F429653
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 383 | 188 | 766 | 440 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0136173|Ga0395900_0136173_499_1998 |
| Length | 499 |
| Sequence | VALRQGLRDGSCLTAFFPIFVFLNTLIEDAMRAHCRSVIFNGEIEMTELTRRQALAQVSALAAACAVSPLSAAVPSNKFIHRAGSRLIRDGQPWRYAGTNMWYAAYLGADAPYGNRARLQRELDRVAGLGIQSIRILGSSELSPLLHSVRPTFRDQTTHYNETLLQGLDFALAEMGKRNIRAVIYLANFWEWSGGFMTYLYWTNGGHYLNMNDPAHPWPQFPDMSSDFYGSPKAVAMLNDYIRAVVGRRNTITGQAYGNDPTIQAWQLANEPRPGVSPDVVARHMPAYLAWIDHTAGLIKSIDSHHMVSTGSEGTQGCAESDSCARDAHASPHIDYVTAHIWPQNWSWADPKDLPGTWPTVEKNTRTYFAREVAIAQALNKPLVIEEFGFPRDNGSFDPGTPTTYKDRFYSLIYELALENMRSGGPVAGTHFWAWSGEGRAQHPDHRFQPGDTDYVGDPPHEPQGWYGVFDVDASTQAVIRNHATAVRALASAGRGERG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 66 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 67 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 121 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 122 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 123 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 124 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 125 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 126 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 130 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 142 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 143 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 144 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 145 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 146 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 147 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 148 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 149 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 150 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 151 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 152 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 153 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 154 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 155 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 156 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 157 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 158 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 159 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 160 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 169 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 171 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 172 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 173 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 174 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 175 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 176 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 177 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 178 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 179 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 180 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 181 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 182 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 183 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 184 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 185 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 186 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 187 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 188 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.13 |
| Metatranscriptomes | 0.26 |
| Isolates | 2.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.31 |
| Bulb | 0 |
| Endosphere | 11.49 |
| Nodule | 0 |
| Rhizoplane | 1.57 |
| Rhizosphere | 83.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0136173 | 3300037418 | Unclassified | 2516 |
| 2 | JGI24736J21556_1000305 | 3300001904 | Bacteria | 9007 |
| 3 | JGI24739J22299_10003454 | 3300001989 | Bacteria | 6024 |
| 4 | JGI24737J22298_10005368 | 3300001990 | Bacteria | 4429 |
| 5 | JGI25150J39212_1000213 | 3300002774 | Bacteria | 31530 |
| 6 | JGI25153J46596_10000036 | 3300003215 | Bacteria | 182205 |
| 7 | Ga0055526_1000948 | 3300003771 | Bacteria | 21478 |
| 8 | Ga0055537_1001825 | 3300003773 | Bacteria | 7709 |
| 9 | Ga0055537_1002993 | 3300003773 | Bacteria | 5345 |
| 10 | Ga0055524_1000180 | 3300003775 | Bacteria | 71495 |
| 11 | Ga0055536_1000775 | 3300003781 | Bacteria | 21284 |
| 12 | Ga0055530_10007997 | 3300003791 | Bacteria | 4322 |
| 13 | Ga0055540_1001281 | 3300003792 | Bacteria | 15301 |
| 14 | Ga0055540_1005532 | 3300003792 | Bacteria | 5280 |
| 15 | Ga0055531_10014204 | 3300003794 | Bacteria | 3605 |
| 16 | Ga0055531_10016981 | 3300003794 | Bacteria | 3102 |
| 17 | Ga0055531_10017508 | 3300003794 | Bacteria | 3020 |
| 18 | Ga0065165_1001869 | 3300005262 | Bacteria | 20423 |
| 19 | Ga0065165_1004474 | 3300005262 | Bacteria | 8626 |
| 20 | Ga0070658_10000087 | 3300005327 | Bacteria | 85758 |
| 21 | Ga0070658_10000199 | 3300005327 | Bacteria | 52822 |
| 22 | Ga0070658_10048918 | 3300005327 | Bacteria | 3424 |
| 23 | Ga0070676_10002120 | 3300005328 | Bacteria | 10099 |
