F429660

General Info

Members Datasets Scaffolds Average Seq Length
383 179 766 295

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0146281|Ga0395901_0146281_1361_2230
Length 289
Sequence MTWQFILAGLAVGVLVGMTGMGGGSLMTPMLILLFGFDPKTAVGTDLLHGAVFKSFGAWRHRQLGNVHTKLALWMLVGSAPLSLVGVQLASSFSDAAQSTMGRVVGGTLIVGGLGFLAKTFLPKRAAEDDDFAITRRVRILAILIGATFGFVVGLTSVGSGTFFGLAMLLLFPFSATRMVGTDMLHAALLLWVAGAGHLLHGNVDLHAIAWLLVGSIPGVLIGSHLSIRVPDRALRIAFGFVLVLSGLKIVKVPAADTVIEVSLVLGAVALLAWSARSLLQRRFPVPAD

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 1.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.53
Rhizosphere 93.47
Stem 0
Stem Tuber 0
Unclassified 6.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0146281 3300038443 Bacteria 2483
2 JGI25407J50210_10001088 3300003373 Bacteria 5979
3 JGI25407J50210_10013454 3300003373 Bacteria 2103
4 JGI25407J50210_10037635 3300003373 Bacteria 1243
5 Ga0070658_10054755 3300005327 Bacteria 3239
6 Ga0070658_10115086 3300005327 Unclassified 2231
7 Ga0070658_10424213 3300005327 Bacteria 1144
8 Ga0070683_100002112 3300005329 Bacteria 15693
9 Ga0070683_100031333 3300005329 Unclassified 4834
10 Ga0070683_100076447 3300005329 Bacteria 3129
11 Ga0070683_100155604 3300005329 Bacteria 2168
12 Ga0070680_100002340 3300005336 Bacteria 14005
13 Ga0070680_100005282 3300005336 Bacteria 9766
14 Ga0070680_100108828 3300005336 Bacteria 2306
15 Ga0070680_100115292 3300005336 Bacteria 2239
16 Ga0070682_100080374 3300005337 Bacteria 2108
17 Ga0070660_100001872 3300005339 Bacteria 14489
18 Ga0070660_100003645 3300005339 Bacteria 10637
19 Ga0070660_100005099 3300005339 Bacteria 9074
20 Ga0070660_100052328 3300005339 Bacteria 3148
21 Ga0070660_100170579 3300005339 Bacteria 1757
22 Ga0070661_100109476 3300005344 Bacteria 2062
23 Ga0070661_100148936 3300005344 Bacteria 1768
24 Ga0070661_100183343 3300005344 Bacteria 1593
25 Ga0070671_100294705 3300005355 Bacteria 1381
26 Ga0070659_100019778 3300005366 Bacteria 5110
27 Ga0070714_100147935 3300005435 Bacteria 2114
28 Ga0070713_100099969 3300005436 Bacteria 2510
29 Ga0070663_100137794 3300005455 Unclassified 1860
30 Ga0070663_100140719 3300005455 Bacteria 1842
31 Ga0070681_10001749 3300005458 Bacteria 19455
32 Ga0070681_10055059 3300005458 Bacteria 3962
33 Ga0070681_10058835 3300005458 Bacteria 3822
34 Ga0070681_10155919 3300005458 Bacteria 2208
35 Ga0070707_100494987 3300005468 Bacteria 1184
36 Ga0070679_100019856 3300005530 Bacteria 6543
37 Ga0070679_100091197 3300005530 Bacteria 3035
38 Ga0070679_100129481 3300005530 Bacteria 2505
39 Ga0070684_100006051 3300005535 Bacteria 9322
40 Ga0070684_100064771 3300005535 Bacteria 3207
41 Ga0070684_100285108 3300005535 Bacteria 1514
42 Ga0068853_100102099 3300005539 Bacteria 2537
43 Ga0068853_100142172 3300005539 Bacteria 2155
44 Ga0070665_100007776 3300005548 Bacteria 10889
45 Ga0068855_100016807 3300005563 Bacteria 8797
46 Ga0068855_100058375 3300005563 Bacteria 4519
47 Ga0068855_100058505 3300005563 Bacteria 4513
48 Ga0068855_100082196 3300005563 Bacteria 3733
49 Ga0068855_100535925 3300005563 Bacteria 1269
50 Ga0070664_100255493 3300005564 Bacteria 1576
51 Ga0068857_100004349 3300005577 Bacteria 11961
52 Ga0068857_100034831 3300005577 Bacteria 4454
53 Ga0068857_100048030 3300005577 Bacteria 3790
54 Ga0068857_100319321 3300005577 Bacteria 1434
55 Ga0068856_100063809 3300005614 Bacteria 3639
56 Ga0068856_100077855 3300005614 Bacteria 3286
57 Ga0068852_100028710 3300005616 Bacteria 4558
58 Ga0068852_100238168 3300005616 Bacteria 1738
59 Ga0081455_10182381 3300005937 Bacteria 1588
60 Ga0081538_10001009 3300005981 Bacteria 30023
61 Ga0081538_10002042 3300005981 Bacteria 20143
