F429655

General Info

Members Datasets Scaffolds Average Seq Length
383 246 766 363

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0011631|Ga0395905_0011631_6354_7574
Length 406
Sequence VQQSLLTVWCLTLALLSPLLKALVLGAHCLAFHHYSKLMNEVKRSPDLLKTKQHFAILDGLRGIAALAVVIFHFMEWVFTDSSKNFIGHGFLAVDFFFCLSGFVIGYAYDDRIRKMGAGEFFKSRLIRLHPLVVLGSVLGLLGFLFDPFASSLAYDAGKLALLFVCSLFLIPLPLMEERFFNLFAFNAPAWSLFWEYVANIFYAFVLYKVGRRSLAALTILAAAGICIVSYGAGNLLGGWSKDNFLDGGARVAYSFLAGLFLYRSNWIIKNRLGFTGLAILLSLAFIMPWSKWSWLTEALVVLVYFPLLVSLGAGSSLSPQWKKVCRFSGNISYPLYMTHYAAIWVFGNYYTSKKPPAGELPYIVIPGIIFLIILAYFAMVFYDIPVRRYLAKKRRQGRTHQSYQS

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
128 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
134 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
135 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
136 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
164 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
190 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
191 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
192 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
193 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
200 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
201 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
202 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
203 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
204 2738541283 Pedobacter sp. OK701 Isolate Unclassified
205 2738541302 Pedobacter sp. CF074 Isolate Unclassified
206 2739367663 Pedobacter sp. YR510 Isolate Unclassified
207 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
208 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
209 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
210 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
211 2818991437 Pedobacter terrae 518 Isolate Unclassified
212 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
213 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
214 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
215 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
216 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
217 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
218 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
219 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
220 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
221 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
222 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
223 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
224 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
225 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
226 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
227 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
228 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
229 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
230 2914759650 Rhizosphaericola mali Isolate Rhizosphere
231 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
232 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
233 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
234 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
235 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
236 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
237 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
238 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
239 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
240 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
241 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
242 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
243 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
244 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
245 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
246 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.73
Metatranscriptomes 0.26
Isolates 12.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.49
Nodule 1.31
Rhizoplane 0.78
Rhizosphere 72.85
Stem 0