| 24 | Ga0070683_100000786 | 3300005329 | Bacteria | 23405 |
| 25 | Ga0070683_100007519 | 3300005329 | Bacteria | 9210 |
| 26 | Ga0070670_100002050 | 3300005331 | Bacteria | 16494 |
| 27 | Ga0070670_100002581 | 3300005331 | Bacteria | 14976 |
| 28 | Ga0070670_100005253 | 3300005331 | Bacteria | 10909 |
| 29 | Ga0070666_10000190 | 3300005335 | Bacteria | 42241 |
| 30 | Ga0068868_100054407 | 3300005338 | Bacteria | 3154 |
| 31 | Ga0070660_100000084 | 3300005339 | Bacteria | 56611 |
| 32 | Ga0070660_100000665 | 3300005339 | Bacteria | 22740 |
| 33 | Ga0070661_100000050 | 3300005344 | Bacteria | 90752 |
| 34 | Ga0070661_100008483 | 3300005344 | Bacteria | 7108 |
| 35 | Ga0070661_100019589 | 3300005344 | Bacteria | 4822 |
| 36 | Ga0070661_100181967 | 3300005344 | Bacteria | 1599 |
| 37 | Ga0070692_10006464 | 3300005345 | Bacteria | 5090 |
| 38 | Ga0070668_100008177 | 3300005347 | Bacteria | 7769 |
| 39 | Ga0070675_100002531 | 3300005354 | Bacteria | 13673 |
| 40 | Ga0070675_100157971 | 3300005354 | Bacteria | 1948 |
| 41 | Ga0070671_100000305 | 3300005355 | Bacteria | 33410 |
| 42 | Ga0070671_100040651 | 3300005355 | Bacteria | 3863 |
| 43 | Ga0070659_100000117 | 3300005366 | Bacteria | 59483 |
| 44 | Ga0070659_100004192 | 3300005366 | Bacteria | 10287 |
| 45 | Ga0070659_100037614 | 3300005366 | Bacteria | 3774 |
| 46 | Ga0070659_100110087 | 3300005366 | Bacteria | 2223 |
| 47 | Ga0070667_100013546 | 3300005367 | Bacteria | 6737 |
| 48 | Ga0070667_100044162 | 3300005367 | Bacteria | 3742 |
| 49 | Ga0070663_100009987 | 3300005455 | Bacteria | 5901 |
| 50 | Ga0070663_100142427 | 3300005455 | Bacteria | 1831 |
| 51 | Ga0070678_100081274 | 3300005456 | Bacteria | 2456 |
| 52 | Ga0070662_100000025 | 3300005457 | Bacteria | 87144 |
| 53 | Ga0070662_100003303 | 3300005457 | Bacteria | 10049 |
| 54 | Ga0070662_100202485 | 3300005457 | Bacteria | 1576 |
| 55 | Ga0068867_100009731 | 3300005459 | Bacteria | 6778 |
| 56 | Ga0070679_100025183 | 3300005530 | Bacteria | 5836 |
| 57 | Ga0068853_100000061 | 3300005539 | Bacteria | 77461 |
| 58 | Ga0070672_100006497 | 3300005543 | Bacteria | 7856 |
| 59 | Ga0070693_100000099 | 3300005547 | Bacteria | 38227 |
| 60 | Ga0070665_100012759 | 3300005548 | Bacteria | 8464 |
| 61 | Ga0068855_100000326 | 3300005563 | Bacteria | 59175 |
| 62 | Ga0068855_100027240 | 3300005563 | Bacteria | 6838 |
| 63 | Ga0068855_100146577 | 3300005563 | Bacteria | 2687 |
| 64 | Ga0068855_100233627 | 3300005563 | Bacteria | 2057 |
| 65 | Ga0070664_100000012 | 3300005564 | Bacteria | 162011 |
| 66 | Ga0070664_100000093 | 3300005564 | Bacteria | 57415 |
| 67 | Ga0070664_100099510 | 3300005564 | Bacteria | 2527 |
| 68 | Ga0068857_100002322 | 3300005577 | Bacteria | 15458 |
| 69 | Ga0068854_100038055 | 3300005578 | Bacteria | 3381 |
| 70 | Ga0068856_100000552 | 3300005614 | Bacteria | 41305 |
| 71 | Ga0068856_100012005 | 3300005614 | Bacteria | 8391 |
| 72 | Ga0068856_100248565 | 3300005614 | Bacteria | 1793 |
| 73 | Ga0068852_100000691 | 3300005616 | Bacteria | 22066 |
| 74 | Ga0068852_100001871 | 3300005616 | Bacteria | 14319 |
| 75 | Ga0068852_100067709 | 3300005616 | Bacteria | 3122 |
| 76 | Ga0068859_100082879 | 3300005617 | Bacteria | 3249 |
| 77 | Ga0068859_100110974 | 3300005617 | Bacteria | 2804 |
| 78 | Ga0068864_100014319 | 3300005618 | Bacteria | 6589 |
| 79 | Ga0068864_100018967 | 3300005618 | Bacteria | 5751 |
| 80 | Ga0068851_10009005 | 3300005834 | Bacteria | 4633 |
| 81 | Ga0068863_100004593 | 3300005841 | Bacteria | 13611 |
| 82 | Ga0068860_100009115 | 3300005843 | Bacteria | 9874 |
| 83 | Ga0068862_100005021 | 3300005844 | Bacteria | 11131 |
| 84 | Ga0068871_100050593 | 3300006358 | Bacteria | 3361 |
| 85 | Ga0097620_100082880 | 3300006931 | Bacteria | 3249 |
| 86 | Ga0097620_100110971 | 3300006931 | Bacteria | 2804 |
| 87 | Ga0105241_10059214 | 3300009174 | Bacteria | 2944 |
| 88 | Ga0105248_10000258 | 3300009177 | Bacteria | 62009 |
| 89 | Ga0105248_10002223 | 3300009177 | Bacteria | 21450 |
| 90 | Ga0105248_10075524 | 3300009177 | Bacteria | 3788 |
| 91 | Ga0105238_10028305 | 3300009551 | Bacteria | 5710 |
| 92 | Ga0157373_10019070 | 3300013100 | Bacteria | 4993 |
| 93 | Ga0157373_10185048 | 3300013100 | Bacteria | 1467 |
| 94 | Ga0157371_10002335 | 3300013102 | Bacteria | 18182 |
| 95 | Ga0157371_10010873 | 3300013102 | Bacteria | 7060 |
| 96 | Ga0157371_10021335 | 3300013102 | Bacteria | 4756 |
| 97 | Ga0157371_10040259 | 3300013102 | Unclassified | 3338 |
| 98 | Ga0157371_10053846 | 3300013102 | Bacteria | 2857 |
| 99 | Ga0157370_10011105 | 3300013104 | Bacteria | 9443 |
| 100 | Ga0157370_10339859 | 3300013104 | Bacteria | 1384 |
| 101 | Ga0157369_10000354 | 3300013105 | Bacteria | 61200 |
| 102 | Ga0157369_10001231 | 3300013105 | Bacteria | 31905 |
| 103 | Ga0157369_10029722 | 3300013105 | Bacteria | 6036 |
| 104 | Ga0157369_10085857 | 3300013105 | Bacteria | 3362 |
| 105 | Ga0157374_10001400 | 3300013296 | Bacteria | 20458 |
| 106 | Ga0157374_10054636 | 3300013296 | Bacteria | 3726 |
| 107 | Ga0157374_10094790 | 3300013296 | Bacteria | 2853 |
| 108 | Ga0157378_10238395 | 3300013297 | Bacteria | 1737 |