62 Ga0081538_10002956 3300005981 Bacteria 16226
63 Ga0081538_10007344 3300005981 Bacteria 9544
64 Ga0075432_10032363 3300006058 Bacteria 1812
65 Ga0075428_100009522 3300006844 Bacteria 10786
66 Ga0075430_100116612 3300006846 Bacteria 2225
67 Ga0075429_100011193 3300006880 Bacteria 7767
68 Ga0075436_100104234 3300006914 Bacteria 1977
69 Ga0105240_10107388 3300009093 Bacteria 3384
70 Ga0105240_10272467 3300009093 Unclassified 1948
71 Ga0105240_10282134 3300009093 Bacteria 1907
72 Ga0111539_10015598 3300009094 Bacteria 9448
73 Ga0105241_10197843 3300009174 Unclassified 1677
74 Ga0105241_10243557 3300009174 Bacteria 1521
75 Ga0105242_10081875 3300009176 Bacteria 2700
76 Ga0105237_10116325 3300009545 Bacteria 2667
77 Ga0105238_10040636 3300009551 Bacteria 4712
78 Ga0105239_10112109 3300010375 Bacteria 3024
79 Ga0157373_10077476 3300013100 Bacteria 2345
80 Ga0157370_10005431 3300013104 Bacteria 14298
81 Ga0157370_10022199 3300013104 Bacteria 6316
82 Ga0157370_10038885 3300013104 Bacteria 4601
83 Ga0157370_10170414 3300013104 Bacteria 2024
84 Ga0157370_10244965 3300013104 Bacteria 1658
85 Ga0157369_10002266 3300013105 Bacteria 23125
86 Ga0157369_10003630 3300013105 Bacteria 18313
87 Ga0157369_10092014 3300013105 Bacteria 3236
88 Ga0157369_10104505 3300013105 Bacteria 3016
89 Ga0157369_10123760 3300013105 Bacteria 2743
90 Ga0157374_10145439 3300013296 Bacteria 2302
91 Ga0157372_10126542 3300013307 Bacteria 2938
92 Ga0157375_10496175 3300013308 Bacteria 1385
93 Ga0206356_10435686 3300020070 Bacteria 1425
94 Ga0206353_10001931 3300020082 Bacteria 1771
95 Ga0206353_10110823 3300020082 Bacteria 4343
96 Ga0206353_12040575 3300020082 Bacteria 2548
97 Ga0207707_10003849 3300025912 Bacteria 13301
98 Ga0207707_10034498 3300025912 Bacteria 4427
99 Ga0207707_10056792 3300025912 Bacteria 3406
100 Ga0207707_10134362 3300025912 Bacteria 2163
101 Ga0207695_10255537 3300025913 Bacteria 1651
102 Ga0207695_10470644 3300025913 Bacteria 1139
103 Ga0207671_10066603 3300025914 Bacteria 2681
104 Ga0207660_10066132 3300025917 Bacteria 2615
105 Ga0207660_10308208 3300025917 Bacteria 1262
106 Ga0207657_10000299 3300025919 Bacteria 52815
107 Ga0207657_10005518 3300025919 Bacteria 13209
108 Ga0207657_10011682 3300025919 Bacteria 8702
109 Ga0207657_10072398 3300025919 Bacteria 2916
110 Ga0207657_10187946 3300025919 Bacteria 1667
111 Ga0207649_10039582 3300025920 Bacteria 2859
112 Ga0207649_10206422 3300025920 Bacteria 1391
113 Ga0207652_10020309 3300025921 Bacteria 5468
114 Ga0207652_10070790 3300025921 Bacteria 3029
115 Ga0207652_10152393 3300025921 Bacteria 2070
116 Ga0207652_10318486 3300025921 Bacteria 1404
117 Ga0207694_10040166 3300025924 Bacteria 3601
118 Ga0207700_10073768 3300025928 Bacteria 2636
119 Ga0207700_10344786 3300025928 Bacteria 1296
120 Ga0207664_10025823 3300025929 Bacteria 4431
121 Ga0207664_10198979 3300025929 Bacteria 1728
122 Ga0207690_10078865 3300025932 Bacteria 2293
123 Ga0207690_10086232 3300025932 Bacteria 2206
124 Ga0207661_10020403 3300025944 Bacteria 4954
125 Ga0207661_10055341 3300025944 Bacteria 3182
126 Ga0207667_10212883 3300025949 Unclassified 1981
127 Ga0207667_10239701 3300025949 Bacteria 1856
128 Ga0207667_10324821 3300025949 Bacteria 1571
129 Ga0207639_10058522 3300026041 Bacteria 2964
130 Ga0207639_10105561 3300026041 Bacteria 2286
131 Ga0207678_10049607 3300026067 Bacteria 3628
132 Ga0207674_10060742 3300026116 Bacteria 3822
133 Ga0207698_10027583 3300026142 Bacteria 4034
134 Ga0207428_10079389 3300027907 Bacteria 2566
135 Ga0268266_10033213 3300028379 Bacteria 4388
136 Ga0265322_10026375 3300028654 Bacteria 1661
137 Ga0373943_0000818 3300035170 Bacteria 13676