Stem Tuber 0
Unclassified 3.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0011631 3300037471 Bacteria 8500
2 MBSR1b_contig_9650719 2162886012 Bacteria 1984
3 JGI24740J21852_10015621 3300001979 Bacteria 2767
4 JGI24739J22299_10025337 3300001989 Bacteria 2086
5 JGI24735J21928_10000005 3300002067 Bacteria 356755
6 JGI25162J39368_1001282 3300002737 Bacteria 14251
7 JGI25164J39214_1002525 3300002772 Bacteria 2743
8 JGI25152J39213_1000129 3300002773 Bacteria 51667
9 JGI25150J39212_1000004 3300002774 Bacteria 417320
10 JGI25151J46595_10000002 3300003187 Bacteria 731381
11 JGI25153J46596_10000037 3300003215 Bacteria 182199
12 rootH1_10012261 3300003316 Bacteria 7196
13 rootH1_10033497 3300003316 Bacteria 14410
14 rootL2_10004956 3300003322 Bacteria 13305
15 rootL2_10158894 3300003322 Bacteria 6301
16 rootH1_10001487 3300003323 Bacteria 6681
17 rootH1_10011973 3300003323 Bacteria 7108
18 rootH1_10028571 3300003323 Bacteria 20032
19 rootH1_10028572 3300003323 Bacteria 2289
20 rootH1_10051591 3300003323 Bacteria 7313
21 rootH1_10225705 3300003323 Unclassified 2744
22 rootH1_10325494 3300003323 Bacteria 3092
23 rootH1_10392865 3300003323 Unclassified 1245
24 JGI25160J50197_1001434 3300003354 Bacteria 11915
25 JGI25160J50197_1003405 3300003354 Bacteria 7120
26 Ga0006562J51391_1046505 3300003578 Bacteria 2776
27 Ga0055526_1002734 3300003771 Bacteria 11716
28 Ga0055526_1008180 3300003771 Bacteria 5261
29 Ga0055536_1002613 3300003781 Bacteria 10035
30 Ga0055528_1000179 3300003790 Bacteria 53605
31 Ga0055530_10006296 3300003791 Bacteria 5336
32 Ga0055531_10000225 3300003794 Bacteria 62492
33 Ga0065165_1000280 3300005262 Bacteria 87088
34 Ga0065165_1001699 3300005262 Bacteria 22163
35 Ga0065714_10002217 3300005288 Bacteria 49867
36 Ga0065714_10004484 3300005288 Bacteria 19587
37 Ga0065704_10000199 3300005289 Bacteria 297176
38 Ga0065704_10071400 3300005289 Bacteria 11327
39 Ga0065715_10105897 3300005293 Bacteria 2864
40 Ga0070658_10001089 3300005327 Bacteria 23167
41 Ga0070658_10051023 3300005327 Bacteria 3352
42 Ga0070658_10060036 3300005327 Bacteria 3096
43 Ga0070676_10003897 3300005328 Bacteria 7830
44 Ga0070683_100226405 3300005329 Bacteria 1777
45 Ga0070680_100042586 3300005336 Bacteria 3685
46 Ga0070682_100004714 3300005337 Bacteria 7577
47 Ga0068868_100002424 3300005338 Bacteria 12922
48 Ga0070660_100086912 3300005339 Bacteria 2460
49 Ga0070660_100112938 3300005339 Bacteria 2163
50 Ga0070691_10001777 3300005341 Bacteria 9370
51 Ga0070692_10081454 3300005345 Bacteria 1744
52 Ga0070675_100016537 3300005354 Bacteria 5857
53 Ga0070673_100000271 3300005364 Bacteria 26588
54 Ga0070659_100016494 3300005366 Bacteria 5546
55 Ga0070667_100001481 3300005367 Bacteria 21046
56 Ga0070663_100017649 3300005455 Bacteria 4662
57 Ga0070662_100001316 3300005457 Bacteria 15273
58 Ga0070681_10072554 3300005458 Bacteria 3405
59 Ga0070681_10100620 3300005458 Bacteria 2836
60 Ga0070681_10140985 3300005458 Bacteria 2340
61 Ga0068867_100040330 3300005459 Bacteria 3407
62 Ga0070679_100022351 3300005530 Bacteria 6182
63 Ga0068853_100000346 3300005539 Bacteria 32311
64 Ga0068853_100012479 3300005539 Bacteria 6913
65 Ga0068853_100222724 3300005539 Bacteria 1723
66 Ga0070672_100000102 3300005543 Bacteria 42541
67 Ga0070693_100002641 3300005547 Bacteria 8251
68 Ga0070665_100000016 3300005548 Bacteria 451538
69 Ga0070665_100001243 3300005548 Bacteria 30849
70 Ga0068855_100000162 3300005563 Bacteria 85736
71 Ga0068855_100007135 3300005563 Bacteria 13556
72 Ga0068855_100029552 3300005563 Bacteria 6551
73 Ga0068855_100033629 3300005563 Bacteria 6117
74 Ga0068855_100074639 3300005563 Bacteria 3938
75 Ga0068856_100266235 3300005614 Unclassified 1730
76 Ga0068852_100103130 3300005616 Bacteria 2579
77 Ga0068852_100142848 3300005616 Bacteria 2217
78 Ga0068851_10003496 3300005834 Bacteria 6995
79 Ga0068863_100001029 3300005841 Bacteria 27853
80 Ga0068858_100004689 3300005842 Bacteria 13396
81 Ga0068860_100010484 3300005843 Bacteria 9160
82 Ga0075366_10002440 3300006195 Bacteria 9515
83 Ga0097621_100046296 3300006237 Bacteria 3519