| 109 | Ga0163162_10059201 | 3300013306 | Bacteria | 3862 |
| 110 | Ga0163162_10113989 | 3300013306 | Bacteria | 2802 |
| 111 | Ga0157372_10070448 | 3300013307 | Bacteria | 3934 |
| 112 | Ga0157372_10076844 | 3300013307 | Bacteria | 3771 |
| 113 | Ga0157372_10134673 | 3300013307 | Bacteria | 2844 |
| 114 | Ga0163163_10000222 | 3300014325 | Bacteria | 58432 |
| 115 | Ga0206353_10558927 | 3300020082 | Bacteria | 2085 |
| 116 | Ga0213876_10000178 | 3300021384 | Bacteria | 65721 |
| 117 | Ga0213875_10004821 | 3300021388 | Bacteria | 7330 |
| 118 | Ga0207425_1000037 | 3300025245 | Bacteria | 224645 |
| 119 | Ga0209129_1000363 | 3300025258 | Bacteria | 37614 |
| 120 | Ga0209233_1000058 | 3300025261 | Bacteria | 421872 |
| 121 | Ga0209565_1000012 | 3300025263 | Bacteria | 606500 |
| 122 | Ga0209565_1000427 | 3300025263 | Bacteria | 34040 |
| 123 | Ga0209673_1002832 | 3300025273 | Bacteria | 11149 |
| 124 | Ga0209673_1024065 | 3300025273 | Bacteria | 2055 |
| 125 | Ga0209676_1000046 | 3300025292 | Bacteria | 409173 |
| 126 | Ga0209676_1002287 | 3300025292 | Bacteria | 13986 |
| 127 | Ga0209676_1002861 | 3300025292 | Bacteria | 11381 |
| 128 | Ga0209676_1013050 | 3300025292 | Bacteria | 3216 |
| 129 | Ga0209025_1000117 | 3300025294 | Bacteria | 215073 |
| 130 | Ga0209564_1003622 | 3300025295 | Bacteria | 10279 |
| 131 | Ga0209758_1000103 | 3300025297 | Bacteria | 223968 |
| 132 | Ga0209758_1012477 | 3300025297 | Bacteria | 4753 |
| 133 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 134 | Ga0209050_1006341 | 3300025298 | Bacteria | 7038 |
| 135 | Ga0209050_1014985 | 3300025298 | Bacteria | 3292 |
| 136 | Ga0209256_1000012 | 3300025299 | Bacteria | 790371 |
| 137 | Ga0209051_1003509 | 3300025303 | Bacteria | 10253 |
| 138 | Ga0209257_1000505 | 3300025304 | Bacteria | 68565 |
| 139 | Ga0209257_1005036 | 3300025304 | Bacteria | 9613 |
| 140 | Ga0209257_1005111 | 3300025304 | Bacteria | 9510 |
| 141 | Ga0207680_10001212 | 3300025903 | Bacteria | 12214 |
| 142 | Ga0207680_10030185 | 3300025903 | Bacteria | 3054 |
| 143 | Ga0207680_10061499 | 3300025903 | Bacteria | 2290 |
| 144 | Ga0207647_10022612 | 3300025904 | Bacteria | 4173 |
| 145 | Ga0207647_10040364 | 3300025904 | Bacteria | 2940 |
| 146 | Ga0207647_10060019 | 3300025904 | Bacteria | 2326 |
| 147 | Ga0207645_10000623 | 3300025907 | Bacteria | 29375 |
| 148 | Ga0207645_10114763 | 3300025907 | Bacteria | 1745 |
| 149 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 150 | Ga0207705_10000096 | 3300025909 | Bacteria | 105775 |
| 151 | Ga0207705_10000217 | 3300025909 | Bacteria | 57123 |
| 152 | Ga0207705_10006308 | 3300025909 | Bacteria | 8801 |
| 153 | Ga0207705_10011124 | 3300025909 | Bacteria | 6525 |
| 154 | Ga0207705_10026789 | 3300025909 | Bacteria | 4108 |
| 155 | Ga0207705_10054954 | 3300025909 | Bacteria | 2870 |
| 156 | Ga0207707_10195010 | 3300025912 | Bacteria | 1767 |
| 157 | Ga0207695_10119944 | 3300025913 | Bacteria | 2600 |
| 158 | Ga0207660_10000564 | 3300025917 | Bacteria | 24915 |
| 159 | Ga0207657_10000028 | 3300025919 | Bacteria | 141576 |
| 160 | Ga0207657_10001150 | 3300025919 | Bacteria | 28145 |
| 161 | Ga0207649_10000214 | 3300025920 | Bacteria | 47982 |
| 162 | Ga0207649_10002617 | 3300025920 | Bacteria | 9997 |
| 163 | Ga0207649_10005049 | 3300025920 | Bacteria | 7137 |
| 164 | Ga0207650_10019849 | 3300025925 | Bacteria | 4729 |
| 165 | Ga0207659_10022035 | 3300025926 | Bacteria | 4238 |
| 166 | Ga0207687_10020658 | 3300025927 | Bacteria | 4370 |
| 167 | Ga0207644_10002433 | 3300025931 | Bacteria | 11998 |
| 168 | Ga0207690_10000042 | 3300025932 | Bacteria | 120002 |
| 169 | Ga0207690_10009159 | 3300025932 | Bacteria | 5876 |
| 170 | Ga0207706_10000029 | 3300025933 | Bacteria | 146113 |
| 171 | Ga0207706_10009692 | 3300025933 | Bacteria | 8838 |
| 172 | Ga0207706_10015111 | 3300025933 | Bacteria | 6988 |
| 173 | Ga0207669_10003161 | 3300025937 | Bacteria | 7105 |
| 174 | Ga0207704_10118896 | 3300025938 | Bacteria | 1803 |
| 175 | Ga0207691_10011335 | 3300025940 | Bacteria | 8555 |
| 176 | Ga0207711_10000236 | 3300025941 | Bacteria | 59308 |
| 177 | Ga0207711_10002718 | 3300025941 | Bacteria | 15605 |
| 178 | Ga0207711_10074099 | 3300025941 | Bacteria | 2960 |
| 179 | Ga0207689_10030310 | 3300025942 | Bacteria | 4508 |
| 180 | Ga0207661_10000330 | 3300025944 | Bacteria | 30136 |
| 181 | Ga0207661_10006771 | 3300025944 | Bacteria | 8115 |
| 182 | Ga0207661_10020462 | 3300025944 | Bacteria | 4946 |
| 183 | Ga0207661_10138843 | 3300025944 | Bacteria | 2090 |
| 184 | Ga0207679_10000092 | 3300025945 | Bacteria | 78331 |
| 185 | Ga0207679_10003090 | 3300025945 | Bacteria | 10306 |
| 186 | Ga0207667_10005528 | 3300025949 | Bacteria | 15423 |
| 187 | Ga0207667_10011504 | 3300025949 | Bacteria | 10279 |
| 188 | Ga0207667_10101917 | 3300025949 | Bacteria | 2961 |
| 189 | Ga0207667_10143052 | 3300025949 | Bacteria | 2462 |
| 190 | Ga0207651_10000956 | 3300025960 | Bacteria | 12758 |
| 191 | Ga0207651_10122391 | 3300025960 | Bacteria | 1975 |
| 192 | Ga0207668_10000330 | 3300025972 | Bacteria | 30637 |