138 Ga0373955_0031491 3300035172 Bacteria 2779
139 Ga0373924_0056586 3300035410 Bacteria 1634
140 Ga0373937_0024016 3300036401 Bacteria 5497
141 Ga0395899_0129921 3300037312 Bacteria 1799
142 Ga0395899_0186975 3300037312 Archaea 1451
143 Ga0395900_0024603 3300037418 Bacteria 6163
144 Ga0395900_0065988 3300037418 Bacteria 3719
145 Ga0395900_0068293 3300037418 Bacteria 3652
146 Ga0395900_0184352 3300037418 Unclassified 2119
147 Ga0395900_0451181 3300037418 Bacteria 1242
148 Ga0395898_0003654 3300037466 Bacteria 17105
149 Ga0395898_0103262 3300037466 Bacteria 2735
150 Ga0395898_0106057 3300037466 Unclassified 2695
151 Ga0395898_0291995 3300037466 Bacteria 1555
152 Ga0395905_0347288 3300037471 Unclassified 1375
153 Ga0395905_0443232 3300037471 Bacteria 1196
154 Ga0395901_0002691 3300038443 Bacteria 17924
155 Ga0395901_0004023 3300038443 Bacteria 14808
156 Ga0395901_0084166 3300038443 Bacteria 3324
157 Ga0466965_0054243 3300044683 Bacteria 1993
158 Ga0466966_0012527 3300044684 Bacteria 5617
159 Ga0466966_0049410 3300044684 Bacteria 2679
160 Ga0466966_0132012 3300044684 Unclassified 1529
161 Ga0466963_0000397 3300044694 Bacteria 19859
162 Ga0466963_0003568 3300044694 Bacteria 8937
163 Ga0466963_0024031 3300044694 Bacteria 3876
164 Ga0466963_0120845 3300044694 Bacteria 1802
165 Ga0466963_0159354 3300044694 Bacteria 1570
166 Ga0466963_0262595 3300044694 Bacteria 1212
167 Ga0466964_0006273 3300044706 Bacteria 4428
168 Ga0466964_0017205 3300044706 Bacteria 2766
169 Ga0466971_0000419 3300044719 Bacteria 16573
170 Ga0466971_0004499 3300044719 Bacteria 6026
171 Ga0466968_0003131 3300044735 Bacteria 6104
172 Ga0466970_0010715 3300044765 Bacteria 4660
173 Ga0466970_0079454 3300044765 Bacteria 1771
174 Ga0466957_0000643 3300044842 Bacteria 17696
175 Ga0466957_0124805 3300044842 Bacteria 1644
176 Ga0466960_0015726 3300044901 Bacteria 3269
177 Ga0466960_0054634 3300044901 Bacteria 1940
178 Ga0466959_0003748 3300045049 Bacteria 10058
179 Ga0466959_0046706 3300045049 Bacteria 3186
180 Ga0466959_0068805 3300045049 Bacteria 2565
181 Ga0466958_0003045 3300045836 Bacteria 8592
182 Ga0466958_0029990 3300045836 Bacteria 3227
183 Ga0466958_0032776 3300045836 Bacteria 3092
184 Ga0466958_0058301 3300045836 Bacteria 2348
185 Ga0466958_0077993 3300045836 Bacteria 2035
186 Ga0466967_0000239 3300045976 Bacteria 23946
187 Ga0466967_0006042 3300045976 Bacteria 8513
188 Ga0466967_0015906 3300045976 Bacteria 5913
189 Ga0466967_0027778 3300045976 Bacteria 4711
190 Ga0466967_0055578 3300045976 Bacteria 3487
191 Ga0466967_0073674 3300045976 Bacteria 3064
192 Ga0466967_0074904 3300045976 Bacteria 3041
193 Ga0466967_0111465 3300045976 Bacteria 2514
194 Ga0466967_0193087 3300045976 Bacteria 1925
195 Ga0466967_0203536 3300045976 Bacteria 1875
196 Ga0466967_0242453 3300045976 Bacteria 1720
197 Ga0466967_0252195 3300045976 Bacteria 1686
198 Ga0466967_0271983 3300045976 Bacteria 1623
199 Ga0466967_0581358 3300045976 Bacteria 1104
200 Ga0495592_0051754 3300046454 Bacteria 3050
201 Ga0495592_0053932 3300046454 Bacteria 2981
202 Ga0495629_0001938 3300046459 Bacteria 16126
203 Ga0495641_0021867 3300046461 Bacteria 3210
204 Ga0495651_0114808 3300046462 Bacteria 1986
205 Ga0495653_0012563 3300046463 Bacteria 6915
206 Ga0495582_0004888 3300046473 Bacteria 7509
207 Ga0495639_0022756 3300046475 Bacteria 2750
208 Ga0495608_0011646 3300046511 Bacteria 6117
209 Ga0495608_0238286 3300046511 Unclassified 1137
210 Ga0495618_0039809 3300046514 Bacteria 2956
211 Ga0495618_0125350 3300046514 Unclassified 1645
212 Ga0495630_0051129 3300046517 Bacteria 3092
213 Ga0495630_0076246 3300046517 Unclassified 2526
