F429656

General Info

Members Datasets Scaffolds Average Seq Length
383 220 766 160

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0156758|Ga0395905_0156758_582_1085
Length 167
Sequence MEHMMSNIERAKTDPIAQLWDEIDGVHMVMLGSPDHSQHMQPMAPQSAREEKAIWFFTRVDSDIARSAASGGTVHMCLVTDDYQACLDGDLQTTYSRDHIDRYWSSMVEAWFPGGKDDAEVTMLRFTPRTAEIWASTGSKLIMGWEIAKAITTGEQPDVGHHTRVTF

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
66 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
140 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
141 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
148 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
149 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
209 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
212 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
213 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
214 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
215 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.89
Nodule 0
Rhizoplane 2.61
Rhizosphere 65.54
Stem 0
Stem Tuber 0
Unclassified 3.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0156758 3300037471 Bacteria 2141
2 ARcpr5oldR_c002964 3300000041 Bacteria 1532
3 ARCol0yngRDRAFT_1001660 3300000652 Bacteria 1767
4 JGI24736J21556_1003976 3300001904 Unclassified 2543
5 JGI24736J21556_1036023 3300001904 Bacteria 763
6 JGI24741J21665_1001375 3300001915 Bacteria 7023
7 JGI24739J22299_10002466 3300001989 Bacteria 7140
8 JGI24739J22299_10013482 3300001989 Bacteria 2984
9 JGI24739J22299_10022591 3300001989 Bacteria 2231
10 JGI24739J22299_10155202 3300001989 Bacteria 676
11 JGI24737J22298_10001073 3300001990 Bacteria 9633
12 JGI24737J22298_10002842 3300001990 Bacteria 6133
13 JGI24737J22298_10010458 3300001990 Bacteria 3061
14 JGI24735J21928_10001323 3300002067 Bacteria 8759
15 JGI24738J21930_10014469 3300002075 Unclassified 1692
16 JGI25150J39212_1000696 3300002774 Bacteria 12171
17 JGI25150J39212_1024907 3300002774 Bacteria 877
18 JGI25151J46595_10020753 3300003187 Bacteria 2764
19 JGI25153J46596_10000021 3300003215 Bacteria 252651
20 JGI25153J46596_10000028 3300003215 Bacteria 209842
21 JGI25153J46596_10018657 3300003215 Bacteria 2685
22 rootH1_10058476 3300003316 Bacteria 1320
23 rootH1_10066456 3300003316 Unclassified 2327
24 Ga0055542_1000102 3300003762 Bacteria 115614
25 Ga0055529_1000136 3300003763 Bacteria 104102
26 Ga0055526_1004072 3300003771 Bacteria 8964
27 Ga0055526_1048376 3300003771 Bacteria 990
28 Ga0055537_1001622 3300003773 Bacteria 8442
29 Ga0055537_1003786 3300003773 Bacteria 4541
30 Ga0055524_1000178 3300003775 Bacteria 72273
31 Ga0055536_1021758 3300003781 Bacteria 1934
32 Ga0055530_10000082 3300003791 Bacteria 81812
33 Ga0055530_10017294 3300003791 Bacteria 2265
34 Ga0055530_10018011 3300003791 Bacteria 2193
35 Ga0055540_1007035 3300003792 Bacteria 4332
36 Ga0055531_10000012 3300003794 Bacteria 191187
37 Ga0055531_10023867 3300003794 Bacteria 2276
38 Ga0055531_10024013 3300003794 Bacteria 2265
39 Ga0055531_10024361 3300003794 Bacteria 2236
40 Ga0055531_10024846 3300003794 Bacteria 2195
41 Ga0065165_1007600 3300005262 Bacteria 5280
42 Ga0065165_1010661 3300005262 Bacteria 3939
43 Ga0070670_100251420 3300005331 Bacteria 1540
44 Ga0070680_100979069 3300005336 Bacteria 730
45 Ga0068868_100130903 3300005338 Bacteria 2053
46 Ga0070660_100017933 3300005339 Bacteria 5165
47 Ga0070660_100118502 3300005339 Unclassified 2111
48 Ga0070660_100274071 3300005339 Bacteria 1380
49 Ga0070661_100009503 3300005344 Bacteria 6736
50 Ga0070661_100564636 3300005344 Bacteria 917
51 Ga0070661_100579261 3300005344 Bacteria 905
52 Ga0070661_100750303 3300005344 Bacteria 798
53 Ga0070661_101281705 3300005344 Unclassified 614
54 Ga0070668_100041010 3300005347 Bacteria 3545