84 Ga0097621_100120089 3300006237 Bacteria 2228
85 Ga0068871_100001115 3300006358 Bacteria 18018
86 Ga0099824_1013912 3300006942 Bacteria 8182
87 Ga0079104_1000421 3300006946 Bacteria 48367
88 Ga0099826_10027720 3300006948 Bacteria 4156
89 Ga0105240_10000905 3300009093 Bacteria 52980
90 Ga0105240_10018425 3300009093 Bacteria 9373
91 Ga0105240_10020030 3300009093 Bacteria 8931
92 Ga0105240_10023909 3300009093 Bacteria 8071
93 Ga0105240_10102254 3300009093 Bacteria 3483
94 Ga0105247_10014286 3300009101 Bacteria 4766
95 Ga0105241_10002395 3300009174 Bacteria 14083
96 Ga0105237_10013895 3300009545 Bacteria 8424
97 Ga0105237_10032424 3300009545 Bacteria 5290
98 Ga0105237_10075771 3300009545 Bacteria 3355
99 Ga0105237_10090544 3300009545 Bacteria 3048
100 Ga0105237_10209889 3300009545 Bacteria 1947
101 Ga0105238_10017072 3300009551 Bacteria 7367
102 Ga0105238_10026058 3300009551 Bacteria 5959
103 Ga0105249_10012520 3300009553 Bacteria 7479
104 Ga0105239_10017138 3300010375 Bacteria 8008
105 Ga0105239_10098833 3300010375 Bacteria 3226
106 Ga0105246_10013202 3300011119 Bacteria 5173
107 Ga0157373_10000015 3300013100 Bacteria 183381
108 Ga0157373_10001300 3300013100 Bacteria 19057
109 Ga0157373_10013088 3300013100 Bacteria 6089
110 Ga0157371_10002191 3300013102 Bacteria 18963
111 Ga0157371_10002557 3300013102 Bacteria 17258
112 Ga0157371_10005106 3300013102 Bacteria 11198
113 Ga0157371_10007735 3300013102 Bacteria 8643
114 Ga0157371_10008940 3300013102 Bacteria 7928
115 Ga0157371_10047210 3300013102 Bacteria 3062
116 Ga0157371_10054574 3300013102 Bacteria 2838
117 Ga0157371_10147924 3300013102 Bacteria 1675
118 Ga0157370_10000022 3300013104 Bacteria 163793
119 Ga0157370_10002096 3300013104 Bacteria 24367
120 Ga0157370_10002269 3300013104 Bacteria 23337
121 Ga0157370_10007694 3300013104 Bacteria 11690
122 Ga0157370_10028707 3300013104 Bacteria 5469
123 Ga0157370_10112303 3300013104 Bacteria 2547
124 Ga0157369_10010736 3300013105 Bacteria 10425
125 Ga0157369_10014609 3300013105 Bacteria 8858
126 Ga0157369_10102916 3300013105 Bacteria 3042
127 Ga0157369_10107157 3300013105 Bacteria 2973
128 Ga0157369_10279750 3300013105 Unclassified 1738
129 Ga0157369_10285676 3300013105 Bacteria 1718
130 Ga0157369_10330279 3300013105 Unclassified 1584
131 Ga0157374_10046886 3300013296 Bacteria 4004
132 Ga0163162_10000669 3300013306 Bacteria 31795
133 Ga0163162_10002853 3300013306 Bacteria 16447
134 Ga0163162_10091316 3300013306 Bacteria 3128
135 Ga0163162_10239568 3300013306 Bacteria 1945
136 Ga0157372_10000042 3300013307 Bacteria 157651
137 Ga0157372_10000874 3300013307 Bacteria 32723
138 Ga0157372_10003873 3300013307 Bacteria 16080
139 Ga0157372_10027870 3300013307 Bacteria 6157
140 Ga0157372_10042942 3300013307 Bacteria 5004
141 Ga0157372_10158577 3300013307 Bacteria 2614
142 Ga0157372_10524425 3300013307 Bacteria 1381
143 Ga0163163_10000493 3300014325 Bacteria 35594
144 Ga0182008_10000001 3300014497 Bacteria 540790
145 Ga0182008_10000290 3300014497 Bacteria 39578
146 Ga0182008_10020472 3300014497 Bacteria 3406
147 Ga0157379_10000255 3300014968 Bacteria 41772
148 Ga0157379_10293273 3300014968 Bacteria 1481
149 Ga0157376_10186061 3300014969 Bacteria 1902
150 Ga0157376_10329937 3300014969 Bacteria 1453
151 Ga0182006_1000744 3300015261 Bacteria 22275
152 Ga0182006_1001056 3300015261 Bacteria 17790
153 Ga0182007_10010727 3300015262 Bacteria 3604
154 Ga0163161_10003003 3300017792 Bacteria 11917
155 Ga0163161_10014130 3300017792 Bacteria 5561
156 Ga0163161_10058243 3300017792 Bacteria 2808
157 Ga0163161_10086548 3300017792 Bacteria 2313
158 Ga0207427_100110 3300025231 Bacteria 113735
159 Ga0209437_100093 3300025233 Bacteria 239733
160 Ga0207425_1000003 3300025245 Bacteria 1145342
161 Ga0209129_1000022 3300025258 Bacteria 440876
162 Ga0209233_1000089 3300025261 Bacteria 316381
163 Ga0209455_1002490 3300025272 Bacteria 7075
164 Ga0209673_1000014 3300025273 Bacteria 537082
165 Ga0209673_1000018 3300025273 Bacteria 458281
166 Ga0209676_1000335 3300025292 Bacteria 90378
167 Ga0209025_1000007 3300025294 Bacteria 1145109