214 Ga0495630_0314646 3300046517 Bacteria 1197
215 Ga0495652_0158123 3300046529 Bacteria 1762
216 Ga0495665_0007008 3300046531 Bacteria 6083
217 Ga0495640_0064977 3300046533 Unclassified 2465
218 Ga0495587_0012432 3300046536 Bacteria 5358
219 Ga0495587_0092334 3300046536 Unclassified 1748
220 Ga0495645_0009673 3300046543 Bacteria 6744
221 Ga0495645_0150406 3300046543 Unclassified 1618
222 Ga0495667_0034129 3300046559 Bacteria 3401
223 Ga0495634_0288853 3300046642 Bacteria 994
224 Ga0495635_0002577 3300046663 Bacteria 12403
225 Ga0495657_0081109 3300046675 Unclassified 2098
226 Ga0495657_0101044 3300046675 Unclassified 1838
227 Ga0495623_0006039 3300046679 Bacteria 7875
228 Ga0495658_0003977 3300046683 Bacteria 7285
229 Ga0495613_0002564 3300046689 Bacteria 13678
230 Ga0495624_0031532 3300046690 Bacteria 3444
231 Ga0495624_0223968 3300046690 Bacteria 1140
232 Ga0495600_0011272 3300046809 Bacteria 5567
233 Ga0495600_0066608 3300046809 Unclassified 2354
234 Ga0495581_0000984 3300047315 Bacteria 15315
235 Ga0495604_0004516 3300047317 Bacteria 11025
236 Ga0495604_0093919 3300047317 Unclassified 2218
237 Ga0495674_0042462 3300047319 Bacteria 4056
238 Ga0495676_0002379 3300047321 Bacteria 16690
239 Ga0495680_0003087 3300047322 Bacteria 16597
240 Ga0495680_0009861 3300047322 Bacteria 8561
241 Ga0495680_0017324 3300047322 Bacteria 6156
242 Ga0495675_0033462 3300047444 Bacteria 3281
243 Ga0495684_0017746 3300047471 Bacteria 5480
244 Ga0495593_0011224 3300047673 Bacteria 5150
245 Ga0495602_0023582 3300048088 Bacteria 5992
246 Ga0495614_0060145 3300048089 Bacteria 1632
247 Ga0496100_0074564 3300048903 Bacteria 2274
248 Ga0496101_0011410 3300048904 Bacteria 5894
249 Ga0496101_0045825 3300048904 Bacteria 3134
250 Ga0496102_0091367 3300048905 Bacteria 2818
251 Ga0496102_0194724 3300048905 Unclassified 1910
252 Ga0496102_0548881 3300048905 Bacteria 1078
253 Ga0496104_0065794 3300048907 Bacteria 3441
254 Ga0496104_0146914 3300048907 Bacteria 2264
255 Ga0496105_0120838 3300048908 Bacteria 2160
256 Ga0496105_0123403 3300048908 Bacteria 2135
257 Ga0496106_0026674 3300048909 Bacteria 4303
258 Ga0496107_0016322 3300048910 Bacteria 5212
259 Ga0496107_0113766 3300048910 Bacteria 1990
260 Ga0496109_0077688 3300048912 Bacteria 3055
261 Ga0496110_0047484 3300048913 Bacteria 3760
262 Ga0496110_0286552 3300048913 Unclassified 1500
263 Ga0496111_0277506 3300048914 Bacteria 1243
264 Ga0496112_0005577 3300048915 Bacteria 10912
265 Ga0496112_0021376 3300048915 Bacteria 6153
266 Ga0496112_0064335 3300048915 Bacteria 3619
267 Ga0496114_0033092 3300048917 Bacteria 4258
268 Ga0496114_0124505 3300048917 Bacteria 2220
269 Ga0496115_0049241 3300048918 Bacteria 3372
270 Ga0496115_0072166 3300048918 Bacteria 2801
271 Ga0496115_0072902 3300048918 Bacteria 2786
272 Ga0501031_0000099 3300049568 Bacteria 45863
273 Ga0501031_0006329 3300049568 Bacteria 7718
274 Ga0501031_0297927 3300049568 Bacteria 1045
275 Ga0501032_0000953 3300049569 Bacteria 23370
276 Ga0501032_0172075 3300049569 Bacteria 1420
277 Ga0501033_0001313 3300049570 Bacteria 22078
278 Ga0501033_0005034 3300049570 Bacteria 10523
279 Ga0501034_0005240 3300049571 Bacteria 14226
280 Ga0501034_0006417 3300049571 Bacteria 12668
281 Ga0501036_0000068 3300049572 Bacteria 65696
282 Ga0501036_0000393 3300049572 Bacteria 30816
283 Ga0501036_0030668 3300049572 Bacteria 4541
284 Ga0501037_0000199 3300049573 Bacteria 53953
285 Ga0501038_0000087 3300049574 Bacteria 78741
286 Ga0501038_0033162 3300049574 Bacteria 4549
287 Ga0501039_0000136 3300049575 Bacteria 50622
288 Ga0501039_0017617 3300049575 Bacteria 5479
289 Ga0501040_0000007 3300049576 Bacteria 90368