55 Ga0070671_100079563 3300005355 Bacteria 2740
56 Ga0070671_100542185 3300005355 Bacteria 1003
57 Ga0070674_100010850 3300005356 Bacteria 5524
58 Ga0070674_100025747 3300005356 Bacteria 3833
59 Ga0070673_100251513 3300005364 Bacteria 1540
60 Ga0070673_101486986 3300005364 Bacteria 638
61 Ga0070667_100025937 3300005367 Bacteria 4875
62 Ga0070667_100184337 3300005367 Bacteria 1847
63 Ga0070678_100001001 3300005456 Bacteria 14656
64 Ga0070662_100064250 3300005457 Bacteria 2687
65 Ga0070662_100769103 3300005457 Bacteria 817
66 Ga0070685_10561564 3300005466 Bacteria 816
67 Ga0068853_100280784 3300005539 Bacteria 1535
68 Ga0068853_100522221 3300005539 Bacteria 1122
69 Ga0068853_101234686 3300005539 Unclassified 722
70 Ga0070665_101509917 3300005548 Bacteria 680
71 Ga0068855_100000641 3300005563 Bacteria 42804
72 Ga0068857_101008580 3300005577 Bacteria 801
73 Ga0068857_101055121 3300005577 Bacteria 783
74 Ga0068854_100175945 3300005578 Bacteria 1668
75 Ga0068854_100250036 3300005578 Bacteria 1415
76 Ga0068854_100728208 3300005578 Bacteria 858
77 Ga0068856_100131848 3300005614 Bacteria 2504
78 Ga0068856_100333747 3300005614 Bacteria 1534
79 Ga0068852_100104861 3300005616 Bacteria 2560
80 Ga0068861_101328908 3300005719 Bacteria 700
81 Ga0068851_10062380 3300005834 Bacteria 1912
82 Ga0068851_10114277 3300005834 Bacteria 1444
83 Ga0068858_100000228 3300005842 Bacteria 60736
84 Ga0068862_100021838 3300005844 Bacteria 5352
85 Ga0068862_100453527 3300005844 Bacteria 1209
86 Ga0081455_10572239 3300005937 Bacteria 742
87 Ga0075369_10009478 3300006186 Bacteria 3784
88 Ga0075366_10241703 3300006195 Unclassified 1101
89 Ga0097621_100071243 3300006237 Bacteria 2872
90 Ga0075370_10719161 3300006353 Unclassified 607
91 Ga0068865_101501536 3300006881 Bacteria 604
92 Ga0105240_10001102 3300009093 Bacteria 47631
93 Ga0105240_10037728 3300009093 Bacteria 6208
94 Ga0105240_10045760 3300009093 Bacteria 5550
95 Ga0105245_10696306 3300009098 Bacteria 1049
96 Ga0105247_10248104 3300009101 Bacteria 1216
97 Ga0105243_10000406 3300009148 Bacteria 45265
98 Ga0105243_10522499 3300009148 Bacteria 1129
99 Ga0105241_10003027 3300009174 Bacteria 12558
100 Ga0105241_10346537 3300009174 Bacteria 1288
101 Ga0105242_10178642 3300009176 Bacteria 1871
102 Ga0105242_11358880 3300009176 Bacteria 736
103 Ga0105248_10058979 3300009177 Bacteria 4311
104 Ga0105248_11235082 3300009177 Bacteria 845
105 Ga0105237_10057265 3300009545 Bacteria 3901
106 Ga0105237_10368211 3300009545 Bacteria 1442
107 Ga0105237_10561626 3300009545 Bacteria 1148
108 Ga0105238_10034750 3300009551 Bacteria 5127
109 Ga0105239_10000104 3300010375 Bacteria 117927
110 Ga0105239_10112526 3300010375 Bacteria 3018
111 Ga0105239_10114774 3300010375 Bacteria 2987
112 Ga0105239_10600613 3300010375 Bacteria 1255
113 Ga0105239_12540672 3300010375 Bacteria 597
114 Ga0105246_10239254 3300011119 Bacteria 1434
115 Ga0157317_1011142 3300012475 Bacteria 697
116 Ga0157326_1002246 3300012513 Bacteria 2082
117 Ga0157371_10000066 3300013102 Bacteria 168406
118 Ga0157371_10247879 3300013102 Bacteria 1282
119 Ga0157370_10317820 3300013104 Bacteria 1436
120 Ga0157369_11177945 3300013105 Bacteria 782
121 Ga0157369_11576464 3300013105 Bacteria 668
122 Ga0157378_10017144 3300013297 Bacteria 6349
123 Ga0163162_10006267 3300013306 Bacteria 11524
124 Ga0157372_10514479 3300013307 Bacteria 1396
125 Ga0157372_10981459 3300013307 Bacteria 979
126 Ga0163163_10133178 3300014325 Bacteria 2526
127 Ga0157376_11728108 3300014969 Bacteria 661
128 Ga0163161_10123335 3300017792 Bacteria 1949
129 Ga0209563_100053 3300025230 Bacteria 332370
130 Ga0207425_1000005 3300025245 Bacteria 900502
131 Ga0209646_1025816 3300025246 Bacteria 818
132 Ga0209677_103801 3300025253 Bacteria 4681