168 Ga0209564_1002131 3300025295 Bacteria 16763
169 Ga0209564_1012902 3300025295 Bacteria 3600
170 Ga0209758_1000012 3300025297 Bacteria 949866
171 Ga0209758_1001144 3300025297 Bacteria 34032
172 Ga0209758_1004251 3300025297 Bacteria 12112
173 Ga0209050_1000481 3300025298 Bacteria 70155
174 Ga0207426_1000030 3300025302 Bacteria 461478
175 Ga0207426_1001281 3300025302 Bacteria 21820
176 Ga0209257_1000008 3300025304 Bacteria 1294570
177 Ga0209257_1003584 3300025304 Bacteria 13129
178 Ga0207656_10000663 3300025321 Bacteria 11275
179 Ga0207710_10008179 3300025900 Bacteria 4415
180 Ga0207647_10017317 3300025904 Bacteria 4899
181 Ga0207645_10005725 3300025907 Bacteria 8967
182 Ga0207705_10026304 3300025909 Bacteria 4150
183 Ga0207654_10002258 3300025911 Bacteria 9884
184 Ga0207654_10011043 3300025911 Unclassified 4597
185 Ga0207707_10001992 3300025912 Bacteria 18554
186 Ga0207695_10000545 3300025913 Bacteria 78409
187 Ga0207695_10027636 3300025913 Bacteria 6313
188 Ga0207695_10039449 3300025913 Bacteria 5076
189 Ga0207695_10047460 3300025913 Bacteria 4545
190 Ga0207695_10278492 3300025913 Bacteria 1567
191 Ga0207671_10004146 3300025914 Bacteria 14009
192 Ga0207671_10009912 3300025914 Bacteria 7918
193 Ga0207671_10040344 3300025914 Bacteria 3456
194 Ga0207671_10049507 3300025914 Bacteria 3111
195 Ga0207671_10201315 3300025914 Bacteria 1555
196 Ga0207660_10041388 3300025917 Bacteria 3228
197 Ga0207657_10034997 3300025919 Bacteria 4508
198 Ga0207652_10000029 3300025921 Bacteria 149054
199 Ga0207652_10043492 3300025921 Bacteria 3824
200 Ga0207652_10060716 3300025921 Bacteria 3262
201 Ga0207694_10107778 3300025924 Bacteria 2214
202 Ga0207659_10141871 3300025926 Bacteria 1866
203 Ga0207659_10249319 3300025926 Bacteria 1440
204 Ga0207690_10039084 3300025932 Bacteria 3094
205 Ga0207706_10039979 3300025933 Bacteria 4158
206 Ga0207691_10000145 3300025940 Bacteria 65242
207 Ga0207661_10254136 3300025944 Bacteria 1563
208 Ga0207667_10000426 3300025949 Bacteria 56781
209 Ga0207667_10006584 3300025949 Bacteria 14047
210 Ga0207667_10045958 3300025949 Bacteria 4623
211 Ga0207651_10000509 3300025960 Bacteria 16353
212 Ga0207668_10000328 3300025972 Bacteria 30719
213 Ga0207658_10000431 3300025986 Bacteria 39615
214 Ga0207677_10001428 3300026023 Bacteria 12703
215 Ga0207703_10039950 3300026035 Bacteria 3752
216 Ga0207639_10008782 3300026041 Bacteria 6944
217 Ga0207639_10121281 3300026041 Bacteria 2148
218 Ga0207639_10312413 3300026041 Unclassified 1393
219 Ga0207678_10008606 3300026067 Bacteria 8993
220 Ga0207641_10014043 3300026088 Bacteria 6566
221 Ga0207648_10013260 3300026089 Bacteria 7678
222 Ga0207674_10044700 3300026116 Bacteria 4561
223 Ga0207674_10093299 3300026116 Bacteria 2999
224 Ga0207698_10075510 3300026142 Bacteria 2694
225 Ga0209281_1004023 3300027111 Bacteria 4550
226 Ga0209489_108179 3300027361 Bacteria 14625
227 Ga0268266_10000034 3300028379 Bacteria 354251
228 Ga0268266_10001404 3300028379 Bacteria 28781
229 Ga0268266_10307419 3300028379 Bacteria 1481
230 Ga0268264_10003907 3300028381 Bacteria 12762
231 Ga0307517_10000255 3300028786 Bacteria 91028
232 Ga0307515_10006611 3300028794 Bacteria 23131
233 Ga0307515_10047955 3300028794 Bacteria 6474
234 Ga0316177_1209479 3300030731 Bacteria 2444
235 Ga0316176_1094622 3300030732 Bacteria 6790
236 Ga0316183_1109514 3300030742 Bacteria 62860
237 Ga0316182_1064797 3300030745 Bacteria 2298
238 Ga0265327_10000306 3300031251 Bacteria 95199
239 Ga0307509_10056475 3300031507 Bacteria 4167
240 Ga0307405_10000026 3300031731 Bacteria 118954
241 Ga0307413_10000064 3300031824 Bacteria 26787
242 Ga0307407_10000032 3300031903 Bacteria 87003
243 Ga0307412_10000017 3300031911 Bacteria 294698
244 Ga0307416_100000045 3300032002 Bacteria 126832
245 Ga0307416_100015524 3300032002 Bacteria 5263
246 Ga0307414_10004993 3300032004 Bacteria 7258
247 Ga0307414_10030225 3300032004 Bacteria 3536
248 Ga0307414_10038856 3300032004 Bacteria 3200
249 Ga0307414_10103763 3300032004 Bacteria 2146
250 Ga0307414_10148016 3300032004 Bacteria 1848