| 193 | Ga0207640_10000645 | 3300025981 | Bacteria | 20386 |
| 194 | Ga0207640_10005728 | 3300025981 | Bacteria | 6769 |
| 195 | Ga0207640_10051398 | 3300025981 | Bacteria | 2679 |
| 196 | Ga0207640_10128085 | 3300025981 | Bacteria | 1830 |
| 197 | Ga0207658_10002397 | 3300025986 | Bacteria | 13744 |
| 198 | Ga0207658_10010060 | 3300025986 | Bacteria | 6425 |
| 199 | Ga0207703_10002552 | 3300026035 | Bacteria | 15728 |
| 200 | Ga0207639_10004825 | 3300026041 | Bacteria | 9093 |
| 201 | Ga0207678_10002375 | 3300026067 | Bacteria | 17077 |
| 202 | Ga0207678_10004602 | 3300026067 | Bacteria | 12396 |
| 203 | Ga0207678_10011574 | 3300026067 | Bacteria | 7748 |
| 204 | Ga0207678_10013490 | 3300026067 | Bacteria | 7174 |
| 205 | Ga0207678_10042311 | 3300026067 | Bacteria | 3947 |
| 206 | Ga0207678_10065749 | 3300026067 | Bacteria | 3113 |
| 207 | Ga0207678_10105469 | 3300026067 | Bacteria | 2405 |
| 208 | Ga0207678_10232126 | 3300026067 | Bacteria | 1580 |
| 209 | Ga0207702_10000581 | 3300026078 | Bacteria | 40736 |
| 210 | Ga0207702_10013512 | 3300026078 | Bacteria | 6782 |
| 211 | Ga0207702_10056583 | 3300026078 | Bacteria | 3330 |
| 212 | Ga0207641_10053439 | 3300026088 | Bacteria | 3424 |
| 213 | Ga0207641_10244790 | 3300026088 | Bacteria | 1672 |
| 214 | Ga0207648_10006551 | 3300026089 | Bacteria | 11562 |
| 215 | Ga0207676_10012518 | 3300026095 | Bacteria | 6081 |
| 216 | Ga0207674_10000324 | 3300026116 | Bacteria | 60949 |
| 217 | Ga0207674_10009767 | 3300026116 | Bacteria | 10931 |
| 218 | Ga0207674_10012432 | 3300026116 | Bacteria | 9512 |
| 219 | Ga0207683_10014400 | 3300026121 | Bacteria | 6734 |
| 220 | Ga0207698_10000670 | 3300026142 | Bacteria | 19839 |
| 221 | Ga0207698_10003414 | 3300026142 | Bacteria | 9561 |
| 222 | Ga0207698_10018964 | 3300026142 | Bacteria | 4697 |
| 223 | Ga0207698_10140545 | 3300026142 | Bacteria | 2079 |
| 224 | Ga0268266_10000135 | 3300028379 | Bacteria | 141959 |
| 225 | Ga0268266_10007540 | 3300028379 | Bacteria | 9800 |
| 226 | Ga0268266_10058087 | 3300028379 | Bacteria | 3330 |
| 227 | Ga0268265_10002699 | 3300028380 | Bacteria | 13141 |
| 228 | Ga0268264_10003362 | 3300028381 | Bacteria | 13826 |
| 229 | Ga0307509_10111063 | 3300031507 | Bacteria | 2745 |
| 230 | Ga0307508_10005365 | 3300031616 | Bacteria | 12204 |
| 231 | Ga0307413_10002531 | 3300031824 | Bacteria | 7459 |
| 232 | Ga0307413_10062325 | 3300031824 | Bacteria | 2306 |
| 233 | Ga0307413_10173180 | 3300031824 | Bacteria | 1530 |
| 234 | Ga0307410_10000779 | 3300031852 | Bacteria | 13433 |
| 235 | Ga0307406_10000983 | 3300031901 | Bacteria | 15867 |
| 236 | Ga0307406_10005810 | 3300031901 | Bacteria | 6761 |
| 237 | Ga0307407_10000332 | 3300031903 | Bacteria | 14125 |
| 238 | Ga0307407_10012808 | 3300031903 | Bacteria | 4047 |
| 239 | Ga0307412_10002527 | 3300031911 | Bacteria | 10165 |
| 240 | Ga0307412_10008588 | 3300031911 | Bacteria | 5838 |
| 241 | Ga0307409_100023749 | 3300031995 | Bacteria | 4257 |
| 242 | Ga0307409_100173786 | 3300031995 | Bacteria | 1899 |
| 243 | Ga0307416_100007454 | 3300032002 | Bacteria | 6961 |
| 244 | Ga0307414_10001145 | 3300032004 | Bacteria | 13588 |
| 245 | Ga0307414_10131100 | 3300032004 | Bacteria | 1946 |
| 246 | Ga0307411_10007262 | 3300032005 | Bacteria | 5623 |
| 247 | Ga0307415_100010346 | 3300032126 | Bacteria | 5280 |
| 248 | Ga0307415_100013633 | 3300032126 | Bacteria | 4751 |
| 249 | Ga0373943_0005373 | 3300035170 | Bacteria | 5763 |
| 250 | Ga0373931_0078116 | 3300035691 | Bacteria | 1821 |
| 251 | Ga0373947_0088212 | 3300035725 | Bacteria | 1930 |
| 252 | Ga0373925_0050594 | 3300037068 | Bacteria | 3099 |
| 253 | Ga0395899_0011468 | 3300037312 | Bacteria | 6784 |
| 254 | Ga0395899_0014332 | 3300037312 | Bacteria | 6051 |
| 255 | Ga0395899_0022586 | 3300037312 | Bacteria | 4766 |
| 256 | Ga0395899_0048327 | 3300037312 | Bacteria | 3166 |
| 257 | Ga0395899_0069491 | 3300037312 | Bacteria | 2579 |
| 258 | Ga0395899_0081676 | 3300037312 | Bacteria | 2351 |
| 259 | Ga0395900_0001516 | 3300037418 | Bacteria | 27574 |
| 260 | Ga0395900_0004239 | 3300037418 | Bacteria | 15217 |
| 261 | Ga0395900_0004370 | 3300037418 | Bacteria | 14995 |
| 262 | Ga0395900_0005399 | 3300037418 | Bacteria | 13387 |
| 263 | Ga0395900_0007912 | 3300037418 | Bacteria | 10947 |
| 264 | Ga0395900_0013702 | 3300037418 | Bacteria | 8277 |
| 265 | Ga0395900_0014930 | 3300037418 | Bacteria | 7915 |
| 266 | Ga0395900_0027462 | 3300037418 | Bacteria | 5830 |
| 267 | Ga0395900_0040319 | 3300037418 | Bacteria | 4812 |
| 268 | Ga0395900_0056636 | 3300037418 | Bacteria | 4035 |
| 269 | Ga0395900_0075839 | 3300037418 | Bacteria | 3456 |
| 270 | Ga0395900_0076295 | 3300037418 | Bacteria | 3445 |
| 271 | Ga0395900_0116538 | 3300037418 | Bacteria | 2741 |
| 272 | Ga0395898_0007848 | 3300037466 | Bacteria | 11327 |
| 273 | Ga0395898_0020232 | 3300037466 | Bacteria | 6762 |
| 274 | Ga0395898_0036843 | 3300037466 | Bacteria | 4854 |
| 275 | Ga0395898_0094727 | 3300037466 | Bacteria | 2869 |
| 276 | Ga0395898_0135645 | 3300037466 | Bacteria | 2356 |
| 277 | Ga0395898_0141255 | 3300037466 | Bacteria | 2305 |