133 Ga0209148_1000159 3300025254 Bacteria 139560
134 Ga0209129_1002894 3300025258 Bacteria 7892
135 Ga0209233_1048811 3300025261 Bacteria 872
136 Ga0209565_1000030 3300025263 Bacteria 325058
137 Ga0209565_1001030 3300025263 Bacteria 14160
138 Ga0209455_1000045 3300025272 Bacteria 383329
139 Ga0209673_1004082 3300025273 Bacteria 8048
140 Ga0209673_1010400 3300025273 Bacteria 3924
141 Ga0209676_1011667 3300025292 Bacteria 3521
142 Ga0209676_1019674 3300025292 Bacteria 2316
143 Ga0209025_1000464 3300025294 Bacteria 79341
144 Ga0209564_1000899 3300025295 Bacteria 39101
145 Ga0209758_1000002 3300025297 Bacteria 1400310
146 Ga0209758_1000023 3300025297 Bacteria 612453
147 Ga0209758_1025648 3300025297 Bacteria 2578
148 Ga0209758_1067977 3300025297 Bacteria 1137
149 Ga0209050_1000005 3300025298 Bacteria 1557793
150 Ga0209050_1000039 3300025298 Bacteria 410069
151 Ga0209050_1011651 3300025298 Bacteria 4137
152 Ga0209050_1018814 3300025298 Bacteria 2660
153 Ga0209256_1000046 3300025299 Bacteria 325040
154 Ga0209051_1000212 3300025303 Bacteria 100189
155 Ga0209051_1026778 3300025303 Bacteria 2314
156 Ga0209257_1000051 3300025304 Bacteria 434166
157 Ga0209257_1001147 3300025304 Bacteria 33719
158 Ga0209257_1001151 3300025304 Bacteria 33659
159 Ga0209257_1001844 3300025304 Bacteria 23083
160 Ga0209257_1006378 3300025304 Bacteria 7636
161 Ga0209257_1067434 3300025304 Bacteria 954
162 Ga0207656_10048996 3300025321 Bacteria 1820
163 Ga0207656_10201559 3300025321 Bacteria 961
164 Ga0207688_10164430 3300025901 Bacteria 1317
165 Ga0207647_10003027 3300025904 Bacteria 12651
166 Ga0207647_10095426 3300025904 Bacteria 1771
167 Ga0207647_10658381 3300025904 Bacteria 574
168 Ga0207705_10000523 3300025909 Bacteria 32624
169 Ga0207654_10022329 3300025911 Bacteria 3375
170 Ga0207654_10256926 3300025911 Bacteria 1173
171 Ga0207695_10001640 3300025913 Bacteria 36144
172 Ga0207695_10052685 3300025913 Bacteria 4260
173 Ga0207695_10070828 3300025913 Bacteria 3562
174 Ga0207695_10499539 3300025913 Bacteria 1098
175 Ga0207695_10715749 3300025913 Bacteria 882
176 Ga0207671_10017407 3300025914 Bacteria 5543
177 Ga0207671_10026724 3300025914 Bacteria 4322
178 Ga0207671_10130863 3300025914 Bacteria 1926
179 Ga0207671_10993253 3300025914 Bacteria 662
180 Ga0207657_10003196 3300025919 Bacteria 17532
181 Ga0207657_10686303 3300025919 Unclassified 796
182 Ga0207649_10000069 3300025920 Bacteria 91425
183 Ga0207649_10417514 3300025920 Bacteria 1007
184 Ga0207649_10550194 3300025920 Bacteria 883
185 Ga0207649_10819261 3300025920 Bacteria 727
186 Ga0207694_10008126 3300025924 Bacteria 7928
187 Ga0207694_10048226 3300025924 Bacteria 3295
188 Ga0207694_10104451 3300025924 Bacteria 2248
189 Ga0207694_10391151 3300025924 Bacteria 1155
190 Ga0207650_10161832 3300025925 Bacteria 1774
191 Ga0207687_11291709 3300025927 Bacteria 627
192 Ga0207644_10112128 3300025931 Bacteria 2064
193 Ga0207690_10000232 3300025932 Bacteria 41579
194 Ga0207706_10095264 3300025933 Bacteria 2618
195 Ga0207709_10000047 3300025935 Bacteria 238649
196 Ga0207669_10013444 3300025937 Bacteria 4065
197 Ga0207704_11035078 3300025938 Bacteria 696
198 Ga0207711_10032710 3300025941 Bacteria 4398
199 Ga0207661_11980029 3300025944 Bacteria 528
200 Ga0207679_10542204 3300025945 Bacteria 1043
201 Ga0207667_10000001 3300025949 Bacteria 1178522
202 Ga0207667_10001189 3300025949 Bacteria 32640
203 Ga0207667_10004096 3300025949 Bacteria 17909
204 Ga0207667_10576506 3300025949 Bacteria 1136
205 Ga0207651_10273135 3300025960 Bacteria 1393
206 Ga0207668_10016495 3300025972 Bacteria 4611
207 Ga0207668_10055714 3300025972 Bacteria 2750
208 Ga0207640_10002528 3300025981 Bacteria 9801
209 Ga0207640_10017311 3300025981 Bacteria 4215
210 Ga0207640_10041701 3300025981 Bacteria 2921