290 Ga0501040_0007922 3300049576 Bacteria 6890
291 Ga0501040_0026709 3300049576 Bacteria 3883
292 Ga0501040_0086660 3300049576 Bacteria 2174
293 Ga0501041_0000110 3300049577 Bacteria 34416
294 Ga0501041_0000480 3300049577 Bacteria 20357
295 Ga0501042_0000001 3300049578 Bacteria 81519
296 Ga0501042_0020079 3300049578 Bacteria 4647
297 Ga0501042_0047168 3300049578 Bacteria 3072
298 Ga0501043_0000472 3300049579 Bacteria 35926
299 Ga0501046_0000506 3300049580 Bacteria 38963
300 Ga0501046_0003673 3300049580 Bacteria 14061
301 Ga0501046_0129895 3300049580 Bacteria 1911
302 Ga0501047_0006576 3300049581 Bacteria 10941
303 Ga0501047_0041450 3300049581 Bacteria 4448
304 Ga0501048_0000018 3300049582 Bacteria 72234
305 Ga0501048_0012872 3300049582 Bacteria 6214
306 Ga0501067_0000435 3300049583 Bacteria 22847
307 Ga0501067_0006592 3300049583 Bacteria 6437
308 Ga0501068_0000036 3300049584 Bacteria 49620
309 Ga0501068_0005842 3300049584 Bacteria 6752
310 Ga0501068_0055289 3300049584 Bacteria 2405
311 Ga0501069_0002375 3300049585 Bacteria 9549
312 Ga0501069_0005429 3300049585 Bacteria 6627
313 Ga0501069_0036928 3300049585 Bacteria 2695
314 Ga0501070_0000049 3300049586 Bacteria 104564
315 Ga0501070_0002648 3300049586 Bacteria 15628
316 Ga0501070_0050428 3300049586 Bacteria 3455
317 Ga0501070_0137172 3300049586 Bacteria 2020
318 Ga0501071_0000005 3300049587 Bacteria 78747
319 Ga0501071_0000641 3300049587 Bacteria 18199
320 Ga0501072_0000136 3300049588 Bacteria 55293
321 Ga0501072_0000234 3300049588 Bacteria 40907
322 Ga0501072_0000860 3300049588 Bacteria 22296
323 Ga0501072_0076087 3300049588 Bacteria 2655
324 Ga0501073_0000180 3300049589 Bacteria 41534
325 Ga0501073_0059625 3300049589 Bacteria 2665
326 Ga0501074_0000033 3300049590 Bacteria 65097
327 Ga0501074_0004749 3300049590 Bacteria 9741
328 Ga0501074_0032450 3300049590 Bacteria 3784
329 Ga0501074_0092474 3300049590 Bacteria 2166
330 Ga0501074_0115796 3300049590 Bacteria 1917
331 Ga0501075_0000009 3300049591 Bacteria 97052
332 Ga0501075_0000458 3300049591 Bacteria 24222
333 Ga0501075_0001352 3300049591 Bacteria 15935
334 Ga0501076_0000028 3300049592 Bacteria 76828
335 Ga0501076_0000308 3300049592 Bacteria 30507
336 Ga0501076_0001425 3300049592 Bacteria 16047
337 Ga0501077_0000006 3300049593 Bacteria 119936
338 Ga0501077_0009398 3300049593 Bacteria 6075
339 Ga0501079_0000042 3300049741 Bacteria 54031
340 Ga0501079_0000237 3300049741 Bacteria 33098
341 Ga0501079_0020236 3300049741 Bacteria 5087
342 Ga0501079_0148655 3300049741 Bacteria 1826
343 Ga0501080_0000108 3300049742 Bacteria 57463
344 Ga0501080_0040151 3300049742 Bacteria 4366
345 Ga0501080_0436528 3300049742 Bacteria 1175
346 Ga0501081_0000003 3300049743 Bacteria 97558
347 Ga0501081_0000041 3300049743 Bacteria 48097
348 Ga0501081_0067186 3300049743 Bacteria 2494
349 Ga0501081_0097229 3300049743 Bacteria 2077
350 Ga0501081_0196156 3300049743 Bacteria 1463
351 Ga0501083_0000502 3300049744 Bacteria 24990
352 Ga0501035_0000175 3300049822 Bacteria 78747
353 Ga0501035_0077614 3300049822 Bacteria 2935
354 Ga0501035_0201640 3300049822 Bacteria 1706
355 Ga0501044_0008133 3300049823 Bacteria 11510
356 Ga0501044_0022463 3300049823 Bacteria 6721
357 Ga0501045_0000254 3300049824 Bacteria 30765
358 Ga0501045_0002198 3300049824 Bacteria 13217
359 Ga0501045_0046354 3300049824 Bacteria 3165
360 Ga0501045_0057437 3300049824 Bacteria 2847
361 nmdc:mga05p37_9082_c1 3300050507 Bacteria 11747
362 nmdc:mga09592_7960_c1 3300050508 Bacteria 8612
363 nmdc:mga0qj67_63267_c1 3300050509 Bacteria 2942
364 nmdc:mga08y16_140289_c1 3300050511 Bacteria 2513
365 nmdc:mga08x19_26262_c1 3300050514 Bacteria 3632