| 278 | Ga0395898_0181259 | 3300037466 | Bacteria | 2013 |
| 279 | Ga0395898_0300513 | 3300037466 | Bacteria | 1531 |
| 280 | Ga0395905_0000690 | 3300037471 | Bacteria | 44713 |
| 281 | Ga0395905_0001128 | 3300037471 | Bacteria | 33451 |
| 282 | Ga0395905_0003228 | 3300037471 | Bacteria | 17536 |
| 283 | Ga0395905_0003285 | 3300037471 | Bacteria | 17370 |
| 284 | Ga0395905_0006353 | 3300037471 | Bacteria | 11910 |
| 285 | Ga0395905_0008533 | 3300037471 | Bacteria | 10104 |
| 286 | Ga0395905_0009564 | 3300037471 | Bacteria | 9465 |
| 287 | Ga0395905_0010413 | 3300037471 | Bacteria | 9047 |
| 288 | Ga0395905_0018758 | 3300037471 | Bacteria | 6562 |
| 289 | Ga0395905_0019264 | 3300037471 | Bacteria | 6470 |
| 290 | Ga0395905_0021997 | 3300037471 | Bacteria | 6032 |
| 291 | Ga0395905_0023067 | 3300037471 | Bacteria | 5883 |
| 292 | Ga0395905_0023772 | 3300037471 | Bacteria | 5786 |
| 293 | Ga0395905_0034945 | 3300037471 | Bacteria | 4718 |
| 294 | Ga0395905_0049196 | 3300037471 | Bacteria | 3950 |
| 295 | Ga0395905_0059954 | 3300037471 | Bacteria | 3558 |
| 296 | Ga0395905_0082804 | 3300037471 | Bacteria | 3006 |
| 297 | Ga0395905_0098855 | 3300037471 | Bacteria | 2740 |
| 298 | Ga0395905_0143102 | 3300037471 | Bacteria | 2250 |
| 299 | Ga0395905_0145413 | 3300037471 | Bacteria | 2230 |
| 300 | Ga0395905_0217819 | 3300037471 | Bacteria | 1787 |
| 301 | Ga0436364_1200686 | 3300037853 | Bacteria | 14813 |
| 302 | Ga0395901_0002805 | 3300038443 | Bacteria | 17583 |
| 303 | Ga0395901_0003675 | 3300038443 | Bacteria | 15471 |
| 304 | Ga0395901_0008517 | 3300038443 | Bacteria | 10360 |
| 305 | Ga0395901_0008751 | 3300038443 | Bacteria | 10238 |
| 306 | Ga0395901_0011112 | 3300038443 | Bacteria | 9124 |
| 307 | Ga0395901_0012663 | 3300038443 | Bacteria | 8557 |
| 308 | Ga0395901_0022340 | 3300038443 | Bacteria | 6483 |
| 309 | Ga0395901_0044945 | 3300038443 | Bacteria | 4582 |
| 310 | Ga0395901_0058839 | 3300038443 | Bacteria | 3997 |
| 311 | Ga0395901_0094368 | 3300038443 | Bacteria | 3134 |
| 312 | Ga0395901_0096982 | 3300038443 | Bacteria | 3090 |
| 313 | Ga0395901_0109691 | 3300038443 | Bacteria | 2897 |
| 314 | Ga0395901_0163472 | 3300038443 | Bacteria | 2337 |
| 315 | Ga0395901_0248343 | 3300038443 | Bacteria | 1854 |
| 316 | Ga0436365_1679154 | 3300039437 | Bacteria | 73730 |
| 317 | Ga0439439_0017256 | 3300041406 | Bacteria | 1773 |
| 318 | Ga0439461_0000282 | 3300041410 | Bacteria | 7317 |
| 319 | Ga0439465_0004264 | 3300041413 | Bacteria | 4650 |
| 320 | Ga0439431_0000586 | 3300041997 | Bacteria | 7729 |
| 321 | Ga0439432_003330 | 3300042006 | Bacteria | 5968 |
| 322 | Ga0439446_0006550 | 3300042156 | Bacteria | 3042 |
| 323 | Ga0439458_0000337 | 3300042157 | Bacteria | 11754 |
| 324 | Ga0439434_0001642 | 3300042435 | Bacteria | 6468 |
| 325 | Ga0439434_0016560 | 3300042435 | Bacteria | 2203 |
| 326 | Ga0466969_0067374 | 3300044656 | Bacteria | 1727 |
| 327 | Ga0466965_0067433 | 3300044683 | Bacteria | 1796 |
| 328 | Ga0466966_0000001 | 3300044684 | Bacteria | 410376 |
| 329 | Ga0466966_0003481 | 3300044684 | Bacteria | 10375 |
| 330 | Ga0466966_0066947 | 3300044684 | Bacteria | 2257 |
| 331 | Ga0466961_0011447 | 3300044693 | Bacteria | 5674 |
| 332 | Ga0466961_0037312 | 3300044693 | Bacteria | 3118 |
| 333 | Ga0466961_0059723 | 3300044693 | Bacteria | 2424 |
| 334 | Ga0466961_0060616 | 3300044693 | Bacteria | 2406 |
| 335 | Ga0466963_0010474 | 3300044694 | Bacteria | 5612 |
| 336 | Ga0466963_0037194 | 3300044694 | Bacteria | 3177 |
| 337 | Ga0466963_0216875 | 3300044694 | Bacteria | 1339 |
| 338 | Ga0466971_0003239 | 3300044719 | Bacteria | 6951 |
| 339 | Ga0466968_0002449 | 3300044735 | Bacteria | 6809 |
| 340 | Ga0466970_0071262 | 3300044765 | Bacteria | 1869 |
| 341 | Ga0466970_0089929 | 3300044765 | Bacteria | 1666 |
| 342 | Ga0466957_0001947 | 3300044842 | Bacteria | 10969 |
| 343 | Ga0466957_0003066 | 3300044842 | Bacteria | 9086 |
| 344 | Ga0466957_0004026 | 3300044842 | Bacteria | 8133 |
| 345 | Ga0466957_0008693 | 3300044842 | Bacteria | 5783 |
| 346 | Ga0451576_0000122 | 3300045051 | Bacteria | 197797 |
| 347 | Ga0466958_0000407 | 3300045836 | Bacteria | 17665 |
| 348 | Ga0466958_0024212 | 3300045836 | Bacteria | 3572 |
| 349 | Ga0466958_0041233 | 3300045836 | Bacteria | 2776 |
| 350 | Ga0466958_0085113 | 3300045836 | Bacteria | 1950 |
| 351 | Ga0466967_0004861 | 3300045976 | Bacteria | 9174 |
| 352 | Ga0466967_0159426 | 3300045976 | Bacteria | 2116 |
| 353 | Ga0495585_0104821 | 3300046492 | Bacteria | 1509 |
| 354 | Ga0495598_0000577 | 3300046537 | Bacteria | 6907 |
| 355 | Ga0495598_0028787 | 3300046537 | Bacteria | 1543 |
| 356 | Ga0495621_0003507 | 3300046539 | Bacteria | 4329 |
| 357 | Ga0495633_0006264 | 3300046558 | Bacteria | 7093 |
| 358 | Ga0495669_0002426 | 3300046684 | Bacteria | 7622 |
| 359 | Ga0495670_0001376 | 3300046691 | Bacteria | 11891 |
| 360 | Ga0496107_0118068 | 3300048910 | Bacteria | 1953 |
| 361 | Ga0496109_0094872 | 3300048912 | Bacteria | 2762 |
| 362 | Ga0496110_0001094 | 3300048913 | Bacteria | 19097 |
| 363 | Ga0496111_0026775 | 3300048914 | Bacteria | 4073 |