211 Ga0207640_10225846 3300025981 Bacteria 1437
212 Ga0207640_10435419 3300025981 Bacteria 1077
213 Ga0207658_10154957 3300025986 Bacteria 1871
214 Ga0207677_10130461 3300026023 Bacteria 1907
215 Ga0207703_10008077 3300026035 Bacteria 8318
216 Ga0207639_10031543 3300026041 Bacteria 3895
217 Ga0207639_10274025 3300026041 Bacteria 1481
218 Ga0207678_10001262 3300026067 Bacteria 23373
219 Ga0207702_10120248 3300026078 Bacteria 2349
220 Ga0207702_10196491 3300026078 Bacteria 1867
221 Ga0207676_10000190 3300026095 Bacteria 53850
222 Ga0207674_11163512 3300026116 Bacteria 741
223 Ga0207674_11832608 3300026116 Bacteria 573
224 Ga0207675_100050875 3300026118 Bacteria 3867
225 Ga0207683_10003855 3300026121 Bacteria 13012
226 Ga0207698_10151808 3300026142 Bacteria 2012
227 Ga0268266_10000015 3300028379 Bacteria 630629
228 Ga0268265_10058575 3300028380 Bacteria 2942
229 Ga0268265_10525806 3300028380 Bacteria 1119
230 Ga0307517_10010769 3300028786 Bacteria 12749
231 Ga0307517_10053457 3300028786 Bacteria 4021
232 Ga0307517_10241842 3300028786 Bacteria 1070
233 Ga0314311_1010417 3300030733 Bacteria 1975
234 Ga0307513_10116304 3300031456 Bacteria 2654
235 Ga0307413_11016008 3300031824 Bacteria 712
236 Ga0307412_10002595 3300031911 Bacteria 10034
237 Ga0307412_10288059 3300031911 Bacteria 1292
238 Ga0307412_10825035 3300031911 Bacteria 807
239 Ga0395900_0321313 3300037418 Bacteria 1528
240 Ga0395900_1245871 3300037418 Bacteria 659
241 Ga0395905_0014159 3300037471 Bacteria 7621
242 Ga0395905_0032953 3300037471 Bacteria 4870
243 Ga0395901_0062626 3300038443 Bacteria 3871
244 Ga0439436_0005388 3300041404 Bacteria 3919
245 Ga0439439_0010655 3300041406 Bacteria 2201
246 Ga0439439_0088139 3300041406 Bacteria 845
247 Ga0439461_0014138 3300041410 Bacteria 1513
248 Ga0439466_0020118 3300041411 Bacteria 2383
249 Ga0439465_0001779 3300041413 Bacteria 7053
250 Ga0451795_0213830 3300041456 Bacteria 826
251 Ga0439431_0000708 3300041997 Bacteria 7172
252 Ga0439431_0015052 3300041997 Bacteria 1797
253 Ga0439432_010352 3300042006 Bacteria 3233
254 Ga0439452_022776 3300042010 Bacteria 1618
255 Ga0439452_093010 3300042010 Bacteria 651
256 Ga0439462_0009592 3300042015 Bacteria 2447
257 Ga0439446_0023747 3300042156 Bacteria 1746
258 Ga0439446_0106901 3300042156 Bacteria 889
259 Ga0439434_0000185 3300042435 Bacteria 17001
260 Ga0439434_0010743 3300042435 Bacteria 2701
261 Ga0466970_0066361 3300044765 Bacteria 1937
262 Ga0495617_103910 3300046452 Bacteria 922
263 Ga0495650_0000491 3300046471 Bacteria 60068
264 Ga0495584_0037578 3300046491 Bacteria 2448
265 Ga0495584_0053812 3300046491 Bacteria 2026
266 Ga0495585_0003633 3300046492 Bacteria 10326
267 Ga0495596_0034348 3300046500 Bacteria 2014
268 Ga0495607_0212216 3300046501 Bacteria 952
269 Ga0495583_0000662 3300046506 Bacteria 45107
270 Ga0495583_0002287 3300046506 Bacteria 16759
271 Ga0495583_0002512 3300046506 Bacteria 15522
272 Ga0495606_0041176 3300046507 Bacteria 3099
273 Ga0495606_0078630 3300046507 Bacteria 2057
274 Ga0495631_0002266 3300046518 Bacteria 11024
275 Ga0495631_0245474 3300046518 Bacteria 763
276 Ga0495632_0253206 3300046519 Bacteria 789
277 Ga0495637_0006030 3300046520 Bacteria 6120
278 Ga0495643_0000940 3300046522 Bacteria 30168
279 Ga0495643_0046852 3300046522 Bacteria 2342
280 Ga0495648_0000513 3300046524 Bacteria 41725
281 Ga0495648_0107925 3300046524 Bacteria 1521
282 Ga0495663_0021672 3300046525 Bacteria 1852
283 Ga0495642_0027226 3300046528 Bacteria 2274
284 Ga0495587_0020276 3300046536 Bacteria 4104
285 Ga0495597_0011441 3300046542 Bacteria 4302
286 Ga0495622_0008530 3300046557 Bacteria 4747
287 Ga0495633_0054059 3300046558 Bacteria 1889
288 Ga0495668_0000548 3300046616 Bacteria 46481
289 Ga0495668_0331206 3300046616 Bacteria 835