366 Ga0495601_0047050 3300053077 Bacteria 2715
367 Ga0495612_0113309 3300053078 Unclassified 1162
368 Ga0495612_0144161 3300053078 Bacteria 1034
369 Ga0495595_0004666 3300053084 Bacteria 5514
370 Ga0495619_0017276 3300053085 Bacteria 4568
371 Ga0495619_0030725 3300053085 Bacteria 3477
372 Ga0501084_0000092 3300054114 Bacteria 65632
373 Ga0501084_0000188 3300054114 Bacteria 48053
374 Ga0501084_0026961 3300054114 Bacteria 4800
375 Ga0501082_0000216 3300060353 Bacteria 50415
376 Ga0501082_0003433 3300060353 Bacteria 13831
377 Ga0501082_0091407 3300060353 Bacteria 2628
378 Ga0466962_0000105 3300061719 Bacteria 34251
379 Ga0530510_0000014 3300061734 Bacteria 106661
380 Ga0530510_0000262 3300061734 Bacteria 33215
381 Ga0530510_0000696 3300061734 Bacteria 21768
382 Ga0530510_0003138 3300061734 Bacteria 11349
383 Ga0530510_0082132 3300061734 Bacteria 2347
384 Ga0395901_0146281
385 JGI25407J50210_10001088
386 JGI25407J50210_10013454
387 JGI25407J50210_10037635
388 Ga0070658_10054755
389 Ga0070658_10115086
390 Ga0070658_10424213
391 Ga0070683_100002112
392 Ga0070683_100031333
393 Ga0070683_100076447
394 Ga0070683_100155604
395 Ga0070680_100002340
396 Ga0070680_100005282
397 Ga0070680_100108828
398 Ga0070680_100115292
399 Ga0070682_100080374
400 Ga0070660_100001872
401 Ga0070660_100003645
402 Ga0070660_100005099
403 Ga0070660_100052328
404 Ga0070660_100170579
405 Ga0070661_100109476
406 Ga0070661_100148936
407 Ga0070661_100183343
408 Ga0070671_100294705
409 Ga0070659_100019778
410 Ga0070714_100147935
411 Ga0070713_100099969
412 Ga0070663_100137794
413 Ga0070663_100140719
414 Ga0070681_10001749
415 Ga0070681_10055059
416 Ga0070681_10058835
417 Ga0070681_10155919
418 Ga0070707_100494987
419 Ga0070679_100019856
420 Ga0070679_100091197
421 Ga0070679_100129481
422 Ga0070684_100006051
423 Ga0070684_100064771
424 Ga0070684_100285108
425 Ga0068853_100102099
426 Ga0068853_100142172
427 Ga0070665_100007776
428 Ga0068855_100016807
429 Ga0068855_100058375
430 Ga0068855_100058505
431 Ga0068855_100082196
432 Ga0068855_100535925
433 Ga0070664_100255493
434 Ga0068857_100004349
435 Ga0068857_100034831
436 Ga0068857_100048030
437 Ga0068857_100319321
438 Ga0068856_100063809
439 Ga0068856_100077855
440 Ga0068852_100028710
441 Ga0068852_100238168
442 Ga0081455_10182381
443 Ga0081538_10001009
444 Ga0081538_10002042
445 Ga0081538_10002956
446 Ga0081538_10007344
447 Ga0075432_10032363
448 Ga0075428_100009522
449 Ga0075430_100116612
450 Ga0075429_100011193
451 Ga0075436_100104234
452 Ga0105240_10107388
453 Ga0105240_10272467
454 Ga0105240_10282134
455 Ga0111539_10015598
456 Ga0105241_10197843
457 Ga0105241_10243557
458 Ga0105242_10081875
459 Ga0105237_10116325
460 Ga0105238_10040636
461 Ga0105239_10112109
462 Ga0157373_10077476
463 Ga0157370_10005431
464 Ga0157370_10022199
465 Ga0157370_10038885
466 Ga0157370_10170414
467 Ga0157370_10244965
468 Ga0157369_10002266
469 Ga0157369_10003630
470 Ga0157369_10092014
471 Ga0157369_10104505
472 Ga0157369_10123760
473 Ga0157374_10145439
474 Ga0157372_10126542
475 Ga0157375_10496175
476 Ga0206356_10435686
477 Ga0206353_10001931
478 Ga0206353_10110823
479 Ga0206353_12040575
480 Ga0207707_10003849
481 Ga0207707_10034498
482 Ga0207707_10056792
483 Ga0207707_10134362
484 Ga0207695_10255537
485 Ga0207695_10470644
486 Ga0207671_10066603
487 Ga0207660_10066132
488 Ga0207660_10308208
489 Ga0207657_10000299
490 Ga0207657_10005518
491 Ga0207657_10011682
492 Ga0207657_10072398
493 Ga0207657_10187946
494 Ga0207649_10039582
495 Ga0207649_10206422
496 Ga0207652_10020309
497 Ga0207652_10070790
498 Ga0207652_10152393
499 Ga0207652_10318486
500 Ga0207694_10040166
501 Ga0207700_10073768