| 364 | Ga0496115_0005756 | 3300048918 | Bacteria | 9026 |
| 365 | Ga0496115_0062504 | 3300048918 | Bacteria | 3004 |
| 366 | Ga0500651_0091487 | 3300053093 | Bacteria | 1872 |
| 367 | Ga0500566_0002509 | 3300053094 | Bacteria | 10901 |
| 368 | Ga0500658_0002030 | 3300053134 | Bacteria | 7899 |
| 369 | Ga0500658_0002068 | 3300053134 | Bacteria | 7807 |
| 370 | Ga0500568_0016516 | 3300053139 | Bacteria | 3280 |
| 371 | Ga0500616_0105821 | 3300053153 | Bacteria | 1367 |
| 372 | Ga0466962_0000509 | 3300061719 | Bacteria | 16925 |
| 373 | Ga0466962_0006995 | 3300061719 | Bacteria | 5407 |
| 374 | 2644126961 | 2643221622 | Bacteria | 4212502 |
| 375 | 2644354107 | 2643221663 | Bacteria | 3425771 |
| 376 | 2848299468 | 2848297114 | Bacteria | 3608511 |
| 377 | 2928028693 | 2928027323 | Bacteria | 4382488 |
| 378 | 2946788659 | 2946787523 | Bacteria | 4366789 |
| 379 | 2984555507 | 2984555340 | Bacteria | 4247089 |
| 380 | 2984566382 | 2984564862 | Bacteria | 4339992 |
| 381 | 2990265905 | 2990265787 | Bacteria | 3943888 |
| 382 | 2993357395 | 2993356040 | Bacteria | 4247105 |
| 383 | 2993696304 | 2993693658 | Bacteria | 4040749 |
| 384 | Ga0395900_0136173 | |||
| 385 | JGI24736J21556_1000305 | |||
| 386 | JGI24739J22299_10003454 | |||
| 387 | JGI24737J22298_10005368 | |||
| 388 | JGI25150J39212_1000213 | |||
| 389 | JGI25153J46596_10000036 | |||
| 390 | Ga0055526_1000948 | |||
| 391 | Ga0055537_1001825 | |||
| 392 | Ga0055537_1002993 | |||
| 393 | Ga0055524_1000180 | |||
| 394 | Ga0055536_1000775 | |||
| 395 | Ga0055530_10007997 | |||
| 396 | Ga0055540_1001281 | |||
| 397 | Ga0055540_1005532 | |||
| 398 | Ga0055531_10014204 | |||
| 399 | Ga0055531_10016981 | |||
| 400 | Ga0055531_10017508 | |||
| 401 | Ga0065165_1001869 | |||
| 402 | Ga0065165_1004474 | |||
| 403 | Ga0070658_10000087 | |||
| 404 | Ga0070658_10000199 | |||
| 405 | Ga0070658_10048918 | |||
| 406 | Ga0070676_10002120 | |||
| 407 | Ga0070683_100000786 | |||
| 408 | Ga0070683_100007519 | |||
| 409 | Ga0070670_100002050 | |||
| 410 | Ga0070670_100002581 | |||
| 411 | Ga0070670_100005253 | |||
| 412 | Ga0070666_10000190 | |||
| 413 | Ga0068868_100054407 | |||
| 414 | Ga0070660_100000084 | |||
| 415 | Ga0070660_100000665 | |||
| 416 | Ga0070661_100000050 | |||
| 417 | Ga0070661_100008483 | |||
| 418 | Ga0070661_100019589 | |||
| 419 | Ga0070661_100181967 | |||
| 420 | Ga0070692_10006464 | |||
| 421 | Ga0070668_100008177 | |||
| 422 | Ga0070675_100002531 | |||
| 423 | Ga0070675_100157971 | |||
| 424 | Ga0070671_100000305 | |||
| 425 | Ga0070671_100040651 | |||
| 426 | Ga0070659_100000117 | |||
| 427 | Ga0070659_100004192 | |||
| 428 | Ga0070659_100037614 | |||
| 429 | Ga0070659_100110087 | |||
| 430 | Ga0070667_100013546 | |||
| 431 | Ga0070667_100044162 | |||
| 432 | Ga0070663_100009987 | |||
| 433 | Ga0070663_100142427 | |||
| 434 | Ga0070678_100081274 | |||
| 435 | Ga0070662_100000025 | |||
| 436 | Ga0070662_100003303 | |||
| 437 | Ga0070662_100202485 | |||
| 438 | Ga0068867_100009731 | |||
| 439 | Ga0070679_100025183 | |||
| 440 | Ga0068853_100000061 | |||
| 441 | Ga0070672_100006497 | |||
| 442 | Ga0070693_100000099 | |||
| 443 | Ga0070665_100012759 | |||
| 444 | Ga0068855_100000326 | |||
| 445 | Ga0068855_100027240 | |||
| 446 | Ga0068855_100146577 | |||
| 447 | Ga0068855_100233627 | |||
| 448 | Ga0070664_100000012 | |||
| 449 | Ga0070664_100000093 | |||
| 450 | Ga0070664_100099510 | |||
| 451 | Ga0068857_100002322 | |||
| 452 | Ga0068854_100038055 | |||
| 453 | Ga0068856_100000552 | |||
| 454 | Ga0068856_100012005 | |||
| 455 | Ga0068856_100248565 | |||
| 456 | Ga0068852_100000691 | |||
| 457 | Ga0068852_100001871 | |||
| 458 | Ga0068852_100067709 | |||
| 459 | Ga0068859_100082879 | |||
| 460 | Ga0068859_100110974 | |||
| 461 | Ga0068864_100014319 | |||
| 462 | Ga0068864_100018967 | |||
| 463 | Ga0068851_10009005 | |||
| 464 | Ga0068863_100004593 | |||
| 465 | Ga0068860_100009115 | |||
| 466 | Ga0068862_100005021 | |||
| 467 | Ga0068871_100050593 | |||
| 468 | Ga0097620_100082880 | |||
| 469 | Ga0097620_100110971 | |||
| 470 | Ga0105241_10059214 | |||
| 471 | Ga0105248_10000258 | |||
| 472 | Ga0105248_10002223 | |||
| 473 | Ga0105248_10075524 | |||
| 474 | Ga0105238_10028305 | |||
| 475 | Ga0157373_10019070 | |||
| 476 | Ga0157373_10185048 | |||
| 477 | Ga0157371_10002335 | |||
| 478 | Ga0157371_10010873 | |||
| 479 | Ga0157371_10021335 | |||
| 480 | Ga0157371_10040259 | |||
| 481 | Ga0157371_10053846 | |||
| 482 | Ga0157370_10011105 | |||
| 483 | Ga0157370_10339859 | |||
| 484 | Ga0157369_10000354 | |||
| 485 | Ga0157369_10001231 | |||
| 486 | Ga0157369_10029722 | |||
| 487 | Ga0157369_10085857 | |||
| 488 | Ga0157374_10001400 | |||
| 489 | Ga0157374_10054636 | |||
| 490 | Ga0157374_10094790 | |||
| 491 | Ga0157378_10238395 | |||
| 492 | Ga0163162_10059201 | |||
| 493 | Ga0163162_10113989 | |||
| 494 | Ga0157372_10070448 | |||
| 495 | Ga0157372_10076844 | |||
| 496 | Ga0157372_10134673 | |||
| 497 | Ga0163163_10000222 | |||
| 498 | Ga0206353_10558927 | |||
| 499 | Ga0213876_10000178 | |||
| 500 | Ga0213875_10004821 | |||
| 501 | Ga0207425_1000037 | |||