290 Ga0495611_0038627 3300046648 Bacteria 2124
291 Ga0495625_0000757 3300046660 Bacteria 45128
292 Ga0495625_0036994 3300046660 Bacteria 3583
293 Ga0495625_0158656 3300046660 Bacteria 1517
294 Ga0495625_0216429 3300046660 Bacteria 1257
295 Ga0495625_0305963 3300046660 Bacteria 1016
296 Ga0495625_0359419 3300046660 Bacteria 918
297 Ga0495669_0000772 3300046684 Bacteria 13687
298 Ga0495670_0000012 3300046691 Bacteria 170426
299 Ga0495670_0208412 3300046691 Bacteria 1036
300 Ga0495670_0586179 3300046691 Bacteria 607
301 Ga0495671_0197879 3300046692 Bacteria 975
302 Ga0495649_0137129 3300046694 Bacteria 1289
303 Ga0495649_0362352 3300046694 Bacteria 731
304 Ga0495600_0001225 3300046809 Bacteria 14066
305 Ga0495683_0011704 3300047323 Bacteria 4615
306 Ga0495683_0012794 3300047323 Bacteria 4402
307 Ga0495687_000192 3300047443 Bacteria 87877
308 Ga0495687_000611 3300047443 Bacteria 41726
309 Ga0495681_0011630 3300047470 Bacteria 5228
310 Ga0495681_0017785 3300047470 Bacteria 3936
311 Ga0495681_0062366 3300047470 Bacteria 1714
312 Ga0495686_0000070 3300047472 Bacteria 216642
313 Ga0495686_0000578 3300047472 Bacteria 51848
314 Ga0495686_0002775 3300047472 Bacteria 15982
315 Ga0496101_0509706 3300048904 Bacteria 951
316 Ga0496102_0000435 3300048905 Bacteria 47703
317 Ga0496103_0000177 3300048906 Bacteria 65489
318 Ga0496105_0000159 3300048908 Bacteria 44784
319 Ga0496110_0025540 3300048913 Bacteria 5049
320 Ga0496114_0003097 3300048917 Bacteria 12748
321 Ga0496114_1150240 3300048917 Bacteria 661
322 Ga0496115_0000314 3300048918 Bacteria 41118
323 Ga0496115_0002291 3300048918 Bacteria 13708
324 Ga0496116_0003911 3300048919 Bacteria 14514
325 Ga0496117_0001626 3300048920 Bacteria 31763
326 Ga0496117_0011791 3300048920 Bacteria 7786
327 Ga0496117_0017531 3300048920 Bacteria 5977
328 Ga0496117_0093638 3300048920 Bacteria 1926
329 Ga0496117_0294048 3300048920 Bacteria 863
330 Ga0496118_0000370 3300048921 Bacteria 75668
331 Ga0496118_0000850 3300048921 Bacteria 48481
332 Ga0496118_0052596 3300048921 Bacteria 3104
333 Ga0496119_0020375 3300048922 Bacteria 4841
334 Ga0496120_0016088 3300048923 Bacteria 4902
335 Ga0496121_0000801 3300048924 Bacteria 57303
336 Ga0496121_0002231 3300048924 Bacteria 30224
337 Ga0496121_0003769 3300048924 Bacteria 21184
338 Ga0496121_0058289 3300048924 Bacteria 3194
339 Ga0496121_0103477 3300048924 Bacteria 2190
340 Ga0496121_0131836 3300048924 Bacteria 1869
341 Ga0496121_0479110 3300048924 Bacteria 795
342 Ga0496122_0024754 3300048925 Bacteria 5242
343 Ga0496122_0089994 3300048925 Bacteria 2096
344 Ga0496122_0136380 3300048925 Bacteria 1546
345 Ga0496122_0262108 3300048925 Bacteria 958
346 Ga0496123_0004087 3300048926 Bacteria 15698
347 Ga0496123_0012821 3300048926 Bacteria 7103
348 Ga0496123_0049041 3300048926 Bacteria 2835
349 Ga0496124_0000703 3300048927 Bacteria 54743
350 Ga0496124_0001651 3300048927 Bacteria 31933
351 Ga0496124_0034846 3300048927 Bacteria 4410
352 Ga0496124_0161385 3300048927 Bacteria 1746
353 Ga0496124_0390111 3300048927 Bacteria 970
354 Ga0496125_0206612 3300048928 Bacteria 1280
355 Ga0496126_0005946 3300048929 Bacteria 13741
356 Ga0496126_0005968 3300048929 Bacteria 13695
357 Ga0496126_0683512 3300048929 Bacteria 799
358 Ga0496126_0993211 3300048929 Bacteria 630
359 Ga0495682_0027583 3300049460 Bacteria 2106
360 Ga0501033_0347630 3300049570 Unclassified 1039
361 Ga0501047_0312793 3300049581 Bacteria 1411
362 Ga0501080_0326295 3300049742 Bacteria 1389
363 Ga0501035_1161150 3300049822 Unclassified 601
364 nmdc:mga0k408_339996_c1 3300050493 Bacteria 895
365 nmdc:mga0k408_475007_c1 3300050493 Bacteria 742
366 nmdc:mga0sz30_42883_c1 3300050516 Bacteria 1904
367 Ga0500610_0000047 3300053079 Bacteria 40079
368 Ga0500566_0000840 3300053094 Bacteria 17527
