ga0207678_10232126
592 Ga0207702_10000581
593 Ga0207702_10013512
594 Ga0207702_10056583
595 Ga0207641_10053439
596 Ga0207641_10244790
597 Ga0207648_10006551
598 Ga0207676_10012518
599 Ga0207674_10000324
600 Ga0207674_10009767
601 Ga0207674_10012432
602 Ga0207683_10014400
603 Ga0207698_10000670
604 Ga0207698_10003414
605 Ga0207698_10018964
606 Ga0207698_10140545
607 Ga0268266_10000135
608 Ga0268266_10007540
609 Ga0268266_10058087
610 Ga0268265_10002699
611 Ga0268264_10003362
612 Ga0307509_10111063
613 Ga0307508_10005365
614 Ga0307413_10002531
615 Ga0307413_10062325
616 Ga0307413_10173180
617 Ga0307410_10000779
618 Ga0307406_10000983
619 Ga0307406_10005810
620 Ga0307407_10000332
621 Ga0307407_10012808
622 Ga0307412_10002527
623 Ga0307412_10008588
624 Ga0307409_100023749
625 Ga0307409_100173786
626 Ga0307416_100007454
627 Ga0307414_10001145
628 Ga0307414_10131100
629 Ga0307411_10007262
630 Ga0307415_100010346
631 Ga0307415_100013633
632 Ga0373943_0005373
633 Ga0373931_0078116
634 Ga0373947_0088212
635 Ga0373925_0050594
636 Ga0395899_0011468
637 Ga0395899_0014332
638 Ga0395899_0022586
639 Ga0395899_0048327
640 Ga0395899_0069491
641 Ga0395899_0081676
642 Ga0395900_0001516
643 Ga0395900_0004239
644 Ga0395900_0004370
645 Ga0395900_0005399
646 Ga0395900_0007912
647 Ga0395900_0013702
648 Ga0395900_0014930
649 Ga0395900_0027462
650 Ga0395900_0040319
651 Ga0395900_0056636
652 Ga0395900_0075839
653 Ga0395900_0076295
654 Ga0395900_0116538
655 Ga0395898_0007848
656 Ga0395898_0020232
657 Ga0395898_0036843
658 Ga0395898_0094727
659 Ga0395898_0135645
660 Ga0395898_0141255
661 Ga0395898_0181259
662 Ga0395898_0300513
663 Ga0395905_0000690
664 Ga0395905_0001128
665 Ga0395905_0003228
666 Ga0395905_0003285
667 Ga0395905_0006353
668 Ga0395905_0008533
669 Ga0395905_0009564
670 Ga0395905_0010413
671 Ga0395905_0018758
672 Ga0395905_0019264
673 Ga0395905_0021997
674 Ga0395905_0023067
675 Ga0395905_0023772
676 Ga0395905_0034945
677 Ga0395905_0049196
678 Ga0395905_0059954
679 Ga0395905_0082804
680 Ga0395905_0098855
681 Ga0395905_0143102
682 Ga0395905_0145413
683 Ga0395905_0217819
684 Ga0436364_1200686
685 Ga0395901_0002805
686 Ga0395901_0003675
687 Ga0395901_0008517
688 Ga0395901_0008751
689 Ga0395901_0011112
690 Ga0395901_0012663
691 Ga0395901_0022340
692 Ga0395901_0044945
693 Ga0395901_0058839
694 Ga0395901_0094368
695 Ga0395901_0096982
696 Ga0395901_0109691
697 Ga0395901_0163472
698 Ga0395901_0248343
699 Ga0436365_1679154
700 Ga0439439_0017256
701 Ga0439461_0000282
702 Ga0439465_0004264
703 Ga0439431_0000586
704 Ga0439432_003330
705 Ga0439446_0006550
706 Ga0439458_0000337
707 Ga0439434_0001642
708 Ga0439434_0016560
709 Ga0466969_0067374
710 Ga0466965_0067433
711 Ga0466966_0000001
712 Ga0466966_0003481
713 Ga0466966_0066947
714 Ga0466961_0011447
715 Ga0466961_0037312
716 Ga0466961_0059723
717 Ga0466961_0060616
718 Ga0466963_0010474
719 Ga0466963_0037194
720 Ga0466963_0216875
721 Ga0466971_0003239
722 Ga0466968_0002449
723 Ga0466970_0071262
724 Ga0466970_0089929
725 Ga0466957_0001947
726 Ga0466957_0003066
727 Ga0466957_0004026
728 Ga0466957_0008693
729 Ga0451576_0000122
730 Ga0466958_0000407
731 Ga0466958_0024212
732 Ga0466958_0041233
733 Ga0466958_0085113
734 Ga0466967_0004861
735 Ga0466967_0159426
736 Ga0495585_0104821
737 Ga0495598_0000577
738 Ga0495598_0028787
739 Ga0495621_0003507
740 Ga0495633_0006264
741 Ga0495669_0002426
742 Ga0495670_0001376
743 Ga0496107_0118068
744 Ga0496109_0094872
745 Ga0496110_0001094
746 Ga0496111_0026775
747 Ga0496115_0005756
748 Ga0496115_0062504
749 Ga0500651_0091487
750 Ga0500566_0002509
751 Ga0500658_0002030
752 Ga0500658_0002068
753 Ga0500568_0016516
754 Ga0500616_0105821
755 Ga0466962_0000509
756 Ga0466962_0006995
757 2644126961
758 2644354107
759 2848299468
760 2928028693
761 2946788659
762 2984555507
763 2984566382
764 2990265905
765 2993357395
766 2993696304

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uz4-assembly1.cif.gz_A common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis 0.9706 12 420
1uz4-assembly1.cif.gz_A common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis 0.959 12 420
4lyr-assembly1.cif.gz_A glycoside hydrolase family 5 mannosidase from rhizomucor miehei, e301a mutant 0.9162 11 425
4lyp-assembly2.cif.gz_B crystal structure of glycoside hydrolase family 5 mannosidase from rhizomucor miehei 0.9148 9 425
4nrr-assembly1.cif.gz_A crystal structure of glycoside hydrolase family 5 mannosidase (e202a mutant) from rhizomucor miehei in complex with mannosyl-fructose 0.9104 9 425
ID Description Score Start End Superfamily
1uz4A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9706 12 420 3.20.20.80
1uz4A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.959 12 420 3.20.20.80
4lypB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9148 9 425 3.20.20.80
4lypB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.904 9 425 3.20.20.80
af_Q9FZ29_25_401_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8566 11 423 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A7G9SBC3-F1-model_v4 Mannanase 0.9873 12 393 GO:0016985
AF-A0A0Q4I613-F1-model_v4 Mannanase 0.9853 19 423 GO:0000272
GO:0016985
AF-A0A4R2P4W4-F1-model_v4 Mannan endo-1,4-beta-mannosidase 0.9851 34 423 GO:0016985
AF-A0A7K3MZ94-F1-model_v4 Beta-mannanase 0.983 221 420 GO:0016985
AF-A0A258KBN2-F1-model_v4 Mannanase 0.9812 11 368 GO:0016985

Map