| 502 | Ga0209129_1000363 | |||
| 503 | Ga0209233_1000058 | |||
| 504 | Ga0209565_1000012 | |||
| 505 | Ga0209565_1000427 | |||
| 506 | Ga0209673_1002832 | |||
| 507 | Ga0209673_1024065 | |||
| 508 | Ga0209676_1000046 | |||
| 509 | Ga0209676_1002287 | |||
| 510 | Ga0209676_1002861 | |||
| 511 | Ga0209676_1013050 | |||
| 512 | Ga0209025_1000117 | |||
| 513 | Ga0209564_1003622 | |||
| 514 | Ga0209758_1000103 | |||
| 515 | Ga0209758_1012477 | |||
| 516 | Ga0209050_1000001 | |||
| 517 | Ga0209050_1006341 | |||
| 518 | Ga0209050_1014985 | |||
| 519 | Ga0209256_1000012 | |||
| 520 | Ga0209051_1003509 | |||
| 521 | Ga0209257_1000505 | |||
| 522 | Ga0209257_1005036 | |||
| 523 | Ga0209257_1005111 | |||
| 524 | Ga0207680_10001212 | |||
| 525 | Ga0207680_10030185 | |||
| 526 | Ga0207680_10061499 | |||
| 527 | Ga0207647_10022612 | |||
| 528 | Ga0207647_10040364 | |||
| 529 | Ga0207647_10060019 | |||
| 530 | Ga0207645_10000623 | |||
| 531 | Ga0207645_10114763 | |||
| 532 | Ga0207705_10000002 | |||
| 533 | Ga0207705_10000096 | |||
| 534 | Ga0207705_10000217 | |||
| 535 | Ga0207705_10006308 | |||
| 536 | Ga0207705_10011124 | |||
| 537 | Ga0207705_10026789 | |||
| 538 | Ga0207705_10054954 | |||
| 539 | Ga0207707_10195010 | |||
| 540 | Ga0207695_10119944 | |||
| 541 | Ga0207660_10000564 | |||
| 542 | Ga0207657_10000028 | |||
| 543 | Ga0207657_10001150 | |||
| 544 | Ga0207649_10000214 | |||
| 545 | Ga0207649_10002617 | |||
| 546 | Ga0207649_10005049 | |||
| 547 | Ga0207650_10019849 | |||
| 548 | Ga0207659_10022035 | |||
| 549 | Ga0207687_10020658 | |||
| 550 | Ga0207644_10002433 | |||
| 551 | Ga0207690_10000042 | |||
| 552 | Ga0207690_10009159 | |||
| 553 | Ga0207706_10000029 | |||
| 554 | Ga0207706_10009692 | |||
| 555 | Ga0207706_10015111 | |||
| 556 | Ga0207669_10003161 | |||
| 557 | Ga0207704_10118896 | |||
| 558 | Ga0207691_10011335 | |||
| 559 | Ga0207711_10000236 | |||
| 560 | Ga0207711_10002718 | |||
| 561 | Ga0207711_10074099 | |||
| 562 | Ga0207689_10030310 | |||
| 563 | Ga0207661_10000330 | |||
| 564 | Ga0207661_10006771 | |||
| 565 | Ga0207661_10020462 | |||
| 566 | Ga0207661_10138843 | |||
| 567 | Ga0207679_10000092 | |||
| 568 | Ga0207679_10003090 | |||
| 569 | Ga0207667_10005528 | |||
| 570 | Ga0207667_10011504 | |||
| 571 | Ga0207667_10101917 | |||
| 572 | Ga0207667_10143052 | |||
| 573 | Ga0207651_10000956 | |||
| 574 | Ga0207651_10122391 | |||
| 575 | Ga0207668_10000330 | |||
| 576 | Ga0207640_10000645 | |||
| 577 | Ga0207640_10005728 | |||
| 578 | Ga0207640_10051398 | |||
| 579 | Ga0207640_10128085 | |||
| 580 | Ga0207658_10002397 | |||
| 581 | Ga0207658_10010060 | |||
| 582 | Ga0207703_10002552 | |||
| 583 | Ga0207639_10004825 | |||
| 584 | Ga0207678_10002375 | |||
| 585 | Ga0207678_10004602 | |||
| 586 | Ga0207678_10011574 | |||
| 587 | Ga0207678_10013490 | |||
| 588 | Ga0207678_10042311 | |||
| 589 | Ga0207678_10065749 | |||
| 590 | Ga0207678_10105469 | |||
| 591 | Ga0207678_10232126 | |||
| 592 | Ga0207702_10000581 | |||
| 593 | Ga0207702_10013512 | |||
| 594 | Ga0207702_10056583 | |||
| 595 | Ga0207641_10053439 | |||
| 596 | Ga0207641_10244790 | |||
| 597 | Ga0207648_10006551 | |||
| 598 | Ga0207676_10012518 | |||
| 599 | Ga0207674_10000324 | |||
| 600 | Ga0207674_10009767 | |||
| 601 | Ga0207674_10012432 | |||
| 602 | Ga0207683_10014400 | |||
| 603 | Ga0207698_10000670 | |||
| 604 | Ga0207698_10003414 | |||
| 605 | Ga0207698_10018964 | |||
| 606 | Ga0207698_10140545 | |||
| 607 | Ga0268266_10000135 | |||
| 608 | Ga0268266_10007540 | |||
| 609 | Ga0268266_10058087 | |||
| 610 | Ga0268265_10002699 | |||
| 611 | Ga0268264_10003362 | |||
| 612 | Ga0307509_10111063 | |||
| 613 | Ga0307508_10005365 | |||
| 614 | Ga0307413_10002531 | |||
| 615 | Ga0307413_10062325 | |||
| 616 | Ga0307413_10173180 | |||
| 617 | Ga0307410_10000779 | |||
| 618 | Ga0307406_10000983 | |||
| 619 | Ga0307406_10005810 | |||
| 620 | Ga0307407_10000332 | |||
| 621 | Ga0307407_10012808 | |||
| 622 | Ga0307412_10002527 | |||
| 623 | Ga0307412_10008588 | |||
| 624 | Ga0307409_100023749 | |||
| 625 | Ga0307409_100173786 | |||
| 626 | Ga0307416_100007454 | |||
| 627 | Ga0307414_10001145 | |||
| 628 | Ga0307414_10131100 | |||
| 629 | Ga0307411_10007262 | |||
| 630 | Ga0307415_100010346 | |||
| 631 | Ga0307415_100013633 | |||
| 632 | Ga0373943_0005373 | |||
| 633 | Ga0373931_0078116 | |||
| 634 | Ga0373947_0088212 | |||
| 635 | Ga0373925_0050594 | |||
| 636 | Ga0395899_0011468 | |||
| 637 | Ga0395899_0014332 | |||
| 638 | Ga0395899_0022586 | |||
| 639 | Ga0395899_0048327 | |||
| 640 | Ga0395899_0069491 | |||
| 641 | Ga0395899_0081676 | |||
| 642 | Ga0395900_0001516 | |||
| 643 | Ga0395900_0004239 | |||
| 644 | Ga0395900_0004370 | |||
| 645 | Ga0395900_0005399 | |||
| 646 | Ga0395900_0007912 | |||
| 647 | Ga0395900_0013702 | |||
| 648 | Ga0395900_0014930 | |||
| 649 | Ga0395900_0027462 | |||
| 650 | Ga0395900_0040319 | |||
| 651 | Ga0395900_0056636 | |||
| 652 | Ga0395900_0075839 | |||
| 653 | Ga0395900_0076295 | |||
| 654 | Ga0395900_0116538 | |||
| 655 | Ga0395898_0007848 | |||
| 656 | Ga0395898_0020232 | |||
| 657 | Ga0395898_0036843 | |||