369 Ga0500595_003877 3300053119 Bacteria 6868
370 Ga0500607_224210 3300053121 Bacteria 779
371 Ga0500618_029593 3300053125 Bacteria 1292
372 Ga0500626_124950 3300053128 Bacteria 1096
373 Ga0500642_0008271 3300053130 Bacteria 3550
374 Ga0500658_0022688 3300053134 Bacteria 2390
375 Ga0500658_0022769 3300053134 Bacteria 2386
376 Ga0500559_0132081 3300053136 Unclassified 1166
377 Ga0500559_0133832 3300053136 Bacteria 1158
378 Ga0500559_0212220 3300053136 Bacteria 913
379 Ga0500568_0005818 3300053139 Bacteria 6291
380 Ga0500616_0007246 3300053153 Bacteria 7081
381 Ga0500616_0102123 3300053153 Unclassified 1400
382 Ga0500636_0004300 3300053177 Bacteria 8061
383 Ga0500645_000116 3300053730 Bacteria 63698
384 Ga0395905_0156758
385 ARcpr5oldR_c002964
386 ARCol0yngRDRAFT_1001660
387 JGI24736J21556_1003976
388 JGI24736J21556_1036023
389 JGI24741J21665_1001375
390 JGI24739J22299_10002466
391 JGI24739J22299_10013482
392 JGI24739J22299_10022591
393 JGI24739J22299_10155202
394 JGI24737J22298_10001073
395 JGI24737J22298_10002842
396 JGI24737J22298_10010458
397 JGI24735J21928_10001323
398 JGI24738J21930_10014469
399 JGI25150J39212_1000696
400 JGI25150J39212_1024907
401 JGI25151J46595_10020753
402 JGI25153J46596_10000021
403 JGI25153J46596_10000028
404 JGI25153J46596_10018657
405 rootH1_10058476
406 rootH1_10066456
407 Ga0055542_1000102
408 Ga0055529_1000136
409 Ga0055526_1004072
410 Ga0055526_1048376
411 Ga0055537_1001622
412 Ga0055537_1003786
413 Ga0055524_1000178
414 Ga0055536_1021758
415 Ga0055530_10000082
416 Ga0055530_10017294
417 Ga0055530_10018011
418 Ga0055540_1007035
419 Ga0055531_10000012
420 Ga0055531_10023867
421 Ga0055531_10024013
422 Ga0055531_10024361
423 Ga0055531_10024846
424 Ga0065165_1007600
425 Ga0065165_1010661
426 Ga0070670_100251420
427 Ga0070680_100979069
428 Ga0068868_100130903
429 Ga0070660_100017933
430 Ga0070660_100118502
431 Ga0070660_100274071
432 Ga0070661_100009503
433 Ga0070661_100564636
434 Ga0070661_100579261
435 Ga0070661_100750303
436 Ga0070661_101281705
437 Ga0070668_100041010
438 Ga0070671_100079563
439 Ga0070671_100542185
440 Ga0070674_100010850
441 Ga0070674_100025747
442 Ga0070673_100251513
443 Ga0070673_101486986
444 Ga0070667_100025937
445 Ga0070667_100184337
446 Ga0070678_100001001
447 Ga0070662_100064250
448 Ga0070662_100769103
449 Ga0070685_10561564
450 Ga0068853_100280784
451 Ga0068853_100522221
452 Ga0068853_101234686
453 Ga0070665_101509917
454 Ga0068855_100000641
455 Ga0068857_101008580
456 Ga0068857_101055121
457 Ga0068854_100175945
458 Ga0068854_100250036
459 Ga0068854_100728208
460 Ga0068856_100131848
461 Ga0068856_100333747
462 Ga0068852_100104861
463 Ga0068861_101328908
464 Ga0068851_10062380
465 Ga0068851_10114277
466 Ga0068858_100000228
467 Ga0068862_100021838
468 Ga0068862_100453527
469 Ga0081455_10572239
470 Ga0075369_10009478
471 Ga0075366_10241703
472 Ga0097621_100071243
473 Ga0075370_10719161
474 Ga0068865_101501536
475 Ga0105240_10001102
476 Ga0105240_10037728
477 Ga0105240_10045760
478 Ga0105245_10696306
479 Ga0105247_10248104
480 Ga0105243_10000406
481 Ga0105243_10522499
482 Ga0105241_10003027
483 Ga0105241_10346537
484 Ga0105242_10178642
485 Ga0105242_11358880
486 Ga0105248_10058979
487 Ga0105248_11235082
488 Ga0105237_10057265
489 Ga0105237_10368211
490 Ga0105237_10561626
491 Ga0105238_10034750
492 Ga0105239_10000104
493 Ga0105239_10112526
494 Ga0105239_10114774
495 Ga0105239_10600613
496 Ga0105239_12540672
497 Ga0105246_10239254
498 Ga0157317_1011142
499 Ga0157326_1002246
500 Ga0157371_10000066
501 Ga0157371_10247879
502 Ga0157370_10317820
503 Ga0157369_11177945
504 Ga0157369_11576464
505 Ga0157378_10017144
506 Ga0163162_10006267
507 Ga0157372_10514479
508 Ga0157372_10981459
509 Ga0163163_10133178
510 Ga0157376_11728108