251 Ga0307414_10170730 3300032004 Bacteria 1738
252 Ga0307414_10391985 3300032004 Bacteria 1204
253 Ga0307411_10000001 3300032005 Bacteria 931810
254 Ga0373937_0166051 3300036401 Bacteria 2070
255 Ga0395899_0025124 3300037312 Unclassified 4498
256 Ga0395900_0038801 3300037418 Bacteria 4910
257 Ga0395900_0070050 3300037418 Bacteria 3605
258 Ga0395900_0082207 3300037418 Unclassified 3309
259 Ga0395900_0167413 3300037418 Bacteria 2239
260 Ga0395898_0035133 3300037466 Unclassified 4988
261 Ga0395898_0076804 3300037466 Bacteria 3224
262 Ga0395901_0013187 3300038443 Bacteria 8391
263 Ga0466969_0103548 3300044656 Bacteria 1338
264 Ga0466972_0000021 3300044658 Bacteria 196266
265 Ga0466961_0101300 3300044693 Bacteria 1814
266 Ga0466970_0001077 3300044765 Bacteria 13223
267 Ga0466959_0023117 3300045049 Bacteria 4599
268 Ga0466958_0015900 3300045836 Bacteria 4325
269 Ga0495638_0016051 3300046460 Bacteria 5020
270 Ga0495641_0140125 3300046461 Bacteria 1080
271 Ga0495651_0132467 3300046462 Bacteria 1818
272 Ga0495650_0000050 3300046471 Bacteria 318894
273 Ga0495650_0009091 3300046471 Bacteria 5697
274 Ga0495585_0000198 3300046492 Bacteria 62640
275 Ga0495585_0002283 3300046492 Bacteria 13840
276 Ga0495606_0000073 3300046507 Bacteria 171657
277 Ga0495606_0000213 3300046507 Bacteria 103305
278 Ga0495606_0047537 3300046507 Bacteria 2828
279 Ga0495606_0065699 3300046507 Bacteria 2304
280 Ga0495606_0078473 3300046507 Unclassified 2059
281 Ga0495610_0001134 3300046512 Bacteria 24228
282 Ga0495610_0009469 3300046512 Bacteria 6156
283 Ga0495610_0023677 3300046512 Bacteria 3331
284 Ga0495616_0000023 3300046513 Bacteria 147717
285 Ga0495616_0001172 3300046513 Bacteria 18513
286 Ga0495616_0003999 3300046513 Bacteria 9373
287 Ga0495631_0037302 3300046518 Bacteria 2166
288 Ga0495654_0029400 3300046530 Bacteria 2803
289 Ga0495633_0000027 3300046558 Bacteria 204613
290 Ga0495633_0004623 3300046558 Bacteria 8671
291 Ga0495668_0000010 3300046616 Bacteria 487308
292 Ga0495625_0000105 3300046660 Bacteria 126078
293 Ga0495625_0000381 3300046660 Bacteria 67732
294 Ga0495625_0000939 3300046660 Bacteria 39095
295 Ga0495625_0017917 3300046660 Bacteria 5535
296 Ga0495661_0002113 3300046665 Bacteria 15587
297 Ga0495661_0071302 3300046665 Bacteria 2031
298 Ga0495649_0000011 3300046694 Bacteria 416695
299 Ga0495660_0027493 3300046810 Bacteria 3218
300 Ga0495674_0168475 3300047319 Bacteria 1829
301 Ga0495683_0008420 3300047323 Bacteria 5518
302 Ga0495687_000249 3300047443 Bacteria 72846
303 Ga0495686_0000249 3300047472 Bacteria 96604
304 Ga0495686_0008691 3300047472 Bacteria 7415
305 Ga0495686_0010210 3300047472 Bacteria 6689
306 Ga0495686_0021357 3300047472 Bacteria 4301
307 Ga0495614_0027051 3300048089 Bacteria 2473
308 Ga0496112_0242814 3300048915 Bacteria 1753
309 Ga0496115_0251602 3300048918 Bacteria 1455
310 Ga0496116_0000004 3300048919 Bacteria 839841
311 Ga0496117_0049456 3300048920 Bacteria 2991
312 Ga0496121_0000007 3300048924 Bacteria 942516
313 Ga0496121_0005339 3300048924 Bacteria 16523
314 Ga0496121_0018257 3300048924 Bacteria 7087
315 Ga0496122_0001254 3300048925 Bacteria 42541
316 Ga0496124_0097680 3300048927 Bacteria 2384
317 Ga0496125_0000012 3300048928 Bacteria 651142
318 Ga0496126_0014436 3300048929 Bacteria 7985
319 Ga0496126_0078952 3300048929 Bacteria 2915
320 Ga0496126_0136127 3300048929 Bacteria 2119
321 Ga0495678_019859 3300049459 Bacteria 2987
322 Ga0501047_0043388 3300049581 Bacteria 4344
323 Ga0501047_0101047 3300049581 Bacteria 2764
324 Ga0501242_000533 3300049674 Bacteria 3385
325 Ga0501249_001185 3300049679 Bacteria 5477
326 Ga0501249_003099 3300049679 Bacteria 3346
327 Ga0501241_000793 3300049758 Bacteria 6702
328 Ga0501241_028496 3300049758 Bacteria 1048
329 Ga0501264_000024 3300049761 Bacteria 23547
330 Ga0501266_000019 3300049763 Bacteria 114355
331 nmdc:mga0k408_10440_c1 3300050493 Bacteria 5020
332 Ga0500651_0001594 3300053093 Bacteria 11523
333 Ga0500608_001010 3300053122 Bacteria 10107
334 Ga0500658_0000003 3300053134 Bacteria 512506
335 Ga0500622_0001360 3300053156 Bacteria 19742