502 Ga0207700_10344786
503 Ga0207664_10025823
504 Ga0207664_10198979
505 Ga0207690_10078865
506 Ga0207690_10086232
507 Ga0207661_10020403
508 Ga0207661_10055341
509 Ga0207667_10212883
510 Ga0207667_10239701
511 Ga0207667_10324821
512 Ga0207639_10058522
513 Ga0207639_10105561
514 Ga0207678_10049607
515 Ga0207674_10060742
516 Ga0207698_10027583
517 Ga0207428_10079389
518 Ga0268266_10033213
519 Ga0265322_10026375
520 Ga0373943_0000818
521 Ga0373955_0031491
522 Ga0373924_0056586
523 Ga0373937_0024016
524 Ga0395899_0129921
525 Ga0395899_0186975
526 Ga0395900_0024603
527 Ga0395900_0065988
528 Ga0395900_0068293
529 Ga0395900_0184352
530 Ga0395900_0451181
531 Ga0395898_0003654
532 Ga0395898_0103262
533 Ga0395898_0106057
534 Ga0395898_0291995
535 Ga0395905_0347288
536 Ga0395905_0443232
537 Ga0395901_0002691
538 Ga0395901_0004023
539 Ga0395901_0084166
540 Ga0466965_0054243
541 Ga0466966_0012527
542 Ga0466966_0049410
543 Ga0466966_0132012
544 Ga0466963_0000397
545 Ga0466963_0003568
546 Ga0466963_0024031
547 Ga0466963_0120845
548 Ga0466963_0159354
549 Ga0466963_0262595
550 Ga0466964_0006273
551 Ga0466964_0017205
552 Ga0466971_0000419
553 Ga0466971_0004499
554 Ga0466968_0003131
555 Ga0466970_0010715
556 Ga0466970_0079454
557 Ga0466957_0000643
558 Ga0466957_0124805
559 Ga0466960_0015726
560 Ga0466960_0054634
561 Ga0466959_0003748
562 Ga0466959_0046706
563 Ga0466959_0068805
564 Ga0466958_0003045
565 Ga0466958_0029990
566 Ga0466958_0032776
567 Ga0466958_0058301
568 Ga0466958_0077993
569 Ga0466967_0000239
570 Ga0466967_0006042
571 Ga0466967_0015906
572 Ga0466967_0027778
573 Ga0466967_0055578
574 Ga0466967_0073674
575 Ga0466967_0074904
576 Ga0466967_0111465
577 Ga0466967_0193087
578 Ga0466967_0203536
579 Ga0466967_0242453
580 Ga0466967_0252195
581 Ga0466967_0271983
582 Ga0466967_0581358
583 Ga0495592_0051754
584 Ga0495592_0053932
585 Ga0495629_0001938
586 Ga0495641_0021867
587 Ga0495651_0114808
588 Ga0495653_0012563
589 Ga0495582_0004888
590 Ga0495639_0022756
591 Ga0495608_0011646
592 Ga0495608_0238286
593 Ga0495618_0039809
594 Ga0495618_0125350
595 Ga0495630_0051129
596 Ga0495630_0076246
597 Ga0495630_0314646
598 Ga0495652_0158123
599 Ga0495665_0007008
600 Ga0495640_0064977
601 Ga0495587_0012432
602 Ga0495587_0092334
603 Ga0495645_0009673
604 Ga0495645_0150406
605 Ga0495667_0034129
606 Ga0495634_0288853
607 Ga0495635_0002577
608 Ga0495657_0081109
609 Ga0495657_0101044
610 Ga0495623_0006039
611 Ga0495658_0003977
612 Ga0495613_0002564
613 Ga0495624_0031532
614 Ga0495624_0223968
615 Ga0495600_0011272
616 Ga0495600_0066608
617 Ga0495581_0000984
618 Ga0495604_0004516
619 Ga0495604_0093919
620 Ga0495674_0042462
621 Ga0495676_0002379
622 Ga0495680_0003087
623 Ga0495680_0009861
624 Ga0495680_0017324
625 Ga0495675_0033462
626 Ga0495684_0017746
627 Ga0495593_0011224
628 Ga0495602_0023582
629 Ga0495614_0060145
630 Ga0496100_0074564
631 Ga0496101_0011410
632 Ga0496101_0045825
633 Ga0496102_0091367
634 Ga0496102_0194724
635 Ga0496102_0548881
636 Ga0496104_0065794
637 Ga0496104_0146914
638 Ga0496105_0120838
639 Ga0496105_0123403
640 Ga0496106_0026674
641 Ga0496107_0016322
642 Ga0496107_0113766
643 Ga0496109_0077688
644 Ga0496110_0047484
645 Ga0496110_0286552
646 Ga0496111_0277506
647 Ga0496112_0005577
648 Ga0496112_0021376
649 Ga0496112_0064335
650 Ga0496114_0033092
651 Ga0496114_0124505
652 Ga0496115_0049241
653 Ga0496115_0072166
654 Ga0496115_0072902
655 Ga0501031_0000099
656 Ga0501031_0006329
657 Ga0501031_0297927
658 Ga0501032_0000953
659 Ga0501032_0172075
660 Ga0501033_0001313
661 Ga0501033_0005034
662 Ga0501034_0005240
663 Ga0501034_0006417
664 Ga0501036_0000068
665 Ga0501036_0000393