| 658 | Ga0395898_0094727 | |||
| 659 | Ga0395898_0135645 | |||
| 660 | Ga0395898_0141255 | |||
| 661 | Ga0395898_0181259 | |||
| 662 | Ga0395898_0300513 | |||
| 663 | Ga0395905_0000690 | |||
| 664 | Ga0395905_0001128 | |||
| 665 | Ga0395905_0003228 | |||
| 666 | Ga0395905_0003285 | |||
| 667 | Ga0395905_0006353 | |||
| 668 | Ga0395905_0008533 | |||
| 669 | Ga0395905_0009564 | |||
| 670 | Ga0395905_0010413 | |||
| 671 | Ga0395905_0018758 | |||
| 672 | Ga0395905_0019264 | |||
| 673 | Ga0395905_0021997 | |||
| 674 | Ga0395905_0023067 | |||
| 675 | Ga0395905_0023772 | |||
| 676 | Ga0395905_0034945 | |||
| 677 | Ga0395905_0049196 | |||
| 678 | Ga0395905_0059954 | |||
| 679 | Ga0395905_0082804 | |||
| 680 | Ga0395905_0098855 | |||
| 681 | Ga0395905_0143102 | |||
| 682 | Ga0395905_0145413 | |||
| 683 | Ga0395905_0217819 | |||
| 684 | Ga0436364_1200686 | |||
| 685 | Ga0395901_0002805 | |||
| 686 | Ga0395901_0003675 | |||
| 687 | Ga0395901_0008517 | |||
| 688 | Ga0395901_0008751 | |||
| 689 | Ga0395901_0011112 | |||
| 690 | Ga0395901_0012663 | |||
| 691 | Ga0395901_0022340 | |||
| 692 | Ga0395901_0044945 | |||
| 693 | Ga0395901_0058839 | |||
| 694 | Ga0395901_0094368 | |||
| 695 | Ga0395901_0096982 | |||
| 696 | Ga0395901_0109691 | |||
| 697 | Ga0395901_0163472 | |||
| 698 | Ga0395901_0248343 | |||
| 699 | Ga0436365_1679154 | |||
| 700 | Ga0439439_0017256 | |||
| 701 | Ga0439461_0000282 | |||
| 702 | Ga0439465_0004264 | |||
| 703 | Ga0439431_0000586 | |||
| 704 | Ga0439432_003330 | |||
| 705 | Ga0439446_0006550 | |||
| 706 | Ga0439458_0000337 | |||
| 707 | Ga0439434_0001642 | |||
| 708 | Ga0439434_0016560 | |||
| 709 | Ga0466969_0067374 | |||
| 710 | Ga0466965_0067433 | |||
| 711 | Ga0466966_0000001 | |||
| 712 | Ga0466966_0003481 | |||
| 713 | Ga0466966_0066947 | |||
| 714 | Ga0466961_0011447 | |||
| 715 | Ga0466961_0037312 | |||
| 716 | Ga0466961_0059723 | |||
| 717 | Ga0466961_0060616 | |||
| 718 | Ga0466963_0010474 | |||
| 719 | Ga0466963_0037194 | |||
| 720 | Ga0466963_0216875 | |||
| 721 | Ga0466971_0003239 | |||
| 722 | Ga0466968_0002449 | |||
| 723 | Ga0466970_0071262 | |||
| 724 | Ga0466970_0089929 | |||
| 725 | Ga0466957_0001947 | |||
| 726 | Ga0466957_0003066 | |||
| 727 | Ga0466957_0004026 | |||
| 728 | Ga0466957_0008693 | |||
| 729 | Ga0451576_0000122 | |||
| 730 | Ga0466958_0000407 | |||
| 731 | Ga0466958_0024212 | |||
| 732 | Ga0466958_0041233 | |||
| 733 | Ga0466958_0085113 | |||
| 734 | Ga0466967_0004861 | |||
| 735 | Ga0466967_0159426 | |||
| 736 | Ga0495585_0104821 | |||
| 737 | Ga0495598_0000577 | |||
| 738 | Ga0495598_0028787 | |||
| 739 | Ga0495621_0003507 | |||
| 740 | Ga0495633_0006264 | |||
| 741 | Ga0495669_0002426 | |||
| 742 | Ga0495670_0001376 | |||
| 743 | Ga0496107_0118068 | |||
| 744 | Ga0496109_0094872 | |||
| 745 | Ga0496110_0001094 | |||
| 746 | Ga0496111_0026775 | |||
| 747 | Ga0496115_0005756 | |||
| 748 | Ga0496115_0062504 | |||
| 749 | Ga0500651_0091487 | |||
| 750 | Ga0500566_0002509 | |||
| 751 | Ga0500658_0002030 | |||
| 752 | Ga0500658_0002068 | |||
| 753 | Ga0500568_0016516 | |||
| 754 | Ga0500616_0105821 | |||
| 755 | Ga0466962_0000509 | |||
| 756 | Ga0466962_0006995 | |||
| 757 | 2644126961 | |||
| 758 | 2644354107 | |||
| 759 | 2848299468 | |||
| 760 | 2928028693 | |||
| 761 | 2946788659 | |||
| 762 | 2984555507 | |||
| 763 | 2984566382 | |||
| 764 | 2990265905 | |||
| 765 | 2993357395 | |||
| 766 | 2993696304 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1uz4-assembly1.cif.gz_A | common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis | 0.9706 | 12 | 420 |
| 1uz4-assembly1.cif.gz_A | common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis | 0.959 | 12 | 420 |
| 4lyr-assembly1.cif.gz_A | glycoside hydrolase family 5 mannosidase from rhizomucor miehei, e301a mutant | 0.9162 | 11 | 425 |
| 4lyp-assembly2.cif.gz_B | crystal structure of glycoside hydrolase family 5 mannosidase from rhizomucor miehei | 0.9148 | 9 | 425 |
| 4nrr-assembly1.cif.gz_A | crystal structure of glycoside hydrolase family 5 mannosidase (e202a mutant) from rhizomucor miehei in complex with mannosyl-fructose | 0.9104 | 9 | 425 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1uz4A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9706 | 12 | 420 | 3.20.20.80 |
| 1uz4A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.959 | 12 | 420 | 3.20.20.80 |
| 4lypB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9148 | 9 | 425 | 3.20.20.80 |
| 4lypB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.904 | 9 | 425 | 3.20.20.80 |
| af_Q9FZ29_25_401_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.8566 | 11 | 423 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G9SBC3-F1-model_v4 | Mannanase | 0.9873 | 12 | 393 |
GO:0016985
|
| AF-A0A0Q4I613-F1-model_v4 | Mannanase | 0.9853 | 19 | 423 |
GO:0000272
GO:0016985 |
| AF-A0A4R2P4W4-F1-model_v4 | Mannan endo-1,4-beta-mannosidase | 0.9851 | 34 | 423 |
GO:0016985
|
| AF-A0A7K3MZ94-F1-model_v4 | Beta-mannanase | 0.983 | 221 | 420 |
GO:0016985
|
| AF-A0A258KBN2-F1-model_v4 | Mannanase | 0.9812 | 11 | 368 |
GO:0016985
|