336 Ga0500624_000426 3300053157 Bacteria 12838
337 Ga0500661_008982 3300055283 Unclassified 1836
338 2520879469 2519899754 Bacteria 5336938
339 2599480008 2599185184 Bacteria 6430550
340 2644011303 2643221600 Bacteria 5530138
341 2738757656 2738541283 Bacteria 7222293
342 2738853618 2738541302 Bacteria 5944758
343 2739646027 2739367663 Bacteria 5040914
344 2740001099 2739367857 Bacteria 5433684
345 2740005915 2739367858 Bacteria 5432813
346 2776612543 2775506987 Bacteria 5373360
347 2817413618 2816332280 Bacteria 5109718
348 2819548825 2818991437 Bacteria 5805520
349 2819578222 2818991442 Bacteria 8318214
350 2819681190 2818991460 Bacteria 7595395
351 2821139332 2821136567 Bacteria 8080116
352 2842726299 2842722452 Bacteria 6263924
353 2842905753 2842903701 Bacteria 6986368
354 2842910553 2842909656 Bacteria 6185908
355 2852632149 2852627209 Bacteria 5896285
356 2857618722 2857618242 Bacteria 5635925
357 2881362604 2881359912 Bacteria 4935907
358 2884794314 2884791551 Bacteria 8511252
359 2896088126 2896085136 Bacteria 6129793
360 2896113882 2896109856 Bacteria 7140722
361 2898713998 2898713307 Bacteria 4110805
362 2902049723 2902048731 Bacteria 4976191
363 2903896755 2903895155 Bacteria 5258610
364 2904472046 2904467357 Bacteria 8057758
365 2904557135 2904555929 Bacteria 5218588
366 2910250491 2910245624 Bacteria 6935613
367 2914763159 2914759650 Bacteria 4701441
368 2919186820 2919186247 Bacteria 6244071
369 2919438894 2919437846 Bacteria 6199444
370 2928081139 2928078545 Bacteria 6534839
371 2928152440 2928147474 Bacteria 6512076
372 2929154887 2929154850 Bacteria 6753285
373 2929179742 2929177148 Bacteria 7883697
374 2929243845 2929239360 Bacteria 7745570
375 2932087789 2932082852 Bacteria 6563563
376 2939665911 2939664404 Bacteria 6364494
377 2945982164 2945977869 Bacteria 7777518
378 2946000862 2945997725 Bacteria 6404843
379 2946018445 2946013367 Bacteria 7766675
380 2958463468 2958458903 Bacteria 5301041
381 8055423658 8055419101 Bacteria 5289643
382 8055588970 8055588893 Bacteria 3619545
383 8055594987 8055592153 Bacteria 5961247
384 Ga0395905_0011631
385 MBSR1b_contig_9650719
386 JGI24740J21852_10015621
387 JGI24739J22299_10025337
388 JGI24735J21928_10000005
389 JGI25162J39368_1001282
390 JGI25164J39214_1002525
391 JGI25152J39213_1000129
392 JGI25150J39212_1000004
393 JGI25151J46595_10000002
394 JGI25153J46596_10000037
395 rootH1_10012261
396 rootH1_10033497
397 rootL2_10004956
398 rootL2_10158894
399 rootH1_10001487
400 rootH1_10011973
401 rootH1_10028571
402 rootH1_10028572
403 rootH1_10051591
404 rootH1_10225705
405 rootH1_10325494
406 rootH1_10392865
407 JGI25160J50197_1001434
408 JGI25160J50197_1003405
409 Ga0006562J51391_1046505
410 Ga0055526_1002734
411 Ga0055526_1008180
412 Ga0055536_1002613
413 Ga0055528_1000179
414 Ga0055530_10006296
415 Ga0055531_10000225
416 Ga0065165_1000280
417 Ga0065165_1001699
418 Ga0065714_10002217
419 Ga0065714_10004484
420 Ga0065704_10000199
421 Ga0065704_10071400
422 Ga0065715_10105897
423 Ga0070658_10001089
424 Ga0070658_10051023
425 Ga0070658_10060036
426 Ga0070676_10003897
427 Ga0070683_100226405
428 Ga0070680_100042586
429 Ga0070682_100004714
430 Ga0068868_100002424
431 Ga0070660_100086912
432 Ga0070660_100112938
433 Ga0070691_10001777
434 Ga0070692_10081454
435 Ga0070675_100016537
436 Ga0070673_100000271
437 Ga0070659_100016494
438 Ga0070667_100001481
439 Ga0070663_100017649
440 Ga0070662_100001316
441 Ga0070681_10072554
442 Ga0070681_10100620
443 Ga0070681_10140985
444 Ga0068867_100040330
445 Ga0070679_100022351
446 Ga0068853_100000346
447 Ga0068853_100012479
448 Ga0068853_100222724
449 Ga0070672_100000102
450 Ga0070693_100002641
451 Ga0070665_100000016
452 Ga0070665_100001243
453 Ga0068855_100000162
454 Ga0068855_100007135
455 Ga0068855_100029552
456 Ga0068855_100033629
457 Ga0068855_100074639
458 Ga0068856_100266235
459 Ga0068852_100103130
460 Ga0068852_100142848
461 Ga0068851_10003496
462 Ga0068863_100001029
463 Ga0068858_100004689
464 Ga0068860_100010484
465 Ga0075366_10002440
466 Ga0097621_100046296
467 Ga0097621_100120089