511 Ga0163161_10123335
512 Ga0209563_100053
513 Ga0207425_1000005
514 Ga0209646_1025816
515 Ga0209677_103801
516 Ga0209148_1000159
517 Ga0209129_1002894
518 Ga0209233_1048811
519 Ga0209565_1000030
520 Ga0209565_1001030
521 Ga0209455_1000045
522 Ga0209673_1004082
523 Ga0209673_1010400
524 Ga0209676_1011667
525 Ga0209676_1019674
526 Ga0209025_1000464
527 Ga0209564_1000899
528 Ga0209758_1000002
529 Ga0209758_1000023
530 Ga0209758_1025648
531 Ga0209758_1067977
532 Ga0209050_1000005
533 Ga0209050_1000039
534 Ga0209050_1011651
535 Ga0209050_1018814
536 Ga0209256_1000046
537 Ga0209051_1000212
538 Ga0209051_1026778
539 Ga0209257_1000051
540 Ga0209257_1001147
541 Ga0209257_1001151
542 Ga0209257_1001844
543 Ga0209257_1006378
544 Ga0209257_1067434
545 Ga0207656_10048996
546 Ga0207656_10201559
547 Ga0207688_10164430
548 Ga0207647_10003027
549 Ga0207647_10095426
550 Ga0207647_10658381
551 Ga0207705_10000523
552 Ga0207654_10022329
553 Ga0207654_10256926
554 Ga0207695_10001640
555 Ga0207695_10052685
556 Ga0207695_10070828
557 Ga0207695_10499539
558 Ga0207695_10715749
559 Ga0207671_10017407
560 Ga0207671_10026724
561 Ga0207671_10130863
562 Ga0207671_10993253
563 Ga0207657_10003196
564 Ga0207657_10686303
565 Ga0207649_10000069
566 Ga0207649_10417514
567 Ga0207649_10550194
568 Ga0207649_10819261
569 Ga0207694_10008126
570 Ga0207694_10048226
571 Ga0207694_10104451
572 Ga0207694_10391151
573 Ga0207650_10161832
574 Ga0207687_11291709
575 Ga0207644_10112128
576 Ga0207690_10000232
577 Ga0207706_10095264
578 Ga0207709_10000047
579 Ga0207669_10013444
580 Ga0207704_11035078
581 Ga0207711_10032710
582 Ga0207661_11980029
583 Ga0207679_10542204
584 Ga0207667_10000001
585 Ga0207667_10001189
586 Ga0207667_10004096
587 Ga0207667_10576506
588 Ga0207651_10273135
589 Ga0207668_10016495
590 Ga0207668_10055714
591 Ga0207640_10002528
592 Ga0207640_10017311
593 Ga0207640_10041701
594 Ga0207640_10225846
595 Ga0207640_10435419
596 Ga0207658_10154957
597 Ga0207677_10130461
598 Ga0207703_10008077
599 Ga0207639_10031543
600 Ga0207639_10274025
601 Ga0207678_10001262
602 Ga0207702_10120248
603 Ga0207702_10196491
604 Ga0207676_10000190
605 Ga0207674_11163512
606 Ga0207674_11832608
607 Ga0207675_100050875
608 Ga0207683_10003855
609 Ga0207698_10151808
610 Ga0268266_10000015
611 Ga0268265_10058575
612 Ga0268265_10525806
613 Ga0307517_10010769
614 Ga0307517_10053457
615 Ga0307517_10241842
616 Ga0314311_1010417
617 Ga0307513_10116304
618 Ga0307413_11016008
619 Ga0307412_10002595
620 Ga0307412_10288059
621 Ga0307412_10825035
622 Ga0395900_0321313
623 Ga0395900_1245871
624 Ga0395905_0014159
625 Ga0395905_0032953
626 Ga0395901_0062626
627 Ga0439436_0005388
628 Ga0439439_0010655
629 Ga0439439_0088139
630 Ga0439461_0014138
631 Ga0439466_0020118
632 Ga0439465_0001779
633 Ga0451795_0213830
634 Ga0439431_0000708
635 Ga0439431_0015052
636 Ga0439432_010352
637 Ga0439452_022776
638 Ga0439452_093010
639 Ga0439462_0009592
640 Ga0439446_0023747
641 Ga0439446_0106901
642 Ga0439434_0000185
643 Ga0439434_0010743
644 Ga0466970_0066361
645 Ga0495617_103910
646 Ga0495650_0000491
647 Ga0495584_0037578
648 Ga0495584_0053812
649 Ga0495585_0003633
650 Ga0495596_0034348
651 Ga0495607_0212216
652 Ga0495583_0000662
653 Ga0495583_0002287
654 Ga0495583_0002512
655 Ga0495606_0041176
656 Ga0495606_0078630
657 Ga0495631_0002266
658 Ga0495631_0245474
659 Ga0495632_0253206
660 Ga0495637_0006030
661 Ga0495643_0000940
662 Ga0495643_0046852
663 Ga0495648_0000513
664 Ga0495648_0107925
665 Ga0495663_0021672
666 Ga0495642_0027226
667 Ga0495587_0020276
668 Ga0495597_0011441
669 Ga0495622_0008530
670 Ga0495633_0054059
671 Ga0495668_0000548
672 Ga0495668_0331206
673 Ga0495611_0038627
674 Ga0495625_0000757
675 Ga0495625_0036994
676 Ga0495625_0158656
677 Ga0495625_0216429