666 Ga0501036_0030668
667 Ga0501037_0000199
668 Ga0501038_0000087
669 Ga0501038_0033162
670 Ga0501039_0000136
671 Ga0501039_0017617
672 Ga0501040_0000007
673 Ga0501040_0007922
674 Ga0501040_0026709
675 Ga0501040_0086660
676 Ga0501041_0000110
677 Ga0501041_0000480
678 Ga0501042_0000001
679 Ga0501042_0020079
680 Ga0501042_0047168
681 Ga0501043_0000472
682 Ga0501046_0000506
683 Ga0501046_0003673
684 Ga0501046_0129895
685 Ga0501047_0006576
686 Ga0501047_0041450
687 Ga0501048_0000018
688 Ga0501048_0012872
689 Ga0501067_0000435
690 Ga0501067_0006592
691 Ga0501068_0000036
692 Ga0501068_0005842
693 Ga0501068_0055289
694 Ga0501069_0002375
695 Ga0501069_0005429
696 Ga0501069_0036928
697 Ga0501070_0000049
698 Ga0501070_0002648
699 Ga0501070_0050428
700 Ga0501070_0137172
701 Ga0501071_0000005
702 Ga0501071_0000641
703 Ga0501072_0000136
704 Ga0501072_0000234
705 Ga0501072_0000860
706 Ga0501072_0076087
707 Ga0501073_0000180
708 Ga0501073_0059625
709 Ga0501074_0000033
710 Ga0501074_0004749
711 Ga0501074_0032450
712 Ga0501074_0092474
713 Ga0501074_0115796
714 Ga0501075_0000009
715 Ga0501075_0000458
716 Ga0501075_0001352
717 Ga0501076_0000028
718 Ga0501076_0000308
719 Ga0501076_0001425
720 Ga0501077_0000006
721 Ga0501077_0009398
722 Ga0501079_0000042
723 Ga0501079_0000237
724 Ga0501079_0020236
725 Ga0501079_0148655
726 Ga0501080_0000108
727 Ga0501080_0040151
728 Ga0501080_0436528
729 Ga0501081_0000003
730 Ga0501081_0000041
731 Ga0501081_0067186
732 Ga0501081_0097229
733 Ga0501081_0196156
734 Ga0501083_0000502
735 Ga0501035_0000175
736 Ga0501035_0077614
737 Ga0501035_0201640
738 Ga0501044_0008133
739 Ga0501044_0022463
740 Ga0501045_0000254
741 Ga0501045_0002198
742 Ga0501045_0046354
743 Ga0501045_0057437
744 nmdc:mga05p37_9082_c1
745 nmdc:mga09592_7960_c1
746 nmdc:mga0qj67_63267_c1
747 nmdc:mga08y16_140289_c1
748 nmdc:mga08x19_26262_c1
749 Ga0495601_0047050
750 Ga0495612_0113309
751 Ga0495612_0144161
752 Ga0495595_0004666
753 Ga0495619_0017276
754 Ga0495619_0030725
755 Ga0501084_0000092
756 Ga0501084_0000188
757 Ga0501084_0026961
758 Ga0501082_0000216
759 Ga0501082_0003433
760 Ga0501082_0091407
761 Ga0466962_0000105
762 Ga0530510_0000014
763 Ga0530510_0000262
764 Ga0530510_0000696
765 Ga0530510_0003138
766 Ga0530510_0082132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

5

250

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5582 5 251
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.546 5 251
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5338 5 251
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5248 5 251
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.4358 33 255
ID Description Score Start End Superfamily
af_Q2G0C4_6_197_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4664 6 258 1.20.1250.20
af_Q5U419_3_402_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4519 25 256 1.20.1250.20
af_Q6DBX0_304_491_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4386 5 259 1.20.1250.20
af_Q2G0C4_6_197_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.436 6 258 1.20.1250.20
af_Q59XM0_407_678_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4336 26 259 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7V9I6J4-F1-model_v4 Probable membrane transporter protein 0.9224 5 293 GO:0005886
AF-A0A0D0SR35-F1-model_v4 Probable membrane transporter protein 0.9195 6 257 GO:0005886
AF-A0A1L3MMD8-F1-model_v4 Probable membrane transporter protein 0.9188 6 255 GO:0005886
AF-A0A7X9JHC0-F1-model_v4 Probable membrane transporter protein 0.9154 38 258 GO:0005886
AF-A0A5S9IUJ4-F1-model_v4 Probable membrane transporter protein 0.9127 6 255 GO:0005886

Map