468 Ga0068871_100001115
469 Ga0099824_1013912
470 Ga0079104_1000421
471 Ga0099826_10027720
472 Ga0105240_10000905
473 Ga0105240_10018425
474 Ga0105240_10020030
475 Ga0105240_10023909
476 Ga0105240_10102254
477 Ga0105247_10014286
478 Ga0105241_10002395
479 Ga0105237_10013895
480 Ga0105237_10032424
481 Ga0105237_10075771
482 Ga0105237_10090544
483 Ga0105237_10209889
484 Ga0105238_10017072
485 Ga0105238_10026058
486 Ga0105249_10012520
487 Ga0105239_10017138
488 Ga0105239_10098833
489 Ga0105246_10013202
490 Ga0157373_10000015
491 Ga0157373_10001300
492 Ga0157373_10013088
493 Ga0157371_10002191
494 Ga0157371_10002557
495 Ga0157371_10005106
496 Ga0157371_10007735
497 Ga0157371_10008940
498 Ga0157371_10047210
499 Ga0157371_10054574
500 Ga0157371_10147924
501 Ga0157370_10000022
502 Ga0157370_10002096
503 Ga0157370_10002269
504 Ga0157370_10007694
505 Ga0157370_10028707
506 Ga0157370_10112303
507 Ga0157369_10010736
508 Ga0157369_10014609
509 Ga0157369_10102916
510 Ga0157369_10107157
511 Ga0157369_10279750
512 Ga0157369_10285676
513 Ga0157369_10330279
514 Ga0157374_10046886
515 Ga0163162_10000669
516 Ga0163162_10002853
517 Ga0163162_10091316
518 Ga0163162_10239568
519 Ga0157372_10000042
520 Ga0157372_10000874
521 Ga0157372_10003873
522 Ga0157372_10027870
523 Ga0157372_10042942
524 Ga0157372_10158577
525 Ga0157372_10524425
526 Ga0163163_10000493
527 Ga0182008_10000001
528 Ga0182008_10000290
529 Ga0182008_10020472
530 Ga0157379_10000255
531 Ga0157379_10293273
532 Ga0157376_10186061
533 Ga0157376_10329937
534 Ga0182006_1000744
535 Ga0182006_1001056
536 Ga0182007_10010727
537 Ga0163161_10003003
538 Ga0163161_10014130
539 Ga0163161_10058243
540 Ga0163161_10086548
541 Ga0207427_100110
542 Ga0209437_100093
543 Ga0207425_1000003
544 Ga0209129_1000022
545 Ga0209233_1000089
546 Ga0209455_1002490
547 Ga0209673_1000014
548 Ga0209673_1000018
549 Ga0209676_1000335
550 Ga0209025_1000007
551 Ga0209564_1002131
552 Ga0209564_1012902
553 Ga0209758_1000012
554 Ga0209758_1001144
555 Ga0209758_1004251
556 Ga0209050_1000481
557 Ga0207426_1000030
558 Ga0207426_1001281
559 Ga0209257_1000008
560 Ga0209257_1003584
561 Ga0207656_10000663
562 Ga0207710_10008179
563 Ga0207647_10017317
564 Ga0207645_10005725
565 Ga0207705_10026304
566 Ga0207654_10002258
567 Ga0207654_10011043
568 Ga0207707_10001992
569 Ga0207695_10000545
570 Ga0207695_10027636
571 Ga0207695_10039449
572 Ga0207695_10047460
573 Ga0207695_10278492
574 Ga0207671_10004146
575 Ga0207671_10009912
576 Ga0207671_10040344
577 Ga0207671_10049507
578 Ga0207671_10201315
579 Ga0207660_10041388
580 Ga0207657_10034997
581 Ga0207652_10000029
582 Ga0207652_10043492
583 Ga0207652_10060716
584 Ga0207694_10107778
585 Ga0207659_10141871
586 Ga0207659_10249319
587 Ga0207690_10039084
588 Ga0207706_10039979
589 Ga0207691_10000145
590 Ga0207661_10254136
591 Ga0207667_10000426
592 Ga0207667_10006584
593 Ga0207667_10045958
594 Ga0207651_10000509
595 Ga0207668_10000328
596 Ga0207658_10000431
597 Ga0207677_10001428
598 Ga0207703_10039950
599 Ga0207639_10008782
600 Ga0207639_10121281
601 Ga0207639_10312413
602 Ga0207678_10008606
603 Ga0207641_10014043
604 Ga0207648_10013260
605 Ga0207674_10044700
606 Ga0207674_10093299
607 Ga0207698_10075510
608 Ga0209281_1004023
609 Ga0209489_108179
610 Ga0268266_10000034
611 Ga0268266_10001404
612 Ga0268266_10307419
613 Ga0268264_10003907
614 Ga0307517_10000255
615 Ga0307515_10006611
616 Ga0307515_10047955
617 Ga0316177_1209479
618 Ga0316176_1094622
619 Ga0316183_1109514
620 Ga0316182_1064797
621 Ga0265327_10000306
622 Ga0307509_10056475
623 Ga0307405_10000026
624 Ga0307413_10000064
625 Ga0307407_10000032
626 Ga0307412_10000017
627 Ga0307416_100000045
628 Ga0307416_100015524
629 Ga0307414_10004993
630 Ga0307414_10030225
631 Ga0307414_10038856
632 Ga0307414_10103763
633 Ga0307414_10148016
634 Ga0307414_10170730
635 Ga0307414_10391985
636 Ga0307411_10000001
637 Ga0373937_0166051
638 Ga0395899_0025124
639 Ga0395900_0038801
640 Ga0395900_0070050
641 Ga0395900_0082207
642 Ga0395900_0167413
643 Ga0395898_0035133
644 Ga0395898_0076804
645 Ga0395901_0013187