678 Ga0495625_0305963
679 Ga0495625_0359419
680 Ga0495669_0000772
681 Ga0495670_0000012
682 Ga0495670_0208412
683 Ga0495670_0586179
684 Ga0495671_0197879
685 Ga0495649_0137129
686 Ga0495649_0362352
687 Ga0495600_0001225
688 Ga0495683_0011704
689 Ga0495683_0012794
690 Ga0495687_000192
691 Ga0495687_000611
692 Ga0495681_0011630
693 Ga0495681_0017785
694 Ga0495681_0062366
695 Ga0495686_0000070
696 Ga0495686_0000578
697 Ga0495686_0002775
698 Ga0496101_0509706
699 Ga0496102_0000435
700 Ga0496103_0000177
701 Ga0496105_0000159
702 Ga0496110_0025540
703 Ga0496114_0003097
704 Ga0496114_1150240
705 Ga0496115_0000314
706 Ga0496115_0002291
707 Ga0496116_0003911
708 Ga0496117_0001626
709 Ga0496117_0011791
710 Ga0496117_0017531
711 Ga0496117_0093638
712 Ga0496117_0294048
713 Ga0496118_0000370
714 Ga0496118_0000850
715 Ga0496118_0052596
716 Ga0496119_0020375
717 Ga0496120_0016088
718 Ga0496121_0000801
719 Ga0496121_0002231
720 Ga0496121_0003769
721 Ga0496121_0058289
722 Ga0496121_0103477
723 Ga0496121_0131836
724 Ga0496121_0479110
725 Ga0496122_0024754
726 Ga0496122_0089994
727 Ga0496122_0136380
728 Ga0496122_0262108
729 Ga0496123_0004087
730 Ga0496123_0012821
731 Ga0496123_0049041
732 Ga0496124_0000703
733 Ga0496124_0001651
734 Ga0496124_0034846
735 Ga0496124_0161385
736 Ga0496124_0390111
737 Ga0496125_0206612
738 Ga0496126_0005946
739 Ga0496126_0005968
740 Ga0496126_0683512
741 Ga0496126_0993211
742 Ga0495682_0027583
743 Ga0501033_0347630
744 Ga0501047_0312793
745 Ga0501080_0326295
746 Ga0501035_1161150
747 nmdc:mga0k408_339996_c1
748 nmdc:mga0k408_475007_c1
749 nmdc:mga0sz30_42883_c1
750 Ga0500610_0000047
751 Ga0500566_0000840
752 Ga0500595_003877
753 Ga0500607_224210
754 Ga0500618_029593
755 Ga0500626_124950
756 Ga0500642_0008271
757 Ga0500658_0022688
758 Ga0500658_0022769
759 Ga0500559_0132081
760 Ga0500559_0133832
761 Ga0500559_0212220
762 Ga0500568_0005818
763 Ga0500616_0007246
764 Ga0500616_0102123
765 Ga0500636_0004300
766 Ga0500645_000116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16242

Pyrid_ox_like

Pyridoxamine 5'-phosphate oxidase like

14

158

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u34-assembly1.cif.gz_A crystal structure of the general stress fmn/fad binding protein from the phytopathogen xanthomonas citri 0.9303 6 130
3dmb-assembly1.cif.gz_B-2 crystal structure of a putative general stress family protein (xcc2264) from xanthomonas campestris pv. campestris at 2.30 a resolution 0.9052 1 130
3dmb-assembly1.cif.gz_C-2 crystal structure of a putative general stress family protein (xcc2264) from xanthomonas campestris pv. campestris at 2.30 a resolution 0.8982 6 130
2re7-assembly1.cif.gz_A-2 crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution 0.8873 9 126
2qea-assembly1.cif.gz_A crystal structure of a putative general stress protein 26 (jann_0955) from jannaschia sp. ccs1 at 2.46 a resolution 0.8586 4 154
ID Description Score Start End Superfamily
3dmbC00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8892 6 130 2.30.110.10
2re7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8735 9 126 2.30.110.10
2qeaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8257 6 154 2.30.110.10
3dmbC00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.812 6 130 2.30.110.10
2qeaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.801 6 154 2.30.110.10
ID Description Score Start End GO Terms
AF-W1KY17-F1-model_v4 deleted 0.973 1 157
AF-A0A4Q5S484-F1-model_v4 General stress protein 0.9655 1 159
AF-A0A7H0LD30-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9641 2 156
AF-A0A6M5JFH7-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9606 3 159
AF-A0A2A2K2J5-F1-model_v4 General stress protein FMN-binding split barrel domain-containing protein 0.9602 4 157

Map