646 Ga0466969_0103548
647 Ga0466972_0000021
648 Ga0466961_0101300
649 Ga0466970_0001077
650 Ga0466959_0023117
651 Ga0466958_0015900
652 Ga0495638_0016051
653 Ga0495641_0140125
654 Ga0495651_0132467
655 Ga0495650_0000050
656 Ga0495650_0009091
657 Ga0495585_0000198
658 Ga0495585_0002283
659 Ga0495606_0000073
660 Ga0495606_0000213
661 Ga0495606_0047537
662 Ga0495606_0065699
663 Ga0495606_0078473
664 Ga0495610_0001134
665 Ga0495610_0009469
666 Ga0495610_0023677
667 Ga0495616_0000023
668 Ga0495616_0001172
669 Ga0495616_0003999
670 Ga0495631_0037302
671 Ga0495654_0029400
672 Ga0495633_0000027
673 Ga0495633_0004623
674 Ga0495668_0000010
675 Ga0495625_0000105
676 Ga0495625_0000381
677 Ga0495625_0000939
678 Ga0495625_0017917
679 Ga0495661_0002113
680 Ga0495661_0071302
681 Ga0495649_0000011
682 Ga0495660_0027493
683 Ga0495674_0168475
684 Ga0495683_0008420
685 Ga0495687_000249
686 Ga0495686_0000249
687 Ga0495686_0008691
688 Ga0495686_0010210
689 Ga0495686_0021357
690 Ga0495614_0027051
691 Ga0496112_0242814
692 Ga0496115_0251602
693 Ga0496116_0000004
694 Ga0496117_0049456
695 Ga0496121_0000007
696 Ga0496121_0005339
697 Ga0496121_0018257
698 Ga0496122_0001254
699 Ga0496124_0097680
700 Ga0496125_0000012
701 Ga0496126_0014436
702 Ga0496126_0078952
703 Ga0496126_0136127
704 Ga0495678_019859
705 Ga0501047_0043388
706 Ga0501047_0101047
707 Ga0501242_000533
708 Ga0501249_001185
709 Ga0501249_003099
710 Ga0501241_000793
711 Ga0501241_028496
712 Ga0501264_000024
713 Ga0501266_000019
714 nmdc:mga0k408_10440_c1
715 Ga0500651_0001594
716 Ga0500608_001010
717 Ga0500658_0000003
718 Ga0500622_0001360
719 Ga0500624_000426
720 Ga0500661_008982
721 2520879469
722 2599480008
723 2644011303
724 2738757656
725 2738853618
726 2739646027
727 2740001099
728 2740005915
729 2776612543
730 2817413618
731 2819548825
732 2819578222
733 2819681190
734 2821139332
735 2842726299
736 2842905753
737 2842910553
738 2852632149
739 2857618722
740 2881362604
741 2884794314
742 2896088126
743 2896113882
744 2898713998
745 2902049723
746 2903896755
747 2904472046
748 2904557135
749 2910250491
750 2914763159
751 2919186820
752 2919438894
753 2928081139
754 2928152440
755 2929154887
756 2929179742
757 2929243845
758 2932087789
759 2939665911
760 2945982164
761 2946000862
762 2946018445
763 2958463468
764 8055423658
765 8055588970
766 8055594987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01757

Acyl_transf_3

Acyltransferase family

55

383

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n7w-assembly1.cif.gz_A crystal structure of the sodium bile acid symporter from yersinia frederiksenii 0.2714 16 339
4n7w-assembly1.cif.gz_A crystal structure of the sodium bile acid symporter from yersinia frederiksenii 0.2656 16 339
8iwo-assembly1.cif.gz_B the rice na+/h+ antiporter sos1 in an auto-inhibited state 0.2547 19 345
7a0y-assembly1.cif.gz_B structure of dimeric sodium proton antiporter nhaa k300r variant, at ph 8.2, crystallized with chimeric fab antibodies 0.2525 21 356
4czb-assembly2.cif.gz_D structure of the sodium proton antiporter mjnhap1 from methanocaldococcus jannaschii at ph 8. 0.2516 25 357
ID Description Score Start End Superfamily
af_Q18251_2_203_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2784 16 358 1.20.1250.20
af_H2KZQ1_21_234_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2764 83 335 1.20.1250.20
af_Q18251_2_203_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2728 16 358 1.20.1250.20
af_Q54H08_124_529_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2717 83 343 1.20.1250.20
4n7wA00 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.2714 16 339 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A518MZ44-F1-model_v4 Acyltransferase 0.992 13 359 GO:0016020
GO:0016747
AF-A0A6I4HWP7-F1-model_v4 Acyltransferase 0.9919 14 363 GO:0016747
AF-A0A1S8ZR95-F1-model_v4 Acyltransferase 0.9862 8 359 GO:0016020
GO:0016747
AF-A0A162QDI1-F1-model_v4 Acyltransferase 0.9858 47 354 GO:0016020
GO:0016747
AF-A0A0E9MX04-F1-model_v4 Putative acyltransferase 0.9839 38 361 GO:0016020
GO:0016747

Map